| Basic Information | |
|---|---|
| Family ID | F073300 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MPISPARVAAFDILLRVEREDSYASELLHSSRYAELS |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 48.33 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.833 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02911 | Formyl_trans_C | 79.17 |
| PF01327 | Pep_deformylase | 6.67 |
| PF01264 | Chorismate_synt | 4.17 |
| PF13570 | PQQ_3 | 0.83 |
| PF09107 | SelB-wing_3 | 0.83 |
| PF01594 | AI-2E_transport | 0.83 |
| PF04073 | tRNA_edit | 0.83 |
| PF13561 | adh_short_C2 | 0.83 |
| PF07690 | MFS_1 | 0.83 |
| PF03692 | CxxCxxCC | 0.83 |
| PF07732 | Cu-oxidase_3 | 0.83 |
| PF02518 | HATPase_c | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 79.17 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 6.67 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 4.17 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.83 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.00 % |
| Unclassified | root | N/A | 5.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig39133.24777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1737 | Open in IMG/M |
| 3300004092|Ga0062389_104151005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 544 | Open in IMG/M |
| 3300005330|Ga0070690_100120225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1762 | Open in IMG/M |
| 3300005335|Ga0070666_10104046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1959 | Open in IMG/M |
| 3300005337|Ga0070682_101363720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 605 | Open in IMG/M |
| 3300005435|Ga0070714_100214185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1767 | Open in IMG/M |
| 3300005532|Ga0070739_10398035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 640 | Open in IMG/M |
| 3300005577|Ga0068857_101442793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 670 | Open in IMG/M |
| 3300005900|Ga0075272_1054470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 741 | Open in IMG/M |
| 3300006052|Ga0075029_101193377 | Not Available | 531 | Open in IMG/M |
| 3300006797|Ga0066659_11783266 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009098|Ga0105245_11675280 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300009621|Ga0116116_1150537 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300009760|Ga0116131_1110362 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300009762|Ga0116130_1260281 | Not Available | 552 | Open in IMG/M |
| 3300009839|Ga0116223_10885264 | Not Available | 509 | Open in IMG/M |
| 3300010048|Ga0126373_11681271 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010343|Ga0074044_10002248 | All Organisms → cellular organisms → Bacteria | 16916 | Open in IMG/M |
| 3300010359|Ga0126376_11880044 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010379|Ga0136449_101906059 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300010397|Ga0134124_12549653 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300011270|Ga0137391_10969714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 693 | Open in IMG/M |
| 3300012206|Ga0137380_11751353 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012355|Ga0137369_10940352 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012357|Ga0137384_10062589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3086 | Open in IMG/M |
| 3300012362|Ga0137361_11776666 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012363|Ga0137390_10255334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1738 | Open in IMG/M |
| 3300012582|Ga0137358_10949436 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012929|Ga0137404_10177692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1790 | Open in IMG/M |
| 3300012944|Ga0137410_11879629 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012971|Ga0126369_10225609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1826 | Open in IMG/M |
