Basic Information | |
---|---|
Family ID | F073326 |
Family Type | Metagenome |
Number of Sequences | 120 |
Average Sequence Length | 42 residues |
Representative Sequence | MRAKYRAWSEWQNPDFVAKAGEQPTRPSGGNDYQIRYKLDYQDR |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.83 % |
% of genes near scaffold ends (potentially truncated) | 79.17 % |
% of genes from short scaffolds (< 2000 bps) | 86.67 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.17 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.167 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.167 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.833 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.500 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.94% β-sheet: 0.00% Coil/Unstructured: 93.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF10609 | ParA | 43.33 |
PF01883 | FeS_assembly_P | 31.67 |
PF08695 | Coa1 | 5.00 |
PF13614 | AAA_31 | 3.33 |
PF00156 | Pribosyltran | 3.33 |
PF02729 | OTCace_N | 2.50 |
PF04073 | tRNA_edit | 0.83 |
PF13224 | DUF4032 | 0.83 |
PF01979 | Amidohydro_1 | 0.83 |
PF01797 | Y1_Tnp | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.17 % |
Unclassified | root | N/A | 0.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459002|FZY7DQ102GNR3R | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 540 | Open in IMG/M |
3300000709|KanNP_Total_F14TBDRAFT_1013204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 631 | Open in IMG/M |
3300000709|KanNP_Total_F14TBDRAFT_1025545 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
3300000955|JGI1027J12803_106734624 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 979 | Open in IMG/M |
3300000955|JGI1027J12803_107210853 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
3300001593|JGI12635J15846_10136184 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1707 | Open in IMG/M |
3300001661|JGI12053J15887_10027830 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 3173 | Open in IMG/M |
3300002914|JGI25617J43924_10033122 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1847 | Open in IMG/M |
3300004156|Ga0062589_101405400 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 681 | Open in IMG/M |
3300004479|Ga0062595_100902314 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 745 | Open in IMG/M |
3300005166|Ga0066674_10303695 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 750 | Open in IMG/M |
3300005172|Ga0066683_10830192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 535 | Open in IMG/M |
3300005174|Ga0066680_10033865 | All Organisms → cellular organisms → Bacteria | 2908 | Open in IMG/M |
3300005175|Ga0066673_10243712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1039 | Open in IMG/M |
3300005176|Ga0066679_10007444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5225 | Open in IMG/M |
3300005186|Ga0066676_10290682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1078 | Open in IMG/M |
3300005186|Ga0066676_10650744 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300005186|Ga0066676_11001754 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
3300005293|Ga0065715_10642192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 664 | Open in IMG/M |
