NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073313

Metagenome / Metatranscriptome Family F073313

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073313
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 47 residues
Representative Sequence MRLVRYLQHWLGGAGPRLHVADFVPDTHPIRQWADTFPWAALV
Number of Associated Samples 100
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.12 %
% of genes near scaffold ends (potentially truncated) 86.67 %
% of genes from short scaffolds (< 2000 bps) 90.83 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.833 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(16.667 % of family members)
Environment Ontology (ENVO) Unclassified
(25.833 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.333 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.58%    β-sheet: 0.00%    Coil/Unstructured: 70.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF01609DDE_Tnp_1 4.17
PF07592DDE_Tnp_ISAZ013 2.50
PF13358DDE_3 2.50
PF05598DUF772 1.67
PF00665rve 0.83
PF00561Abhydrolase_1 0.83
PF07045DUF1330 0.83
PF01909NTP_transf_2 0.83
PF00378ECH_1 0.83
PF00589Phage_integrase 0.83
PF00239Resolvase 0.83
PF13546DDE_5 0.83
PF13384HTH_23 0.83
PF01610DDE_Tnp_ISL3 0.83
PF16980CitMHS_2 0.83
PF13480Acetyltransf_6 0.83
PF11984DUF3485 0.83
PF12759HTH_Tnp_IS1 0.83
PF09954DUF2188 0.83
PF09585Lin0512_fam 0.83
PF02653BPD_transp_2 0.83
PF00903Glyoxalase 0.83
PF00072Response_reg 0.83
PF00106adh_short 0.83
PF00582Usp 0.83
PF14690zf-ISL3 0.83
PF13359DDE_Tnp_4 0.83
PF02446Glyco_hydro_77 0.83
PF01078Mg_chelatase 0.83
PF13610DDE_Tnp_IS240 0.83
PF13701DDE_Tnp_1_4 0.83
PF03050DDE_Tnp_IS66 0.83
PF03626COX4_pro 0.83
PF01627Hpt 0.83
PF08369PCP_red 0.83
PF01243Putative_PNPOx 0.83
PF13586DDE_Tnp_1_2 0.83
PF05168HEPN 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG3293TransposaseMobilome: prophages, transposons [X] 4.17
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 4.17
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 4.17
COG5421TransposaseMobilome: prophages, transposons [X] 4.17
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 4.17
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 4.17
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.83
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.83
COG3125Heme/copper-type cytochrome/quinol oxidase, subunit 4Energy production and conversion [C] 0.83
COG16404-alpha-glucanotransferaseCarbohydrate transport and metabolism [G] 0.83
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.83
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.83
COG3436TransposaseMobilome: prophages, transposons [X] 0.83
COG3464TransposaseMobilome: prophages, transposons [X] 0.83
COG4584TransposaseMobilome: prophages, transposons [X] 0.83
COG2250HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.83
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.83
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.83
COG1895HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.17 %
UnclassifiedrootN/A10.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000890|JGI11643J12802_11273087All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1155Open in IMG/M
3300005347|Ga0070668_100298752Not Available1350Open in IMG/M
3300005544|Ga0070686_100221994All Organisms → cellular organisms → Bacteria → Proteobacteria1366Open in IMG/M
3300005615|Ga0070702_101734645All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium520Open in IMG/M