| 3300012984|Ga0164309_10160270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1507 | Open in IMG/M |
| 3300012986|Ga0164304_11033385 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300014158|Ga0181521_10095593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1839 | Open in IMG/M |
| 3300014158|Ga0181521_10141573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1396 | Open in IMG/M |
| 3300014165|Ga0181523_10669742 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300014201|Ga0181537_10382454 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300014326|Ga0157380_11268192 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300014493|Ga0182016_10624943 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300014655|Ga0181516_10566176 | Not Available | 585 | Open in IMG/M |
| 3300014657|Ga0181522_10125872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1490 | Open in IMG/M |
| 3300016357|Ga0182032_10848324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 774 | Open in IMG/M |
| 3300016702|Ga0181511_1412482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 559 | Open in IMG/M |
| 3300017931|Ga0187877_1136538 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300017932|Ga0187814_10263538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300017932|Ga0187814_10386869 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300017933|Ga0187801_10168630 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300017933|Ga0187801_10252913 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300017933|Ga0187801_10386474 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300017937|Ga0187809_10356442 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300017955|Ga0187817_10189531 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300017972|Ga0187781_10884400 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300017973|Ga0187780_10426568 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300017974|Ga0187777_10925938 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300017975|Ga0187782_10327473 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300017975|Ga0187782_10552448 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300017994|Ga0187822_10162767 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300018006|Ga0187804_10201920 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300018007|Ga0187805_10599549 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300018022|Ga0187864_10018147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4427 | Open in IMG/M |
| 3300018024|Ga0187881_10093215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1371 | Open in IMG/M |
| 3300018027|Ga0184605_10048822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1796 | Open in IMG/M |
| 3300018035|Ga0187875_10450759 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300018046|Ga0187851_10256912 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300018085|Ga0187772_10368260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 996 | Open in IMG/M |
| 3300020170|Ga0179594_10185713 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300021170|Ga0210400_10079925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2568 | Open in IMG/M |
| 3300021401|Ga0210393_10867992 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300021407|Ga0210383_10495200 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300021407|Ga0210383_11535781 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300021420|Ga0210394_10308433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1389 | Open in IMG/M |
