NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073299

Metagenome / Metatranscriptome Family F073299

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073299
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 44 residues
Representative Sequence FMNSRAGFAWHNEYSWIRQRGTAPDGSDLTSSSLMLGFDFDF
Number of Associated Samples 111
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 83.33 %
% of genes from short scaffolds (< 2000 bps) 78.33 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.167 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(10.000 % of family members)
Environment Ontology (ENVO) Unclassified
(25.833 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.29%    β-sheet: 0.00%    Coil/Unstructured: 75.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF13442Cytochrome_CBB3 71.67
PF00034Cytochrom_C 3.33
PF13620CarboxypepD_reg 1.67
PF10091Glycoamylase 0.83
PF00116COX2 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 0.83
COG4263Nitrous oxide reductaseInorganic ion transport and metabolism [P] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.17 %
UnclassifiedrootN/A15.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q01AXCAEAll Organisms → cellular organisms → Bacteria505Open in IMG/M
2228664022|INPgaii200_c0727240All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300001305|C688J14111_10177045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis659Open in IMG/M
3300002917|JGI25616J43925_10260573All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300004091|Ga0062387_101419014All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300004091|Ga0062387_101722161All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005167|Ga0066672_10128340All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1574Open in IMG/M
3300005337|Ga0070682_100220774All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1349Open in IMG/M
3300005364|Ga0070673_101313783All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter679Open in IMG/M
3300005438|Ga0070701_10174374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1254Open in IMG/M
3300005518|Ga0070699_101649346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter587Open in IMG/M
3300005538|Ga0070731_10679997All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300005549|Ga0070704_100476455All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300005560|Ga0066670_10224470All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1134Open in IMG/M
3300005560|Ga0066670_10378182All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005561|Ga0066699_11226990All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005564|Ga0070664_100506731All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300005566|Ga0066693_10206088All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300005578|Ga0068854_100102723All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2145Open in IMG/M
3300005840|Ga0068870_11282725All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005902|Ga0075273_10067547All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300006028|Ga0070717_10115978All Organisms → cellular organisms → Bacteria2289Open in IMG/M
3300006028|Ga0070717_10359395All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300006052|Ga0075029_100117918All Organisms → cellular organisms → Bacteria1608Open in IMG/M
3300006797|Ga0066659_11818611All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006806|Ga0079220_11902703All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006854|Ga0075425_100815040All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300009093|Ga0105240_12215969All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300010047|Ga0126382_12095680All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010154|Ga0127503_10837430All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300010359|Ga0126376_13227287All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300010360|Ga0126372_11665135All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300010362|Ga0126377_11357314All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300010397|Ga0134124_12626800All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300010398|Ga0126383_11607392All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300011269|Ga0137392_10601943All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300011270|Ga0137391_11