3300006796|Ga0066665_11655418All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300006797|Ga0066659_10682944All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium838Open in IMG/M
3300006844|Ga0075428_102760743All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium500Open in IMG/M
3300006846|Ga0075430_101533116All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300006853|Ga0075420_100605498All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300006854|Ga0075425_100722311All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1143Open in IMG/M
3300006969|Ga0075419_10162581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1465Open in IMG/M
3300007255|Ga0099791_10251961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6837Open in IMG/M
3300009089|Ga0099828_10128950All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2218Open in IMG/M
3300009089|Ga0099828_10190487All Organisms → cellular organisms → Bacteria1827Open in IMG/M
3300009090|Ga0099827_10527620All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1015Open in IMG/M
3300009090|Ga0099827_10818376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium806Open in IMG/M
3300009100|Ga0075418_11490639All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium734Open in IMG/M
3300009137|Ga0066709_104376004All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300009143|Ga0099792_10825167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae609Open in IMG/M
3300009146|Ga0105091_10450833All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium647Open in IMG/M
3300009157|Ga0105092_10739421All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300009455|Ga0114939_10510879All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300009691|Ga0114944_1334162All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300009691|Ga0114944_1394038All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium583Open in IMG/M
3300009803|Ga0105065_1053765All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300009803|Ga0105065_1067537All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium543Open in IMG/M
3300009804|Ga0105063_1081532All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium517Open in IMG/M
3300009808|Ga0105071_1094683All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium536Open in IMG/M
3300009812|Ga0105067_1028947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales804Open in IMG/M
3300009812|Ga0105067_1033965All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium759Open in IMG/M
3300009812|Ga0105067_1036015All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium742Open in IMG/M
3300009860|Ga0130032_1077484All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium557Open in IMG/M
3300010043|Ga0126380_10996642All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300010043|Ga0126380_12187494All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300010046|Ga0126384_10348127All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1234Open in IMG/M
3300010046|Ga0126384_11601772All Organisms → cellular organisms → Bacteria → Proteobacteria613Open in IMG/M
3300010047|Ga0126382_12473162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia rosea506Open in IMG/M
3300010358|Ga0126370_10580939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria963Open in IMG/M
3300010358|Ga0126370_11095434Not Available734Open in IMG/M