| 3300021433|Ga0210391_10726709 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300021474|Ga0210390_10487875 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300021478|Ga0210402_10768279 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300021559|Ga0210409_11433757 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300021560|Ga0126371_12068141 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300021861|Ga0213853_10875239 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300024288|Ga0179589_10211591 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300025553|Ga0208080_1039459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1319 | Open in IMG/M |
| 3300025898|Ga0207692_10242226 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300025898|Ga0207692_11020720 | Not Available | 546 | Open in IMG/M |
| 3300025915|Ga0207693_11479982 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025928|Ga0207700_11196611 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300025929|Ga0207664_10385345 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300025939|Ga0207665_10115658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1890 | Open in IMG/M |
| 3300025939|Ga0207665_10317365 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300026312|Ga0209153_1154659 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300026317|Ga0209154_1047776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1916 | Open in IMG/M |
| 3300026317|Ga0209154_1108914 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300026334|Ga0209377_1127293 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300026542|Ga0209805_1204328 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300027313|Ga0207780_1004531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3395 | Open in IMG/M |
| 3300027376|Ga0209004_1062848 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 626 | Open in IMG/M |
| 3300027545|Ga0209008_1093874 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300027603|Ga0209331_1111276 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300027725|Ga0209178_1106998 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300027842|Ga0209580_10137878 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300027911|Ga0209698_10368299 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300028788|Ga0302189_10081195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1511 | Open in IMG/M |
| 3300028800|Ga0265338_10463816 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300029910|Ga0311369_11298935 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300030991|Ga0073994_11467131 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300031250|Ga0265331_10138934 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300031524|Ga0302320_11712891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300031820|Ga0307473_10998444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300031820|Ga0307473_11182700 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031823|Ga0307478_10539879 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300031859|Ga0318527_10290237 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031945|Ga0310913_10337938 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300031954|Ga0306926_10555343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1406 | Open in IMG/M |
| 3300032067|Ga0318524_10759126 | Not Available | 512 | Open in IMG/M |
| 3300032782|Ga0335082_10534322 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300032805|Ga0335078_10071376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5073 | Open in IMG/M |
| 3300032829|Ga0335070_10051910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4507 | Open in IMG/M |
| 3300032892|Ga0335081_10843648 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300032893|Ga0335069_10178689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2604 | Open in IMG/M |
| 3300032897|Ga0335071_10368085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1391 | Open in IMG/M |
| 3300032955|Ga0335076_10190518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1955 | Open in IMG/M |