3300005437|Ga0070710_10959196 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 621 | Open in IMG/M |
3300005445|Ga0070708_100643679 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 999 | Open in IMG/M |
3300005445|Ga0070708_101425383 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 646 | Open in IMG/M |
3300005447|Ga0066689_10627210 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 677 | Open in IMG/M |
3300005467|Ga0070706_100409201 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1263 | Open in IMG/M |
3300005554|Ga0066661_10636297 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 630 | Open in IMG/M |
3300005555|Ga0066692_10251718 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1115 | Open in IMG/M |
3300005555|Ga0066692_10914218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 537 | Open in IMG/M |
3300005556|Ga0066707_10260062 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1134 | Open in IMG/M |
3300005561|Ga0066699_10729609 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 704 | Open in IMG/M |
3300005569|Ga0066705_10401414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 859 | Open in IMG/M |
3300005598|Ga0066706_10656565 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 833 | Open in IMG/M |
3300005764|Ga0066903_101853281 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1154 | Open in IMG/M |
3300005764|Ga0066903_102055664 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1099 | Open in IMG/M |
3300005764|Ga0066903_104597784 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 735 | Open in IMG/M |
3300005937|Ga0081455_10094092 | All Organisms → cellular organisms → Bacteria | 2421 | Open in IMG/M |
3300006796|Ga0066665_10237678 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1434 | Open in IMG/M |
3300006796|Ga0066665_11501826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
3300006800|Ga0066660_10418663 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300006904|Ga0075424_102542438 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
3300007076|Ga0075435_101849835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 530 | Open in IMG/M |
3300009093|Ga0105240_11634351 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 674 | Open in IMG/M |
3300009094|Ga0111539_11601370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 755 | Open in IMG/M |
3300009137|Ga0066709_100186324 | All Organisms → cellular organisms → Bacteria | 2708 | Open in IMG/M |
3300009157|Ga0105092_10683105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 596 | Open in IMG/M |
3300009792|Ga0126374_11423207 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
3300010048|Ga0126373_10977523 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 912 | Open in IMG/M |
3300010320|Ga0134109_10201108 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 735 | Open in IMG/M |
3300010326|Ga0134065_10047391 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1313 | Open in IMG/M |
3300010326|Ga0134065_10207846 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 712 | Open in IMG/M |
3300010362|Ga0126377_13142938 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