3300010359|Ga0126376_10159855All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1817Open in IMG/M
3300010359|Ga0126376_12974748All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes523Open in IMG/M
3300010399|Ga0134127_12821222All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300010400|Ga0134122_11385371All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes716Open in IMG/M
3300011003|Ga0138514_100142938Not Available531Open in IMG/M
3300012205|Ga0137362_10996149All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium714Open in IMG/M
3300012207|Ga0137381_11743072All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium513Open in IMG/M
3300012212|Ga0150985_101363035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1034Open in IMG/M
3300012212|Ga0150985_115359700All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300012355|Ga0137369_10441993All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium930Open in IMG/M
3300012356|Ga0137371_10253892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61373Open in IMG/M
3300012357|Ga0137384_11168743All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300012360|Ga0137375_10155822All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes2223Open in IMG/M
3300012361|Ga0137360_11745224All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012402|Ga0134059_1061730Not Available579Open in IMG/M
3300012469|Ga0150984_105827729All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium687Open in IMG/M
3300012515|Ga0157338_1041466All Organisms → cellular organisms → Bacteria → Proteobacteria628Open in IMG/M
3300012517|Ga0157354_1071885All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium543Open in IMG/M
3300012901|Ga0157288_10215898All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300012907|Ga0157283_10223904All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300012925|Ga0137419_11199732All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium635Open in IMG/M
3300012930|Ga0137407_10810971All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium884Open in IMG/M
3300012948|Ga0126375_10808345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria743Open in IMG/M
3300012948|Ga0126375_10953750All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium694Open in IMG/M
3300012948|Ga0126375_11898960All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium523Open in IMG/M
3300014879|Ga0180062_1095017All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria676Open in IMG/M
3300015371|Ga0132258_10937304All Organisms → cellular organisms → Bacteria2187Open in IMG/M
3300015371|Ga0132258_11286155All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Pseudorivibacter → Pseudorivibacter rhizosphaerae1849Open in IMG/M
3300015371|Ga0132258_13177348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer1134Open in IMG/M
3300018031|Ga0184634_10195424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium920Open in IMG/M
3300018061|Ga0184619_10477828All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium553Open in IMG/M
3300018063|Ga0184637_10012417All Organisms → cellular organisms → Bacteria5112Open in IMG/M
3300018079|Ga0184627_10436522All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium681Open in IMG/M
3300018079|Ga0184627_10457462All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium663Open in IMG/M
3300018079|Ga0184627_10571154All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300018466|Ga0190268_11656201All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina567Open in IMG/M