| 3300033158|Ga0335077_11012901 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300033807|Ga0314866_042474 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.67% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.67% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.83% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_03990870 | 2199352024 | Soil | MPVSPARAAAFEILMRIETTDAYASEMLHSSQFAKLSRADHGL |
| Ga0062389_1041510051 | 3300004092 | Bog Forest Soil | MAISPARIAAFDILLRVDQQDAYASELLHAPDYSKLSPAN |
| Ga0070690_1001202253 | 3300005330 | Switchgrass Rhizosphere | MPVSAARAAAFDILMRVGQQGAYASELLHSAQFRTLSATDHGLA |
| Ga0070666_101040461 | 3300005335 | Switchgrass Rhizosphere | MPIAPARIAAFDILLRVEQTGAFASELLHSSGYSQLTSADHG |
| Ga0070682_1013637201 | 3300005337 | Corn Rhizosphere | VKTSPARTAAFEILMRVETTDAYASELLNSSRFSRLSTADHGLV |
| Ga0070714_1002141853 | 3300005435 | Agricultural Soil | MPISPARAAAFDLLMRIEQQDAYASEILHSKQYEKLSNVDHGLTT |
| Ga0070739_103980352 | 3300005532 | Surface Soil | MSGVSPARITAFDILLRVEQGGAYASELLHANSATP |
| Ga0068857_1014427932 | 3300005577 | Corn Rhizosphere | LISPARTAAFDILLRVETQNAYASELLHSDRLEKL |
| Ga0075272_10544701 | 3300005900 | Rice Paddy Soil | MPVSVARRIAFDVLLRVESESAYASELLHSALAPE |
| Ga0075029_1011933771 | 3300006052 | Watersheds | MAVSVARSVAFDILVRVEREDSYASELLHSPALAQ |
| Ga0066659_117832662 | 3300006797 | Soil | MPISPARAAAFDILLRVERESSYASELLHSKEQNK |
| Ga0105245_116752802 | 3300009098 | Miscanthus Rhizosphere | MSISPARAAAFDILLRIEQQDAYASELLHSSQYEKLSA |
| Ga0116116_11505371 | 3300009621 | Peatland | MPISAARLAAFEILLRVQEQGAYASELLHSERLVSLSA |
| Ga0116131_11103622 | 3300009760 | Peatland | MAVSPARAVAFEIFLRVEREDSYAAELLHSAHAAKL |
| Ga0116130_12602811 | 3300009762 | Peatland | MPISAARRAAFEILLRVEEQGAYASELLHSERLAALSAA |
| Ga0116223_108852641 | 3300009839 | Peatlands Soil | MAVSPARAAAFEILQRVEREQSYAGELLHSARFNRLSSADHGL |
| Ga0126373_116812712 | 3300010048 | Tropical Forest Soil | MLMPVSPARAAAFDILLGVEQRNAYASELLHSERLSKLSA |
| Ga0074044_100022481 | 3300010343 | Bog Forest Soil | MAVSPARAAAFEILQRVEREQSYAGELLHSARFNRLSSADH |
| Ga0126376_118800442 | 3300010359 | Tropical Forest Soil | MPISPARIAAFEILIRIEGTDAYASELLHASRFSRLSPADH |
| Ga0136449_1019060592 | 3300010379 | Peatlands Soil | MAVSPARAAAFEILQRVEREQSYAGELLHSVRFNKLSSADHGLAT |
| Ga0134124_125496531 | 3300010397 | Terrestrial Soil | MPIAPARIAAFDILLRVEQTGAFASELLHSSGYSQLTS |
| Ga0137391_109697142 | 3300011270 | Vadose Zone Soil | MPVSPARAAAFDILLRVERDSAYTSELLHSAKYDQLS |
| Ga0137380_117513532 | 3300012206 | Vadose Zone Soil | MAISPARAAAFDILLRMERQHAYASELLHSGQYQKLSPG |
| Ga0137369_109403522 | 3300012355 | Vadose Zone Soil | MPVSPARAAAFEILLRIETTDAYASELLHSSRFAKL |
| Ga0137384_100625894 | 3300012357 | Vadose Zone Soil | MSISPARTTAFDILLQVEKEDAYASELLHSAQYATLSRGS |
| Ga0137361_117766662 | 3300012362 | Vadose Zone Soil | MPATPARAAAFEILLRVDRDHSYASELLHSDRNARLSP |
| Ga0137390_102553341 | 3300012363 | Vadose Zone Soil | MSTSPARAAAFDVLLRIEQEDAYSSELLHSSQYAK |
| Ga0137358_109494362 | 3300012582 | Vadose Zone Soil | MSISPARTAAFDILLQVEKEDAYASELLHSAKYGALSR |
| Ga0137404_101776921 | 3300012929 | Vadose Zone Soil | MAISPARVAAFEILLRVERENGYSSELLHSARYSKL |
| Ga0137410_118796292 | 3300012944 | Vadose Zone Soil | MAVSPARAAAFEILLRVERDNSYVSELLHAERNVTL |
| Ga0126369_102256091 | 3300012971 | Tropical Forest Soil | MPVSPARAAAFDVLLRVEKQDAYASELLHSARSDKLST |
| Ga0164309_101602703 | 3300012984 | Soil | MSIAPARTAAFDILLRIEQHAAYASELLHSGPYAKL |
| Ga0164304_110333852 | 3300012986 | Soil | MPTSPARAAAFDILLRIEQHDAYASELLHSGPYARLSP |
| Ga0181521_100955931 | 3300014158 | Bog | MAVSLARAAAFDILLRVERESSYTSELLHSAAYASLSGPDHA |
| Ga0181521_101415733 | 3300014158 | Bog | MPVSPARAAAFDILLRVEQTNAYASELLHSERLDK |
| Ga0181523_106697421 | 3300014165 | Bog | MPIAPARLAAFDILLRIERQNAYAGELLHSDRLNS |
| Ga0181537_103824542 | 3300014201 | Bog | MPISPARAAAFDILLRVDRESSYASELLHSSAYENLSTP |