3300010362|Ga0126377_13170011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 531 | Open in IMG/M |
3300010366|Ga0126379_13140162 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 553 | Open in IMG/M |
3300010376|Ga0126381_104682360 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 527 | Open in IMG/M |
3300010863|Ga0124850_1028000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1809 | Open in IMG/M |
3300012198|Ga0137364_11132620 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
3300012198|Ga0137364_11372837 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
3300012199|Ga0137383_10295638 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1186 | Open in IMG/M |
3300012200|Ga0137382_11322653 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 508 | Open in IMG/M |
3300012204|Ga0137374_10139438 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 2189 | Open in IMG/M |
3300012210|Ga0137378_10037810 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4309 | Open in IMG/M |
3300012210|Ga0137378_11171295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 684 | Open in IMG/M |
3300012211|Ga0137377_11408730 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 625 | Open in IMG/M |
3300012285|Ga0137370_10217692 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1124 | Open in IMG/M |
3300012349|Ga0137387_10847557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 661 | Open in IMG/M |
3300012356|Ga0137371_10449473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 997 | Open in IMG/M |
3300012356|Ga0137371_11380408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
3300012361|Ga0137360_10079751 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2451 | Open in IMG/M |
3300012362|Ga0137361_11492225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 598 | Open in IMG/M |
3300012924|Ga0137413_11292389 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 585 | Open in IMG/M |
3300012930|Ga0137407_10131086 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2191 | Open in IMG/M |
3300012948|Ga0126375_10821470 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 738 | Open in IMG/M |
3300012971|Ga0126369_11591238 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 743 | Open in IMG/M |
3300012972|Ga0134077_10094792 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1150 | Open in IMG/M |
3300012972|Ga0134077_10147621 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 937 | Open in IMG/M |
3300012976|Ga0134076_10113929 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1083 | Open in IMG/M |
3300014154|Ga0134075_10261970 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 749 | Open in IMG/M |
3300014157|Ga0134078_10002162 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 5101 | Open in IMG/M |
3300014157|Ga0134078_10333540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 662 | Open in IMG/M |
3300015241|Ga0137418_10578398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 885 | Open in IMG/M |
3300015357|Ga0134072_10474831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 509 | Open in IMG/M |