3300018476|Ga0190274_12981786All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium568Open in IMG/M
3300019789|Ga0137408_1028126All Organisms → cellular organisms → Bacteria → Proteobacteria1222Open in IMG/M
3300022563|Ga0212128_10170140All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300022563|Ga0212128_10620736Not Available653Open in IMG/M
3300025149|Ga0209827_11279866All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon717Open in IMG/M
3300025157|Ga0209399_10394094All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium538Open in IMG/M
3300025160|Ga0209109_10467079All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12578Open in IMG/M
3300025660|Ga0209045_1104355All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinaceae → Methanosarcina → Methanosarcina mazei839Open in IMG/M
3300025900|Ga0207710_10229275All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium924Open in IMG/M
3300025908|Ga0207643_10673025All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300025910|Ga0207684_11745261All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium500Open in IMG/M
3300026119|Ga0207966_1023055All Organisms → cellular organisms → Bacteria1864Open in IMG/M
3300026535|Ga0256867_10004306All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria6210Open in IMG/M
3300027163|Ga0209878_1024511All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis800Open in IMG/M
3300027862|Ga0209701_10341497All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium850Open in IMG/M
3300027875|Ga0209283_10236614All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300027882|Ga0209590_10381402All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium910Open in IMG/M
3300027909|Ga0209382_11433740All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300027909|Ga0209382_11761889All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium605Open in IMG/M
3300027961|Ga0209853_1125126All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300028536|Ga0137415_10799395All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes754Open in IMG/M
3300028608|Ga0247819_10434514All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber764Open in IMG/M
3300028878|Ga0307278_10163634All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300030496|Ga0268240_10151942All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium571Open in IMG/M
3300030902|Ga0308202_1122176All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium557Open in IMG/M
3300030990|Ga0308178_1070908All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium691Open in IMG/M
3300031114|Ga0308187_10370618All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium558Open in IMG/M
3300031198|Ga0307500_10304155All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031548|Ga0307408_100252275All Organisms → cellular organisms → Bacteria1456Open in IMG/M
3300031573|Ga0310915_11090481All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium555Open in IMG/M
3300031731|Ga0307405_10404866All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1069Open in IMG/M
3300031804|Ga0310124_10330753All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula europaea917Open in IMG/M
3300031833|Ga0310917_10582566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis760Open in IMG/M
3300031945|Ga0310913_10860138All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium638Open in IMG/M