| Ga0157380_112681922 | 3300014326 | Switchgrass Rhizosphere | MPVSAARAAAFDILMRVGQQGAYASELLHSAQFRTLSATDHG |
| Ga0182016_106249431 | 3300014493 | Bog | MAVSPARAAAFEILLRVERDDSYAAELLHSAAFCKLTSRDHG |
| Ga0181516_105661761 | 3300014655 | Bog | MPISAARLAAFEILLRVQEQGAYASELLHSERLASL |
| Ga0181522_101258721 | 3300014657 | Bog | MPVSPARSLAFDILLRVERESAYASELLHSAASEN |
| Ga0182032_108483242 | 3300016357 | Soil | MPISPARSVAFDILLRIDKQNAYASELLHSDRLEKLTSA |
| Ga0181511_14124822 | 3300016702 | Peatland | MPVSPARAAAFDILLRVEQTNAYASELLHSERLDKL |
| Ga0187877_11365382 | 3300017931 | Peatland | MPISAARLAAFEILLRVQEQGAYASELLHSERLASLS |
| Ga0187814_102635383 | 3300017932 | Freshwater Sediment | MPISPARVAAFDILLRVEREDSYASELLHSSRYSEL |
| Ga0187814_103868692 | 3300017932 | Freshwater Sediment | MPVSPARVAAFHILLRVEQEDAYAAELLHSTRYTRIDSAD |
| Ga0187801_101686302 | 3300017933 | Freshwater Sediment | VAAMPVSPARAAAFEILLRVEHEDSYADELLHSARLAKLTP |
| Ga0187801_102529131 | 3300017933 | Freshwater Sediment | MPVSSARAAAFEILLRIGREDSYANELLHSASPAKLSS |
| Ga0187801_103864741 | 3300017933 | Freshwater Sediment | MPISPARVAAFDILFRVERENSYASELLHASRYAELS |
| Ga0187809_103564421 | 3300017937 | Freshwater Sediment | MPVSPARATAFDILLRIDRQNSYASELLHSQIYGKLS |
| Ga0187817_101895312 | 3300017955 | Freshwater Sediment | MPISPARVAAFETLLRVDQKNSYASELLHSSRYKKLSAAD |
| Ga0187781_108844001 | 3300017972 | Tropical Peatland | MPVSPARATAFDILVRVERESSYAAELLHSAAYSR |
| Ga0187780_104265681 | 3300017973 | Tropical Peatland | MNGMPVSPARAAAFDILLRVECESSYASELLHSAACER |
| Ga0187777_109259381 | 3300017974 | Tropical Peatland | MPISPARLAAFDILLRVEQQGAYASELLHSSRHQKLASAD |
| Ga0187782_103274731 | 3300017975 | Tropical Peatland | MPASPARAAAFDILVRVERESSYAAELLHSAAYSR |
| Ga0187782_105524481 | 3300017975 | Tropical Peatland | MSVSPARRTAFEVLLRVETQDAYASELLNSARVAALSPVDRHLCM |
| Ga0187822_101627671 | 3300017994 | Freshwater Sediment | MPISPARVAAFDILLRVERESSYASELLHADTYNRL |
| Ga0187804_102019202 | 3300018006 | Freshwater Sediment | MPASPARAAAFDILLRVERESSYASELLHSATYEHLS |
| Ga0187805_105995492 | 3300018007 | Freshwater Sediment | MPISPARVAAFETLLRVDQKNSYASELLHSSRYKKLSAADHHLAT |
| Ga0187864_100181471 | 3300018022 | Peatland | MAVSPARAVAFEILLRVEREESYAAELLHSARLAK |
| Ga0187881_100932153 | 3300018024 | Peatland | MAVSPARAVAFEILLRVEREESYAAELLHSARLAKL |
| Ga0184605_100488221 | 3300018027 | Groundwater Sediment | MAVSPARAAAFDILLRVEQQDAYASELLHSPRFAK |
| Ga0187875_104507592 | 3300018035 | Peatland | MPISPARVAAFDILLRVERDDSYASELLHSSGNAG |
| Ga0187851_102569121 | 3300018046 | Peatland | MAVSPARAAAFEILLKVEREHSYASELLHSARYSKL |
| Ga0187772_103682601 | 3300018085 | Tropical Peatland | MGKMSVSPARAAAFEILLKVEREQSYAAELLHSSRFSKLSRADH |
| Ga0179594_101857132 | 3300020170 | Vadose Zone Soil | MSISRARTAAFDTLLQVEKEDAYASELLHSAQYAA |
| Ga0210400_100799251 | 3300021170 | Soil | MPISPARVAAFDILLRVEREDSYASELLHASRYANLS |
| Ga0210393_108679921 | 3300021401 | Soil | MPVSPARAAAFDILLRVERESSYASDLLHSTAHERLST |
| Ga0210383_104952001 | 3300021407 | Soil | MPISPARIAAFDILLRVERESSYASELLHSSRYASLS |
| Ga0210383_115357811 | 3300021407 | Soil | MPVSAARAAAFDILLRAERESSYASELLHSATYEGLSRLD |
| Ga0210394_103084333 | 3300021420 | Soil | MPISPARTAAFDILLRVEREDSYASELLRSARHANLSP |
| Ga0210391_107267092 | 3300021433 | Soil | MPISPARVAAFDILLRVEREDSYASELLHSSRYAELS |
| Ga0210390_104878751 | 3300021474 | Soil | MPISPARVAAFDILLRVERDDSYASELLHSSGNAGLSAAAPP |
| Ga0210402_107682791 | 3300021478 | Soil | MPISPARVAAFDILLRVERENSYASELLHASRYAN |
| Ga0210409_114337572 | 3300021559 | Soil | MPISPARVAAFDILLRVEREDSYASELLHSSRYAGL |
| Ga0126371_120681411 | 3300021560 | Tropical Forest Soil | MPVSPARAAAFDILLRVEREDSYAAELLHSTRCADL |
| Ga0213853_108752391 | 3300021861 | Watersheds | MPASPARTAAFDILLRVERESSYVSELLHSNAYADMSTP |
| Ga0179589_102115912 | 3300024288 | Vadose Zone Soil | MAISPARAAAYDLLMRIEQQDAYASELLHSPQYEKLS |
| Ga0208080_10394591 | 3300025553 | Arctic Peat Soil | MLSRYASCMATPAREVAYDILLRVEQQDAYASELLHGGRLESLS |