3300015359|Ga0134085_10224334 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 813 | Open in IMG/M |
3300016341|Ga0182035_10661833 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 907 | Open in IMG/M |
3300016371|Ga0182034_10517122 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 998 | Open in IMG/M |
3300016387|Ga0182040_11205808 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 637 | Open in IMG/M |
3300018071|Ga0184618_10181762 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 873 | Open in IMG/M |
3300018433|Ga0066667_10630087 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 896 | Open in IMG/M |
3300019362|Ga0173479_10521935 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
3300019875|Ga0193701_1011685 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1747 | Open in IMG/M |
3300020012|Ga0193732_1048983 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 722 | Open in IMG/M |
3300020199|Ga0179592_10140573 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1106 | Open in IMG/M |
3300022898|Ga0247745_1044759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 689 | Open in IMG/M |
3300024347|Ga0179591_1300357 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300025972|Ga0207668_10545925 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1003 | Open in IMG/M |
3300025972|Ga0207668_10980861 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 754 | Open in IMG/M |
3300026295|Ga0209234_1024241 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2300 | Open in IMG/M |
3300026306|Ga0209468_1161556 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
3300026307|Ga0209469_1063414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1138 | Open in IMG/M |
3300026307|Ga0209469_1077877 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 995 | Open in IMG/M |
3300026323|Ga0209472_1025247 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2781 | Open in IMG/M |
3300026327|Ga0209266_1093606 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1331 | Open in IMG/M |
3300026328|Ga0209802_1048965 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2102 | Open in IMG/M |
3300026335|Ga0209804_1249867 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 664 | Open in IMG/M |
3300026515|Ga0257158_1056272 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 733 | Open in IMG/M |
3300026548|Ga0209161_10127641 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1496 | Open in IMG/M |
3300026548|Ga0209161_10464539 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 557 | Open in IMG/M |
3300026557|Ga0179587_10267136 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1097 | Open in IMG/M |
3300027480|Ga0208993_1024130 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1073 | Open in IMG/M |
3300027577|Ga0209874_1075448 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 832 | Open in IMG/M |
3300027681|Ga0208991_1000470 | All Organisms → cellular organisms → Bacteria | 10145 | Open in IMG/M |
3300028536|Ga0137415_10066310 | All Organisms → cellular organisms → Bacteria | 3474 | Open in IMG/M |
3300028784|Ga0307282_10065665 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1642 | Open in IMG/M |