022815All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300012199|Ga0137383_10801303All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300012202|Ga0137363_10297673All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300012202|Ga0137363_11010588All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300012212|Ga0150985_102362963All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300012357|Ga0137384_10339105All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300012683|Ga0137398_10844407All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300012929|Ga0137404_10489586All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300012948|Ga0126375_10268533All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300012958|Ga0164299_11132758All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300012961|Ga0164302_11894691All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300012986|Ga0164304_10892393All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300015245|Ga0137409_10139945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2221Open in IMG/M
3300015374|Ga0132255_101144682All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300017933|Ga0187801_10128451All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300017973|Ga0187780_10151768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1607Open in IMG/M
3300018047|Ga0187859_10492984All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300018058|Ga0187766_10327794All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300018088|Ga0187771_10069978All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2773Open in IMG/M
3300018090|Ga0187770_10221774All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300018431|Ga0066655_11342649All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300018433|Ga0066667_12164295All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300020579|Ga0210407_10780800All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300020580|Ga0210403_10181124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1727Open in IMG/M
3300021086|Ga0179596_10220993All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300021171|Ga0210405_10328101All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300021344|Ga0193719_10161879All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300021445|Ga0182009_10132974All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300021560|Ga0126371_13151261All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300022722|Ga0242657_1138149All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300024331|Ga0247668_1086447All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300025475|Ga0208478_1040366All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300025913|Ga0207695_10787952All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300025922|Ga0207646_11763423All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300025922|Ga0207646_11898151All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300025923|Ga0207681_10293533All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300025928|Ga0207700_10521783All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300025960|Ga0207651_11614924All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300026305|Ga0209688_1070571All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300026322|Ga0209687_1123884All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300026377|Ga0257171_1103331All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300027565|Ga0209219_1121937All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300027765|Ga0209073_10384639All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300028800|Ga0265338_10185482All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1582Open in IMG/M
3300030007|Ga0311338_11794344All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300030706|Ga0310039_10043045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2031Open in IMG/M
3300030740|Ga0265460_13075113All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031231|Ga0170824_105718215All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300031250|Ga0265331_10494933All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300031446|Ga0170820_15783753All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300031469|Ga0170819_12818441All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300031474|Ga0170818_108592788All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300031521|Ga0311364_10021461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7103Open in IMG/M