| Ga0207692_102422262 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVSPARAAAFEILMRIETTDAYASEMLHSAWAAKLSPEDH |
| Ga0207692_110207201 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGLKAAISPARLAAFNILLRVEREAAYAVELLHS |
| Ga0207693_114799822 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVSPARAAAFEILMRIETSDAYASEMLHSARAAKLSSEDHGLL |
| Ga0207700_111966111 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVSPARAAAFEILMRIETTDAYASEMLHSSRFAKLSSADHG |
| Ga0207664_103853453 | 3300025929 | Agricultural Soil | MPVSPPRAAAFEILLRIDATDAYASELLHSLRFSK |
| Ga0207665_101156581 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPISPARTAAFDILLKVEREAAYASDLLHSPAYEQLS |
| Ga0207665_103173651 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPISPARASAFDILLRIEQQDAYASELLHGGEYCKLS |
| Ga0209153_11546592 | 3300026312 | Soil | MPVSPARAAAFEILMRVERENSYASELLHAARYLRLSPAD |
| Ga0209154_10477761 | 3300026317 | Soil | MPISPARTAAFDILLRVEQEDSYASELLHSTRCAELAAP |
| Ga0209154_11089142 | 3300026317 | Soil | MAVSPARAAAFDIVLRVEQQDAYASELLHSSRFAKLSP |
| Ga0209377_11272931 | 3300026334 | Soil | MPISPARVAAFEILLRVERENAYASELLHSARYSKLSP |
| Ga0209805_12043281 | 3300026542 | Soil | VPQSMRVSPARSAAFDVLFRVESQASYASELLHSNLLAG |
| Ga0207780_10045315 | 3300027313 | Tropical Forest Soil | MPVSAARAAAFDILLRVETQDAYASELLHSERLDQ |
| Ga0209004_10628482 | 3300027376 | Forest Soil | MPVSAARATGFDILLRMERENAYAAELLHSSPYAKLSAV |
| Ga0209008_10938742 | 3300027545 | Forest Soil | MPVSAARSAAFDILLRAERESSYASELLHSATYEGLSR |
| Ga0209331_11112762 | 3300027603 | Forest Soil | MAISPARAVAFDVLLRIEQQDAYASELLHSSQYVKLSPA |
| Ga0209178_11069982 | 3300027725 | Agricultural Soil | MLSSSRAAAFEILLRVEQHGAYASELLHSERYKKLSYAD |
| Ga0209580_101378781 | 3300027842 | Surface Soil | MPISPARVAAFDILLRVEQEDSYASELLHSSRYANLS |
| Ga0209698_103682993 | 3300027911 | Watersheds | MAVSPARTAAFEILLKVEREQSYASELLHSSRFAKLS |
| Ga0302189_100811953 | 3300028788 | Bog | MAISPARSAAFDILLRVELRNAYASELLHSGRWEQLS |
| Ga0265338_104638162 | 3300028800 | Rhizosphere | MPVSPARAAAFDILLRVERESSYSSELLHAKTHQN |
| Ga0311369_112989351 | 3300029910 | Palsa | MAVSQARGAAFEILLRVERDGSYASELLHSDRLTK |
| Ga0073994_114671311 | 3300030991 | Soil | MAVSAARSVAFDILLRVGSQGSYASELLHSAALTKLAARDHGLVTELGQ |
| Ga0265331_101389342 | 3300031250 | Rhizosphere | MAVSPGRAVAFEILLRVEREDSYASELLHSSLSAKI |
| Ga0302320_117128911 | 3300031524 | Bog | VVSAARAAAFDILLRVERDGAYASELLHSRIHDRLDAGD |
| Ga0307473_109984441 | 3300031820 | Hardwood Forest Soil | MPVSPARAAAFDILLRVEQQDAYASELLHSAQYAKLSSQ |
| Ga0307473_111827002 | 3300031820 | Hardwood Forest Soil | MPVSPARVAAFDILLRIEQHDAYASELLHSRQYAK |
| Ga0307478_105398792 | 3300031823 | Hardwood Forest Soil | MHYDTVPNVSPARAAAFDILLRVERESSYASELLHSASCQRLTT |
| Ga0318527_102902371 | 3300031859 | Soil | MPASPARAAVFDILLRVELQDAYASELMHSARLDSLSQA |
| Ga0310913_103379382 | 3300031945 | Soil | MPASPARAAAFDILLRVEQQEAYASELLHSDKVAKLI |
| Ga0306926_105553433 | 3300031954 | Soil | MPISPARLAAFDILLRVEQQGAYASELLHSSRHQKLSSAD |
| Ga0318524_107591262 | 3300032067 | Soil | MPVSPARAVAFDILLRVELQNAYASELLHSRRLDQLS |
| Ga0335082_105343222 | 3300032782 | Soil | MAISAARVAAFDILLRVDQQDAYASELLHAPDHANLSPAD |
| Ga0335078_100713767 | 3300032805 | Soil | MAMPISPARTAAYDILLRVERQDAYAAELLHSERLEPLGP |
| Ga0335070_100519106 | 3300032829 | Soil | MPISPARIAAFDILLRVETQDAYASELLHSALLDKLSS |
| Ga0335081_108436481 | 3300032892 | Soil | MPISAARQIAYDVLLRVETQQAYASDLLHSALKGKI |
| Ga0335069_101786891 | 3300032893 | Soil | MPVSPARAAAFHILLRVETQDAYASELLHSWLLENASLRD |
| Ga0335071_103680853 | 3300032897 | Soil | MPVSPARAAAFDILLRVERESSYASELLHSVAYEAMATPDH |
| Ga0335076_101905181 | 3300032955 | Soil | MPVSPARAAAFDILTRVERENSYASELLHSAAYANLSKADH |
| Ga0335077_110129011 | 3300033158 | Soil | MAISPARAAACEILLKVERDRSFSDELLHAERFNKLSSIDHGLTT |
| Ga0314866_042474_609_728 | 3300033807 | Peatland | MAISPTRVAAYQILQRVEQEDAYASELLHSARYAKLSAAD |
| ⦗Top⦘ |