3300028824|Ga0307310_10305090 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 775 | Open in IMG/M |
3300028881|Ga0307277_10417538 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 600 | Open in IMG/M |
3300031231|Ga0170824_124677726 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
3300031446|Ga0170820_13893204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 624 | Open in IMG/M |
3300031469|Ga0170819_12078249 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 558 | Open in IMG/M |
3300031680|Ga0318574_10963378 | Not Available | 500 | Open in IMG/M |
3300031740|Ga0307468_100018341 | All Organisms → cellular organisms → Bacteria | 3013 | Open in IMG/M |
3300031962|Ga0307479_10666235 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1021 | Open in IMG/M |
3300032174|Ga0307470_11532851 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.17% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.33% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.50% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.50% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.83% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E1_08161300 | 2170459002 | Grass Soil | MKAKYRAWSEWQNPDFVAKASEPPSRFSDGIDYEIRYKLDYQKR |
KanNP_Total_F14TBDRAFT_10132042 | 3300000709 | Soil | MKAKYRAWSDWQKPDYIAKGGEQPSRASRGSDYQIRYKLDYQDR* |
KanNP_Total_F14TBDRAFT_10255452 | 3300000709 | Soil | MRAKYRAWSDWQKPDYVAKGGEQPSRASSGSDYQIRYKLDYHDR* |
JGI1027J12803_1067346242 | 3300000955 | Soil | WSDWRNPDFVAKAGEQPSRFSGGSDYQIRYKLDYQDR* |
JGI1027J12803_1072108532 | 3300000955 | Soil | WSEWKNPNFVAKGGEQPTLPCGGSDYQIRYKLDYQDR* |
JGI12635J15846_101361842 | 3300001593 | Forest Soil | MKPKYRDWSEWQKPDFVAKGGQQPSHPSSGSEYEIRYKLEYQDR* |
JGI12053J15887_100278304 | 3300001661 | Forest Soil | MKPKYRDWSEWQKPDFVAKGGQQPSHPSSGSEYEIRYKLEYQDW* |
JGI25617J43924_100331222 | 3300002914 | Grasslands Soil | MRAKYRAWSEWQNPDFVAKAGEQPTRPSGGNDYQIRYKLDYQDR* |
Ga0062589_1014054002 | 3300004156 | Soil | RAWSDWQNPDFVAKGGEQPSHPSGGNEYQIRYKMDYQDR* |
Ga0062595_1009023141 | 3300004479 | Soil | KAKYRAWSDWQKPDYIAKGGEQPSRASSGSDYQIRYKLDYQDR* |
Ga0066674_103036951 | 3300005166 | Soil | LSLPANPMSAKYRAWSDWKKPDFIAKGGEQPHPSTGIDYQIRYKVDYQDR* |
Ga0066683_108301921 | 3300005172 | Soil | RVWSEWQNPDFVAKAGEQPSRFSGGSDYLIRYKLDYRDR* |
Ga0066680_100338651 | 3300005174 | Soil | MKAKYRAWSDWQKPDFVAKAGEQPSRPSSGSDYQIRYKLDYQDR* |
Ga0066673_102437122 | 3300005175 | Soil | MREKYRAWSDWQNPDFVAKPGQQPSRPTGGSEYQIRYKMDYQDR* |
Ga0066679_100074448 | 3300005176 | Soil | MKSKYGNWSEWQNPDFVAKADQQPTRFSGGNDYQIRYKVDYQPR* |
Ga0066676_102906821 | 3300005186 | Soil | MKAKYRAWSEWQNPDFVAKAGEQPAHFSGGNDYQIRYKLDYQER* |
Ga0066676_106507442 | 3300005186 | Soil | MKAKYRAWSGWQKPDYIAKGGEQPSRPSSGSDYQIRYKLDYQDR* |
Ga0066676_110017541 | 3300005186 | Soil | NPMRAKYRAWSEWQNPDFVAKAGEQPTRPSGGSDYQIRYKMDYQDR* |
Ga0065715_106421922 | 3300005293 | Miscanthus Rhizosphere | ANPMKAKYRDWSQWQNPDFVAKAGEQPTRPSGGSDYQIRYKLDYQDR* |
Ga0070710_109591961 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | KYRAWSDWQNPDFVAKGGEQPSHPSGGNEYQIRYKMDYQDH* |
Ga0070708_1006436792 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ANPMRAKYRAWSDWQNPDFVAKGGERPSHPSGGNEYRIRYKMDYQDR* |