3300032000|Ga0310903_10531059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4618Open in IMG/M
3300032180|Ga0307471_101267675Not Available900Open in IMG/M
3300032180|Ga0307471_104096767All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium515Open in IMG/M
3300034177|Ga0364932_0120614Not Available997Open in IMG/M
3300034676|Ga0314801_040379All Organisms → cellular organisms → Bacteria888Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.33%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand8.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.67%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs5.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.50%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.67%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.67%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.67%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.83%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.83%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.83%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.83%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.83%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.83%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.83%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.83%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009455Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal SpringEnvironmentalOpen in IMG/M
3300009691Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009803Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50EnvironmentalOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300009808Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50EnvironmentalOpen in IMG/M
3300009812Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60EnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300009860Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 12m; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014879Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300025149Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes)EnvironmentalOpen in IMG/M
3300025157Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes)EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025660Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026119Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031804Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J12802_1127308733300000890SoilRLVRYLQYWLSGTGAPLHVADFVPETHPIRQWADTFPWAAL
Ga0070668_10029875243300005347Switchgrass RhizosphereMSLVRYLQPWLRGPGVPLHVAACVPATHPMRPWAATFPWAALVAAMERSFAPR
Ga0070686_10022199433300005544Switchgrass RhizosphereMGLIRHLQYWLRGTGTPLHVTDFVPQTAPIRQWADTFPWAALVRAIEQSFDKRFPK
Ga0070702_10173464513300005615Corn, Switchgrass And Miscanthus RhizosphereMGLLRHLQHWLTGTGRPLRVADFVPESHPIRQWADTFPWAALVAAVERNFAQRFPTPTA
Ga0066903_10143823123300005764Tropical Forest SoilMRLLHHLQHGLRGSGPRLQVADVVPKTDSIRQWTDTFPWAKLVEAVE*
Ga0066665_1165541813300006796SoilMRLFRHLQHWLTGCGPRLRGADFVPVMHPIRQWADTCPWAAL
Ga0066659_1068294423300006797SoilMRFVRYLQHWLGGTGARLQVTDFVPVLHPIRQWADTFPWAALVSAIEESFDTRFPKKSP
Ga0075428_10276074313300006844Populus RhizosphereMMRLVRYLQHWLGGAGPRLQVADFVPDTHPIRQWANTFPWAALVAAVEHSFAQRFPK
Ga0075430_10153311623300006846Populus RhizosphereMRLVRYLQHWLSGTGARLQVTDFVPVMHPIRQWADTFPWA
Ga0075420_10060549833300006853Populus RhizosphereMGLMRHLQHWLRGTGPPLHVTDFIPQTDPIRQWADTFPWAALVSATDS*