3300031740|Ga0307468_102448758All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031820|Ga0307473_10082263All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1655Open in IMG/M
3300031938|Ga0308175_100889649All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300031962|Ga0307479_11999976All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300032076|Ga0306924_10827368All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300032180|Ga0307471_100749955All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300032205|Ga0307472_101473781All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300032783|Ga0335079_10826696All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300032805|Ga0335078_12307467All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300032895|Ga0335074_11288795All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300033004|Ga0335084_12380246All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300034163|Ga0370515_0019060All Organisms → cellular organisms → Bacteria3173Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.50%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.67%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.17%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.50%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.67%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.67%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.83%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.83%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.83%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.83%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.83%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.83%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.83%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.83%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.83%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005902Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025475Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_094376602170459005Grass SoilTSRAGFAFHNEYSWIRQRGTSPVTGTDLSTNSLMLGFDFDF
INPgaii200_072724012228664022SoilNPFMTSRAGFAFHNEYSWIRQRGTAPDATDLSSNSIMLGFDFAF
C688J14111_1017704523300001305SoilYYPVMNSRAGFAWHNEYSWIRGKGLAPDGSDLTNNSVMAGFDFDF*
JGI25616J43925_1026057313300002917Grasslands SoilNSRAGFAFHNEYSWIKQVGTAPDGSDLTSNSIMAGFDFDF*
Ga0062387_10141901423300004091Bog Forest SoilIMTSRAGFAWHNEYSWIRYKGLAPDGSDLTSSSLMLGFDFAF*
Ga0062387_10172216113300004091Bog Forest SoilRAGFAWHNEYSWIRTQGVSPVTATDLTSSSLMSGFDFDF*
Ga0066672_1012834033300005167SoilFMTSRAGFAFHNEFSWFRQRGVAPDGVSDLSTNSLMAGFDFAF*
Ga0066671_1001196653300005184SoilDNYVFGYRYYPIMNSRGGFAWHNEYSWIRGRGLAPDGSDLTSNSLMLGFDFDF*
Ga0066388_10083298133300005332Tropical Forest SoilGNLDNYVFGYRYYPIMNARAGFAWHNEYSWIRGRGLAPDGSDLTNQSLMLGFDFDF*
Ga0070682_10022077413300005337Corn RhizosphereFMTSRAGFAFHNEYSWIRQRGTSPVTGTDLSSNSLLLGFDFDF*
Ga0070673_10131378323300005364Switchgrass RhizosphereRYMPTMNSRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF*
Ga0070701_1017437413300005438Corn, Switchgrass And Miscanthus RhizosphereYMPTMNSRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF*
Ga0070707_10032056633300005468Corn, Switchgrass And Miscanthus RhizosphereMYTFGYRWYPIMNPRAGFALHNEYSWLRQRGTSPVTATDLTSSALMLGFDFDF*
Ga0070699_10164934613300005518Corn, Switchgrass And Miscanthus RhizosphereFGYRWYPIMTSRAGFAFHNEYSRITQRSAAPDGTDLTSSSVFVGFDFDF*
Ga0070731_1067999723300005538Surface SoilRYMPIMTSRAGFAWHNEYNWLRQSKAAPDGTDLTSSELLLGFDFAF*
Ga0070732_1039997823300005542Surface SoilDMYTFGFRWYPIMNPRAGFAWHNEYSWLRTRGTSPVSFTDLTSSSLMSGFDFDF*
Ga0070704_10047645513300005549Corn, Switchgrass And Miscanthus RhizosphereIMNSRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF*
Ga0066670_1022447013300005560SoilYRYYPVMNSRAGFAWHNEYSWIRGKGLAPDGSDLTNNSLMAGFDFDF*
Ga0066670_1037818223300005560SoilGFAFHNEYSWIRQRGTSPVTGTDLSSNSLLLGFDFDF*
Ga0066699_1122699013300005561SoilSRAGFAWHNEYSWIRQRGGAPDGTDLTSNSLMLGFDFDF*
Ga0070664_10050673113300005564Corn RhizosphereFHNEYSWIRQRGTSPVTGTDLSSNSLMLGFDFDF*
Ga0066693_1020608823300005566SoilAFHNEYSWIRQRGTSPVTGTDLSSNSLLLGFDFDF*
Ga0068854_10010272343300005578Corn RhizosphereAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF*