Ga0070708_1014253832 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVKYRSWSEWQKPDFVAKADQQPTRFSGGNDYQIRYRVDYQDR* |
Ga0066689_106272102 | 3300005447 | Soil | RSWSEWQKPDFVAKADQQPTPFSGGNDYQIRYRVDYQDR* |
Ga0070706_1004092012 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAKYRAWSDWKKPDFVAKAGEQPSRPSGGSDYQIRYKLDYR* |
Ga0066661_106362972 | 3300005554 | Soil | KYRAWSEWQNPDFVAKAGEHPTRFSGGNDYQIRYKLDYQDR* |
Ga0066692_102517181 | 3300005555 | Soil | WSDWQKPDFVAKAGEQPSRPSSGSDYQIRYKLDYQDR* |
Ga0066692_109142182 | 3300005555 | Soil | MKSKYGNWSEWQNPDFVAKADQQPTRFSGGNDYQIRYKVDYQDR* |
Ga0066707_102600622 | 3300005556 | Soil | MKAKYHTWSDWEKPDFVAKAGEQPSSPSGVNDYQIRSKLDYQDR* |
Ga0066699_107296092 | 3300005561 | Soil | LPANPMKASYRAWSGWQNPDFVAKAGEQPSPFSGGSDYQIRYKLDYQER* |
Ga0066705_104014141 | 3300005569 | Soil | YRAWSDWKKPDFVAKAGEQPSRPSGASDYQIRYKVDYQDQ* |
Ga0066706_106565651 | 3300005598 | Soil | YRAWSEWQNPDFVAKAGEQPAHFSGGNDYQIRYKLDYQER* |
Ga0066903_1018532812 | 3300005764 | Tropical Forest Soil | WSDWQNPDFVAKGGQQPSRPTGGNEYQIRYKMDYQER* |
Ga0066903_1020556642 | 3300005764 | Tropical Forest Soil | DWQNPDFVAKAGQQPSRPSGGNEYQIRYKMDYQDR* |
Ga0066903_1045977841 | 3300005764 | Tropical Forest Soil | MKTKFRAWSEWQNPDFVAKAGEQPARFSGGSDYQIHYKLDYQDR* |
Ga0081455_100940921 | 3300005937 | Tabebuia Heterophylla Rhizosphere | EWSNWQNPDYVAKKNEQPSRPSGGNDYQIRYRMDYQDR* |
Ga0066665_102376783 | 3300006796 | Soil | SEWQNPDFVAKGGEQPARFSGGSDYQIHYKLDYQDR* |
Ga0066665_115018262 | 3300006796 | Soil | AKYRGWSEWQNPDFVAKAGAQPSRFSGGTDYQIRYKLDYQDR* |
Ga0066660_104186633 | 3300006800 | Soil | MKSKYGNWSEWQNPDFVAKADQQPTRFSGGNDYQIRYKVDYQ |
Ga0075424_1025424382 | 3300006904 | Populus Rhizosphere | MKAKYRAWSEWQNPDFVAKAGEQPSRFSGGSDYQIRYKLDYRDR* |
Ga0075435_1018498351 | 3300007076 | Populus Rhizosphere | AKYRAWSEWQNPDFVAKAGEQPFRFSGGSDYQIRYKLDYQDR* |
Ga0105240_116343511 | 3300009093 | Corn Rhizosphere | YRAWSDWQSPDFVAKAGEQPSRPSGGNEYQIRYRMDYQDR* |
Ga0111539_116013701 | 3300009094 | Populus Rhizosphere | YRAWSDWQNPDFVAKAGQQPSRPSGSSDYQIRYKMDYQDR* |
Ga0066709_1001863241 | 3300009137 | Grasslands Soil | YRAWSDWQNPDFVAKPGQQPSRPTGGSEYQIRYKMDYQDR* |
Ga0105092_106831052 | 3300009157 | Freshwater Sediment | KYRNWSDWQKPDYIAKGDEQPSRASSGSDYQIRYKLDYQDR* |
Ga0126374_114232072 | 3300009792 | Tropical Forest Soil | WQNPDFVAKADQQPTRFSGGNDYQIRYKVDYQDR* |
Ga0126373_109775231 | 3300010048 | Tropical Forest Soil | LKLPANPMRAKYRAWSDWQKADLVAKAGQQPSRPTGENEYQIRYKMDYQDR* |
Ga0134109_102011081 | 3300010320 | Grasslands Soil | ANPMRSKYRVWSDWQNPDFVAKRGEQPSHPSGGNEYQIRYKMDYQEP* |
Ga0134065_100473912 | 3300010326 | Grasslands Soil | WQNPDFVAKAGEQPTRPSGGSDYQIRYKLDYQDL* |
Ga0134065_102078461 | 3300010326 | Grasslands Soil | ANPMRSKYRAWSDWQNPDFVAKRGEQPSHPAGGNEYQIRYKMDYQEP* |
Ga0126377_131429382 | 3300010362 | Tropical Forest Soil | DWQNPDFVAKKNEQPSRPSGGNEYQIRYRMDYQDR* |
Ga0126377_131700111 | 3300010362 | Tropical Forest Soil | WQSPDFVAKAGEQPSRSSGGNDYQIRYKMDYQDR* |
Ga0126379_131401621 | 3300010366 | Tropical Forest Soil | RAWSDWQNPDFVAKGGEQPSRSSGGNEYQIRYKMDYQDR* |
Ga0126381_1046823601 | 3300010376 | Tropical Forest Soil | MKSKYRSWSEWQKPDFVAKADQQPTRFSGGNDYQIRYKVDYQDR* |
Ga0124850_10280001 | 3300010863 | Tropical Forest Soil | AWSDWKNPDFVAKGGQQPSRPTRGNEYQIRYKMDYQDR* |