Ga0075425_10072231133300006854Populus RhizosphereMRLVRYLQHWLGGAGPRLHVADCVPDTHPIRPWAD
Ga0075419_1016258113300006969Populus RhizosphereMRLVRHLQHWLNGPGTPLQVIDFVPKTPPIRQWADTFPWAALGGA
Ga0099791_1025196113300007255Vadose Zone SoilMRLVRCLQHWLSGTDPRLHVTDFVPEGHPIRQWADTFPWATLVSAIEQSFA
Ga0099828_1012895043300009089Vadose Zone SoilMGLVRSLQHWLRGTGAPLHVADFVPDTPPMRPWADTFPWAALVAAIAPSFAQRFP*
Ga0099828_1019048723300009089Vadose Zone SoilMRLARFLQHWLSGTGTRLHVTDFVPEPHPIRQWADTFPWTALVRAIEYSFPTRFP
Ga0099827_1052762023300009090Vadose Zone SoilMRLVRSLQHWLSGTDPRLHITDFVPEGHPIRQWADTFPWATLVSAIEQSFATRFPKKS
Ga0099827_1081837613300009090Vadose Zone SoilMRLLRHLQHWFTGHGLQIAVADFVPETHPIRQWADTFP
Ga0075418_1149063913300009100Populus RhizosphereVYYLQHWLGGTGAHLQVADFVPSMHPIRQWADTFPWGALVRAIAQS
Ga0066709_10437600413300009137Grasslands SoilMRFLRYLQHWLTGHGTSLQVADFVPTTHPIRQGAETLPWAALVAAIDLSVTPR
Ga0099792_1082516713300009143Vadose Zone SoilMRLLRHLQHWLTGQGFEIAVAEFVPETHPIRQWADT
Ga0105091_1045083313300009146Freshwater SedimentMQLLRYLQHWLTGHGPCLQVADFVPETHPLRQWADTF
Ga0105092_1073942113300009157Freshwater SedimentMPLLQYLQHWLTGRRPRLQVADFVPDTHPIRQWADT
Ga0114939_1051087913300009455GroundwaterMRLLRTLQHWLTGRGPCLQVADFVPETHPLRQWADT
Ga0114944_133416223300009691Thermal SpringsMRILRHLQHWLTGHGFHIAVADFVPETHPVRQWADTFPWAALVA
Ga0114944_139403813300009691Thermal SpringsMRLLRHLQHWLTGHGLQIAVADFVPETHPIRQWADTFPWTALVAAVDRSVAQR
Ga0126374_1050237513300009792Tropical Forest SoilMRLLRHLQHWLSGSGPRLQVAAVVPPTHSIRQWTDTFP
Ga0105065_105376523300009803Groundwater SandMRLLRHLQHWLTGQGLHIAVAEFVPETHPVRQWADTFPWAALVAAVDR
Ga0105065_106753723300009803Groundwater SandMRLVHYLQHWLSGRGTPLQVTDFVPASHPLRQWADTFPWVALVSA
Ga0105063_108153213300009804Groundwater SandVRLVRYLQHWLSGTGQCLYVADFVPDTHPIRQWADTFPWAAL
Ga0105071_109468313300009808Groundwater SandMQLLRYLQHWLTGRGPCLQVGDFVPKTHPLRQWADTFPWAALVAAVDRSFAQRFPKP
Ga0105067_102894713300009812Groundwater SandMRLIRHLQHWLGGSGPRLRVADIVPKTHSIRQWADTFPWTEMVE
Ga0105067_103396513300009812Groundwater SandMRLLRHLQHWLTGPGRPLVVTDFVPETPRLRQWADTFPWTALVAAVE
Ga0105067_103601513300009812Groundwater SandMRLVRSLQHWLSGTGVPLPVTDFVPESHPLRQWADTFPWAAL
Ga0105082_112573813300009814Groundwater SandMRLLRHLQHGRSGSGPRLHVADVVPQTHAIRRWAETFPWAKWV
Ga0130032_107748423300009860Meromictic PondMSMLRHLCHWLTGRGQRIPVSEFVPPTHPLRQWADTCPWAAWIRAIEASFA
Ga0126380_1099664223300010043Tropical Forest SoilMRFVHYLQHWLGGTRAPLQVTDFVPVIHPIRQWAD
Ga0126380_1218749413300010043Tropical Forest SoilMRLVRYLQHWLSSIGPRLQVADFVPDSHPIRQWADTFPW
Ga0126384_1034812713300010046Tropical Forest SoilMQLFRYLQHWLTGRGPCLQVADFVPETHPLRQWTETFPWAALVAAV
Ga0126384_1160177223300010046Tropical Forest SoilMRVVHYLRHWLGGTGARLQVTDFVPVMHPIRQWADTLPWAALVSAIE
Ga0126382_1247316213300010047Tropical Forest SoilMRFVHYLQHWLGGSGARLQVTDFVPVMHPIRQWADTFPWAALVSAIEQS
Ga0126370_1058093913300010358Tropical Forest SoilMRLLRHLQHWLSSSGPRLPVADVVPKTNSIRRWADTFPWAKLVAAVEQSVASRFPKRSPLNF*
Ga0126370_1109543423300010358Tropical Forest SoilMRLVRYLQHWLGGTGPHLQVTDFVPDAHPIRQWADTFPWPMLVAAIEQSF
Ga0126376_1015985513300010359Tropical Forest SoilMRLVRYLQHWLGGAGPRLHVADFVPDTHPIRQWADTFPWAALV
Ga0126376_1297474813300010359Tropical Forest SoilMPLLRHLQHWLRGSGPRLQVADVVPKTDSIRQWTDTFPWAKLVEAVEQSCARRFP
Ga0134127_1282122223300010399Terrestrial SoilMRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALVSA
Ga0134122_1138537113300010400Terrestrial SoilMRLLRHLQHWLRGSGPRLQVADVVPKTNSIRQWTDTFPWAKLVEAVEQSCASRFPKRAPG
Ga0138514_10014293813300011003SoilMGLIRHLQHWLRGTGTPLHVTDFVPQTDPIRQWADTF