Ga0137364_111326202 | 3300012198 | Vadose Zone Soil | AWSEWQNPDFIAKAGEQPTRPSGGIDYQIRYKLDYQDR* |
Ga0137364_113728371 | 3300012198 | Vadose Zone Soil | MRAKYRAWSQWQNPDFVAKGGEQPTRPSGGSDYQIRYKLDYQNR* |
Ga0137383_102956382 | 3300012199 | Vadose Zone Soil | SGWQKPDYIAKGGEQPSRPSSGSDYQIRYKLDYQDR* |
Ga0137382_113226531 | 3300012200 | Vadose Zone Soil | KSKYRNWSEWQDPDFAAKAGQQPARFSGGNDFQIRYKVDYQDR* |
Ga0137374_101394382 | 3300012204 | Vadose Zone Soil | MRSRAWAEWQNPDFVAKDGEPIRLAGGSNYQIRYKLDYQER* |
Ga0137378_100378101 | 3300012210 | Vadose Zone Soil | YRAWSGWQKPDYIAKGGEQPSRPSSGSDYQIRYKLDYQDR* |
Ga0137378_111712951 | 3300012210 | Vadose Zone Soil | KYRAWSDWQNPDFVAKAGQQPARPSGGNEYQIRYKMDYQDR* |
Ga0137377_114087301 | 3300012211 | Vadose Zone Soil | MRAKYRAWSQWQNPDFVAKGGEQPTRPSGGSDYQIRYKLDYQDR* |
Ga0137370_102176921 | 3300012285 | Vadose Zone Soil | WQNPDFVAKAGEQPSPFSGGSDYQIRYKLDYQER* |
Ga0137387_108475572 | 3300012349 | Vadose Zone Soil | PVNPMKAKYRAWSDWKKPDFVAKGGEQPFRPSGGSDYQIRYKLDYQDR* |
Ga0137371_104494732 | 3300012356 | Vadose Zone Soil | WSEWQNPDFIAKAGEQPTRPSGGIDYQIRYKLDYQDR* |
Ga0137371_113804082 | 3300012356 | Vadose Zone Soil | AWSEWQNPDFVAKAGEQPTRPSGGSDYQIRYKVDYQDR* |
Ga0137360_100797515 | 3300012361 | Vadose Zone Soil | MKAKYRAWSDWKKPDFVAKAGEQPSRPSGGSDYQIRYKVDYQDQ* |
Ga0137361_114922252 | 3300012362 | Vadose Zone Soil | KPRYRDWSEWQKPDFVAKGDQQPSHPSSGSEYEIRYKLEYQDR* |
Ga0137413_112923892 | 3300012924 | Vadose Zone Soil | AWSDWRNPDFVAKAGEQPSRFSGGSDYQIRYKLDYQDR* |
Ga0137407_101310861 | 3300012930 | Vadose Zone Soil | ANPMRAKYRAWSDWQNPDFVAKGGEHPSHPSGGNEYQIRYKMDYQDR* |
Ga0126375_108214702 | 3300012948 | Tropical Forest Soil | DWQSPDFVAKGGEQPSRVSGGTEYQIRYKMDYQDR* |
Ga0126369_115912381 | 3300012971 | Tropical Forest Soil | YRAWSEWQNPDFVAKAGEQPTRPSRGSDYQIRYKLDYQDR* |
Ga0134077_100947921 | 3300012972 | Grasslands Soil | NPMRAKYRAWSEWQNPDFIAKAGEQPTRPSGGSDYQIRYKLDYQDR* |
Ga0134077_101476211 | 3300012972 | Grasslands Soil | YRAWSDWQNPDFVAKGGEQPSRPFGGNEYQIRYKMDYQDR* |
Ga0134076_101139292 | 3300012976 | Grasslands Soil | PANPMKAKYRAWSDWKKPDFVAKAGEQPSRPSGASDYQIRYKVDYQDQ* |
Ga0134075_102619701 | 3300014154 | Grasslands Soil | DWQNPDFVAKGGEQPSRPFGGNEYQIRYKMDYQDR* |
Ga0134078_100021627 | 3300014157 | Grasslands Soil | KYRAWSEWQNPDFIAKAGQQPTRPSGGSDYQIRYTLDYQDR* |
Ga0134078_103335401 | 3300014157 | Grasslands Soil | KLPANPMRAKYRAWSDWQNPDFVAKGGEQPSHPSGGNQYQIRYKMDYQDR* |
Ga0137418_105783981 | 3300015241 | Vadose Zone Soil | PMRAKYRAWSDWQNPDFVAKAGQQPSRPSGGNEYQIRYKMDYQDR* |
Ga0134072_104748312 | 3300015357 | Grasslands Soil | ANPMKSKYGNWSEWQNPDFVAKADQQPTRFSGGNDYQIRYKVDYQPR* |
Ga0134085_102243341 | 3300015359 | Grasslands Soil | MNAKYRTWSDWKKPDFVAKAGEQPSRPAGGNDYQIRYKVDYQER* |
Ga0182035_106618331 | 3300016341 | Soil | ANPMKSKYRNWSEWQKPDFVAKADQQPARFSGRNDYQLGYSVD |
Ga0182034_105171221 | 3300016371 | Soil | MKAKYRVWSGWQNPDFVAKAGEQPSRFSGGSDYQIHYKLDYQDR |
Ga0182040_112058081 | 3300016387 | Soil | RVWSEWQNPDFVAKAGEQPSRFSGGSDYQIHYKLDYQDR |
Ga0184618_101817621 | 3300018071 | Groundwater Sediment | ANPMRTKYRAWSDWQNPDFVAKAGQQPSRPSGGNDYQIRYKMDYQNR |
Ga0066667_106300872 | 3300018433 | Grasslands Soil | MKAKYHTWSDWEKPDFVAKAGEQPSSPSGVNDYQIRSKLDYQDR |