Ga0137362_1099614923300012205Vadose Zone SoilMPLLRYLQHWLTGRGPRLQVADFVPETHSLRQWADTF
Ga0137381_1174307213300012207Vadose Zone SoilMRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALISAIEQSFD
Ga0150985_10136303533300012212Avena Fatua RhizosphereMRLVHYLQHWLSGTGTRLQVTDFVPESHPIRQWADTFPWAALVSAIEHSFAARFPTRS
Ga0150985_11535970013300012212Avena Fatua RhizosphereMHLVRSLHHWMSGIGPRLHVADCVPDRHPIRQGADTFP
Ga0137369_1044199333300012355Vadose Zone SoilMPLLRYLQHWLTGRGPRLQVADFVPETHSLRQWADTFPWAALVAAVDRSFAQRFPKP
Ga0137371_1025389213300012356Vadose Zone SoilMRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAA
Ga0137384_1116874323300012357Vadose Zone SoilMRLVHFLQHWLSGTGTRLHVTDVVPESHPIRQWAETFPWAALVSAIE
Ga0137375_1015582233300012360Vadose Zone SoilMQILRFLQHWLTGRGPCLQVADFVPETHPLRQWAETFPWAALGRSR*
Ga0137360_1174522423300012361Vadose Zone SoilMRLARFLQHWLSGTGIRLQVTDFVPEPHPIRQWADTFPWTALV
Ga0134059_106173033300012402Grasslands SoilMRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALVR
Ga0150984_10582772913300012469Avena Fatua RhizosphereMRLLRYLQHWVSGTGLPLQVVDFVPDTDPIRQWADTFPWPA
Ga0157338_104146623300012515Arabidopsis RhizosphereMGLVRYLQHWLSGTGAPLHVADFVPDTHPIRQWTETF
Ga0157354_107188513300012517Unplanted SoilMRFVRYLQPWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALLSAIEQSFA
Ga0157288_1021589823300012901SoilMRLVRYLQHWWGGAGPRLHVADCVPDTHPIRPWADTCPWAALVAAVEHSFAQRFPKRA
Ga0157283_1022390413300012907SoilMRLVRYLQHWLGGAGPRLHVADCVPDTHPIRPWADTCPWAALVA
Ga0137419_1119973213300012925Vadose Zone SoilMRLLRGLQHWLSGTGLPLHVADFVPDTHPIRQWADTFPWTALVA
Ga0137407_1081097113300012930Vadose Zone SoilMPILRYLQHWLTGRGACLQGAAFVPDTHPLRQWADTF
Ga0126375_1080834523300012948Tropical Forest SoilMRLLRHLQHWLSSSGPRLQVADVVPKTNSIRRWADTFPWAKLVAAVEQSVASRFPKRSPLNF*
Ga0126375_1095375013300012948Tropical Forest SoilMRLVRYLQHWLGGTGTRLQVTDFVPVMHPIRQWADTFPWAALVRAI*
Ga0126375_1189896023300012948Tropical Forest SoilMRVVRYLQHWLSGPGAPLQVADFVPVMHPIRQWADTFPWMA
Ga0163162_1246188723300013306Switchgrass RhizosphereMRLLRHLQHWLRGSGPRLQVADVVPKTNAIRQWTDTFPWAK
Ga0180062_109501723300014879SoilMRLVHYLQHWLGGTGARLQVTDFVPIMHPIRQWADTFPWAALV
Ga0132258_1093730443300015371Arabidopsis RhizosphereMRLVRYLQHWLGGAGPRLQVAVFVPDTHPLRQWADTFPWAVLVAAVE
Ga0132258_1128615513300015371Arabidopsis RhizosphereMRVVHYLRHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALLSAIEQSFAPRFPKKSS
Ga0132258_1317734833300015371Arabidopsis RhizosphereMRLLRYLQHWLTGAGRLIRVADFVPESHPVRQWADTFPWTVLIAAVERNFAQ
Ga0184634_1019542413300018031Groundwater SedimentMRILRHLQHWFTGQGFHIAVADFVPETHPVRQWADTFPWAALVAAVERSGA
Ga0184619_1047782813300018061Groundwater SedimentMGLIRHLQHWLRGTGTPLHVTDFVPQTDPIRQWADTFPWAALVRAIEQSFDNRF
Ga0184637_1001241763300018063Groundwater SedimentMRLVRYLQHWLSDTGTPLQVTDFVPKTHPIRQWADTFPWAALVSAIE
Ga0184627_1043652213300018079Groundwater SedimentMRLLRHLQPWFTGQGFPIAVADFVPETQPVRQWADTLPWAA
Ga0184627_1045746213300018079Groundwater SedimentMRLLRGLQHWLSGTGLPLQVADFVPDTHPIRQWADTFPWTALVAAIEHSFATRFPK
Ga0184627_1057115413300018079Groundwater SedimentMSLLRHLQHWLTGPGRPLAVADFVPETHPLRQWADTF
Ga0190268_1165620123300018466SoilMPLLRDLQHWLTGRGPYLQVADFVPATHPLRQWADTFPWAAVVAAVDRRF
Ga0190274_1298178613300018476SoilMRLLSHLQHWLSGQGPRLQVADFVPETHPICQWADTFPWAALVDAVDKSVAERFPK
Ga0137408_102812623300019789Vadose Zone SoilMRLFRHLQHWLGGNGSRLQVADVVPHTHSIRQWADT
Ga0212128_1017014043300022563Thermal SpringsMGIVRQLQHWLGGSGPRLRVHDVVPLDHPLRLWADTFPWSQMTDALEQSFQR
Ga0212128_1062073613300022563Thermal SpringsMQLLRYLQHWLTGRGPCLQVADFVPETHPIRQWADTFPWAALV