Ga0173479_105219351 | 3300019362 | Soil | AKYRAWSDWQNPDFVAKGGQQPTRPTGGNEYQIRYKMDYQDR |
Ga0193701_10116853 | 3300019875 | Soil | RAKYRAWSDWQNPDFVAKGGEQPSHPSGGNEYQIRYKMDYQDR |
Ga0193732_10489831 | 3300020012 | Soil | RMKYRAWSDWQNPDFVAKAGQQPSRPSGGNDYQIRYKMDYQDR |
Ga0179592_101405732 | 3300020199 | Vadose Zone Soil | RAWSDWQNPDFVAKAGQQPSRPSGGNEYQIRYKMDYQDR |
Ga0247745_10447591 | 3300022898 | Soil | MKTKYRAWSDWQNPDLVARAGQQPSRPSGGNDYQIRYKMDYQDR |
Ga0179591_13003572 | 3300024347 | Vadose Zone Soil | MREKYRAWSDWPQQDFVAKAGQQHFPLVLAERNEYQIRYKMAYTGR |
Ga0207668_105459252 | 3300025972 | Switchgrass Rhizosphere | PANPMKTKYRAWSDWQNPDLVARAGQQPSRPSGGNDYQIRYKMDYQDR |
Ga0207668_109808612 | 3300025972 | Switchgrass Rhizosphere | KAKYRAWSAWQKPDYIAKDGEQPSRASGGSDYQIRYKLDYQDR |
Ga0209234_10242411 | 3300026295 | Grasslands Soil | PMKSKYRNWSEWQNPDFVAKADQQPTRFSGGNDYQIRYKVDYQPR |
Ga0209468_11615561 | 3300026306 | Soil | GNWSEWQNPDFVAKADQQPTRFSGGNDYQIRYKVDYQPR |
Ga0209469_10634142 | 3300026307 | Soil | ANPMRPRYRAWSEWQNPDFVAKAGEQPTRPSGGSDYQIRYKLDYQDR |
Ga0209469_10778772 | 3300026307 | Soil | AWSEWQNPDFIAKAGEQPTRPSGGIDYQIRYKLDYQDR |
Ga0209472_10252475 | 3300026323 | Soil | EKYRAWSDWQNPDFVAKPGQQPSRPTGGSEYQIRYKMDYQDR |
Ga0209266_10936062 | 3300026327 | Soil | PANPMRSKYRAWSDWQNPDFVAKRGEQPSHPAGGNEYQIRYKMDYQEP |
Ga0209802_10489654 | 3300026328 | Soil | SEWQNPDFVAKAGGQPTRPSGGSDYQIRYKLDYQER |
Ga0209804_12498671 | 3300026335 | Soil | EWQNPDFVAKAGEHPTRFSGGNDYQIRYKLDYQDR |
Ga0257158_10562721 | 3300026515 | Soil | EWSSWQKQDFVAKPGEQPSRASGGNDYQIRYKVEYQGR |
Ga0209161_101276413 | 3300026548 | Soil | NPMRAKYRAWSEWQNPDFVAKAGGQPTRPSGGSDYQIRYKLDYQER |
Ga0209161_104645392 | 3300026548 | Soil | ANPMKAKYRVWSEWQNPDFVTKAGEQPSRFSGGSDYLIRYKLNYRD |
Ga0179587_102671361 | 3300026557 | Vadose Zone Soil | SDWQNPDFVAKAGQQPSHPSGGNEYQIRYKMDYQDR |
Ga0208993_10241302 | 3300027480 | Forest Soil | MKPKYRDWSEWQKPDFVAKGGQQPSHPSSGSEYEIRYKLEYQDR |
Ga0209874_10754482 | 3300027577 | Groundwater Sand | KAKYRAWSEWQKPDFVAKGGEQPTRPSGGSDYQIRYKLDYQDR |
Ga0208991_10004708 | 3300027681 | Forest Soil | MKPKYRDWSEWQKPDFVAKGGQQPSHPSSGSEYEIRYKLEYQDW |
Ga0137415_100663105 | 3300028536 | Vadose Zone Soil | MKPKYRDWSEWQKPDFVAKGDQQPSHPSSGSEYEIRYKLEYQDR |
Ga0307282_100656652 | 3300028784 | Soil | MKAKYRAWSDWEKPDFIAKAGEQPSRTSAGSDYQIRYRLDYQDR |
Ga0307310_103050901 | 3300028824 | Soil | MRTKYRAWSDWQNPDFVAKAGQQPSRPSGGNDYQIRYKMDYQDR |
Ga0307277_104175382 | 3300028881 | Soil | ANPMRAKYRAWSQWQNPDFVAKAGEQPTRPSGGSDYQIRYKLDYQDR |
Ga0170824_1246777261 | 3300031231 | Forest Soil | NWSEWQSPDFVAKTGQQPTRFSGGNDYQIRYKVDYQDR |
Ga0170820_138932042 | 3300031446 | Forest Soil | EWQKPDFVAKPDQQPTRFSGGNDYQIRYKVDYLDR |
Ga0170819_120782492 | 3300031469 | Forest Soil | MKAKYHAWSAWQNPDFVAKASEPPSRFSDGIDYEIRYKLDYQKR |
Ga0318574_109633781 | 3300031680 | Soil | FRLKLPANPMSAKYRAWSDWQSPDFVAKAGEQASRPSGANQYQVRYRMDYQYP |
Ga0307468_1000183414 | 3300031740 | Hardwood Forest Soil | MRPKYRAWSEWQNPDFVAKAGEQPTRPSGGSDYQIRYKLDYQDR |
Ga0307479_106662351 | 3300031962 | Hardwood Forest Soil | PANPVKAKYRAWSEWQNPDFVAKAGEQPSRFSGGSDYQIHYKLNYQDR |
Ga0307470_115328511 | 3300032174 | Hardwood Forest Soil | ANPMRTNYRAWSDWQNPDFVVRTGQQPSRPSGGNEYQIRYKMDYQDR |
⦗Top⦘ |