Ga0209827_1127986613300025149Thermal SpringsMRLLRTLQHWLTGRGPCLQVADFVPETHPLRQWADTFPWAALVAAVD
Ga0209399_1039409413300025157Thermal SpringsMRLFRHLQHWLTGCGPRLRVADFVPVMHPIRQWADTFPWAALVAALERSFAQRFPTDSSR
Ga0209109_1046707923300025160SoilMRFVRYLQHWLGGTGARLQVTDFVPVMDPIRQWADTFPWAALVSAIEQSFDTRFPKK
Ga0209045_110435513300025660MarineMGIVRQLQHWLGGKGPRLVVADFVPEDHPLRLWSDTFP
Ga0207710_1022927523300025900Switchgrass RhizosphereMGLLRHLQHWLTGAGRPLQVADFVPETHPVRQWADTFPWAALVAAVERNF
Ga0207643_1067302523300025908Miscanthus RhizosphereMRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALVSAIEQSFAT
Ga0207684_1174526123300025910Corn, Switchgrass And Miscanthus RhizosphereMRFVRYLQHWLGGTGARLQVADFVPVMHPIRQWADPFP
Ga0207703_1219010923300026035Switchgrass RhizosphereMRLLRHLQHWLRGSGPRLQVADVVPKTNAIRQWTDTFPWAKLV
Ga0207966_102305543300026119MarineMRTLRQLRHWLTDRGQRIPVSDFVSPTHPLRQWSDTFPWAA
Ga0256867_1000430653300026535SoilMGLVHHFQHWLRGAGTPLQVTDFIPQSDPIRQWADTFPWDALVQAI
Ga0209878_102451113300027163Groundwater SandMRLLRHLQHGRSGSGPRLHVADVVPQTHAIRRWAETFPWSK
Ga0209701_1034149723300027862Vadose Zone SoilMRLVRSLQHGLNGTGTRLHVTDFVPETDPIRRWADTFPWATLVGAIEHSVAKR
Ga0209283_1023661413300027875Vadose Zone SoilMRLVRSLQHWLSGTDPHLHVTDFVPEGHPIRQWADTFPWATLVSAIEQSFA
Ga0209590_1038140223300027882Vadose Zone SoilMRLVRSLQHWLSGTDPHLHVTDFVPEGHPIRQWADTFPWATLVSAIEQSFATRFPKKS
Ga0209382_1143374013300027909Populus RhizosphereMRLVRYLQHWLSGTGARLQVTDFVPVMHPIRQWADTFPWAA
Ga0209382_1176188923300027909Populus RhizosphereMPLLRYLQHWLTGRGPCLQVADFVPETHPLRQWAETFPWAALVRGRGPLV
Ga0209853_112512623300027961Groundwater SandMRLLRHLQHWLTGPGRPLVVADFVPETHPLRQWADTFP
Ga0137415_1079939513300028536Vadose Zone SoilMRVVRYLQHWWGGAGPCLPVADFVPDTHPLRPWADTFPWAALVTAI
Ga0247819_1043451423300028608SoilMRFVRYLQHWLSGTGARLQVTDFVPVMHPIRQWADTLP
Ga0307278_1016363423300028878SoilMQLLRYLQHWLTGRGPRLQVAEFVPETQPIRQWADTLPWAGLVA
Ga0268240_1015194213300030496SoilMRLVRYLQHWLSGPGVPLHVADFVPDTHPIRQWADTFPWAALGAAIEHSFAQRFP
Ga0308202_112217613300030902SoilMGLLRHLQHWLRGTGTPLPVTDFVPQTDPIRQWADTFPWAALVSATEQS
Ga0308178_107090823300030990SoilMGLLRHLQHWLRGTVTPLPVTDFVPQTDPIRQWADTFPWAALVSA
Ga0308187_1037061823300031114SoilMRLLRGLQHWLSGTGLPLQVADFVPDTHPIRQWADTFPWTALVAALERSFATRFP
Ga0307500_1030415513300031198SoilMRIVRHLQHWLTGRGPRLQVIDFVPETHPLRQWADTFPWAALGAAVDRSV
Ga0307408_10025227523300031548RhizosphereMRLIHYLQHWLRGTGPRLQVADFVPDTHPIRPWADAFPWVALVTAIEHSFTTRFPKR
Ga0310915_1109048113300031573SoilMRLLRHLQHWLSGSGPRLQVAAVVPLTHSMRQWTDTFPWAKMVEAVEQSFARRFPKRAQGGRHP
Ga0307405_1040486613300031731RhizosphereMPLLRSLQPWLTGRGPGLQVADFVPETHPVRQWADTFPWAALVAAIDRRF
Ga0310124_1033075313300031804MarineMGFVRQLQHWLSGQGPRLVVADFVPEDHPLRLWADTFPWAPMV
Ga0310917_1058256613300031833SoilMGLVRYLQHWLSGTGTPLQVTDFVPQSDPIRQWADTFP
Ga0310913_1086013823300031945SoilMRLLRHLQHWLSGSGPRLQVAAVVPPTHSIRQWTDTFPWAKMVEAVEHSFARRFPKR
Ga0310903_1053105913300032000SoilMRLVRYLQHGLGGVGPRLHVADFVPDTHPLRQWADSFPWAALVAAVEHSFA
Ga0310911_1002852313300032035SoilMRLLRHLQHWLSGSGPRLQVAAVVPPTHSIRQWTDTFPWV
Ga0307471_10126767523300032180Hardwood Forest SoilMRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTF
Ga0307471_10409676713300032180Hardwood Forest SoilVQLLRYLQHWLTGRGPCLQVADFVPETHPIRQWAETLPWAPLVAAVDHSFA
Ga0364932_0120614_873_9953300034177SedimentMQILRYLQHWLTGGGPCLQVADFVPATHPLRQWAETFPWAA
Ga0314801_040379_711_8873300034676SoilMRLMRYLQHWLGGAGPRLQVADFVPDTHPLRQWADTFPWAVLVAAVEHSFAQRFPKRSP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.