Ga0068870_1128272513300005840Miscanthus RhizosphereSRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF*
Ga0075273_1006754713300005902Rice Paddy SoilNSRAGLAFHNEYSWVRQRGTSPTTGTDLSSSSLFLGLDFDF*
Ga0070717_1011597813300006028Corn, Switchgrass And Miscanthus RhizosphereFMSSRAGFAFHNEYSWIRQRGTSPVTGTDLSSNSLMLGFDFDF*
Ga0070717_1035939523300006028Corn, Switchgrass And Miscanthus RhizosphereFAFHNEYSWIRQRGTAPDNGDLSSNSIMIGFDFAF*
Ga0075029_10011791833300006052WatershedsAGFAWHNEYSWVRQRGTASDGTDLTSSSLLLGFDFDF*
Ga0066659_1181861113300006797SoilRYYPIMNSRAGFAWHNEYSWIRGRGLAPDGSDLTNNSLMLGFDFDF*
Ga0079221_1103112813300006804Agricultural SoilIDMYTVGFRYYPIMNPRAGFAFHNEYSWFRQRGTSPVTGTDLTTSSLMLGWDFDF*
Ga0079220_1190270323300006806Agricultural SoilYNPFMTSRDGFAFHNEYSWIRQRGTAPDGTDLTSSSILLGFDFAF*
Ga0075425_10081504023300006854Populus RhizosphereSRAGFAFHNEYSWIRQRGTAPDASDLSSNSLMLGFDFDF*
Ga0105240_1221596923300009093Corn RhizosphereFMNSRAGFAWHNEYSWIRQRGTAPDGSDLTSSSLMLGFDFDF*
Ga0126382_1209568023300010047Tropical Forest SoilGFAWHNEYSWIRGRGLAPDGSDLTNQSLMLGFDFDF*
Ga0127503_1083743023300010154SoilTSRAGFAFHNEYAWFRQQGTAPLGNALTSSSLMFGFDFDF*
Ga0126376_1322728723300010359Tropical Forest SoilYNPFMTSRAGFAFHNEYSWIRQRGTAPDGSDLSSNSLLLGFDFDL*
Ga0126372_1166513523300010360Tropical Forest SoilFRYMPFMTSRAGFAWHNEYSWIKNSGLAPNGTDLTSSSLMSGFDFDF*
Ga0126378_1244504423300010361Tropical Forest SoilALPSSLGNIDMYTVGFRYYPIMNPRAGFAFHNEYSWFRQRGTSPVTGTDLTTSSLMLGWDFDF*
Ga0126377_1135731423300010362Tropical Forest SoilFHNEYSWFRQRGTSSIPDQDLKTNSILVGMDFDF*
Ga0126379_1038773433300010366Tropical Forest SoilGNIDMYTVGFRYYPIMNPRAGFAFHNEYSWFRQRGTSPVTGTDLTTSSLMLGWDFDF*
Ga0134124_1262680013300010397Terrestrial SoilGVRWYPNITSRAGFALHGEYSWLKQHKTAPVTGTDVTSSSVFFGTDFDF*
Ga0126383_1160739233300010398Tropical Forest SoilGFAFHNEYSWIRQRGTAPDGSDLTSSSIMLGFDFDF*
Ga0137392_1060194323300011269Vadose Zone SoilGYRWYPIMTSRAGFAFHNEYSRIIQRSAAPDGTDLNSSSVFVGFDLDF*
Ga0137391_1102281523300011270Vadose Zone SoilWHNEYSWIRQRGTSPVTFTDVTSSSLMSGFDFDF*
Ga0137383_1080130323300012199Vadose Zone SoilAGFAFHNEFSYFRQRGVSPVNALDLSSNSLLVGFDFAF*
Ga0137363_1029767313300012202Vadose Zone SoilNPFMTSRAGFAFHNEFSWFRQRGVAPDGVSDLSTNSLMAGFDFAF*
Ga0137363_1101058823300012202Vadose Zone SoilMNSRAGFAWHNEYSWIRGKGLAPDGSDLTNNSLMLGFDFDF*
Ga0150985_10236296313300012212Avena Fatua RhizosphereYPVMNSRAGFAWHNEYSWIRGKGLAPDGSDLTNNSVMAGFDFDF*
Ga0137384_1033910513300012357Vadose Zone SoilAWHNEYSWIRGTGLAPDGSDLTSNSLMLGFDFDF*
Ga0137385_1156845913300012359Vadose Zone SoilSTLGNLDNYVFGYRYYPIMNSRGGFAWHNEYSWIRGKGLAPDGTDLTSNSLMLGFDFDF*
Ga0137398_1084440723300012683Vadose Zone SoilRAGFALHNEYSWIRQRGTSPVTGTDLSTNSVMLGFDFDF*
Ga0137395_1045693723300012917Vadose Zone SoilAGSSTVAPMASDLGNIDMYTFGFRYMPIMTSCAGFAFHNEYSWVRQRGTAPVTGTDLTSSSLMSGFDFDF*
Ga0137404_1048958613300012929Vadose Zone SoilYNPFMTSRAGFALHNEYSWIRQRGTSPVTGTDLSTNSVMLGFDFDF*
Ga0126375_1026853323300012948Tropical Forest SoilFMNARDGFAFHNEYSWIRQRGTAPDNGDLSSNSIMIGFDFAF*
Ga0164299_1113275823300012958SoilNSRAGFAFHNEYSLARQQHTAPEGNSLSSSSVFVGFDFDF*
Ga0164302_1189469113300012961SoilAGFAFHNEYSWIRHRGTSPVTGTDLSSNSLLLGFDFDF*
Ga0164304_1089239323300012986SoilPIMNSRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF*
Ga0137409_1013994513300015245Vadose Zone SoilGFAFHNEYSWIRQRGTSPVTSTDLSTNSLLLGFDFDF*
Ga0132255_10114468213300015374Arabidopsis RhizosphereMTSRAGFAFHNEYSWIRQRGTAPDATDLSSNSIMVGFDFAF*
Ga0187801_1012845123300017933Freshwater SedimentRWYPIMLPRAGFAFHNEYSWLRQNGVSPVTGTDLTSSSLLFGFDFDF
Ga0187780_1015176813300017973Tropical PeatlandPIMTSRAGFAWHNEYSWLRVQGVASNGTAATSSSLMSGFDFDF
Ga0187777_1069980413300017974Tropical PeatlandIVGTPSNVGNIDNYVFGYRYMPFMNARAGFAWHNEYSWVRQRGGAPDGTDLTSSSVLLGFDFDF
Ga0187859_1049298413300018047PeatlandSRAGFAFHNEYSWLRQNGTSPVTGTDVTSSSLLLGIDFDF
Ga0187766_1032779423300018058Tropical PeatlandFAFHNEYSWMRQKGTSPVTGTDLTTSSLVFGWDFDF
Ga0187765_1006326533300018060Tropical PeatlandVGNIDNYVFGYRYMPFMNARAGFAWHNEYSWVRQRGGAPDGTDLTSSSVLLGFDFDF
Ga0187771_1006997853300018088Tropical PeatlandIMTSRAGLAWHNEYSWIRTNGIAPLSATDVTSNSLMLGFDFDF
Ga0187770_1022177413300018090Tropical PeatlandRAGFAFHNEYSWLRSNGTAPGGTDQTASSLLFGFDFDF
Ga0066655_1134264913300018431Grasslands SoilTYVFGYRYMPFMTSRAGLAWHNEYSWNRQRGTAPDGSDTTSSSVMLGLDFDF
Ga0066667_1216429513300018433Grasslands SoilSRAGFAWHNEYSWARVRASSPLSGTDLTSNSLYFGFDFDF
Ga0210407_1078080023300020579SoilFMTSRDGFAFHNEYSWIRQRGTAPDGTDLTSSSILLGFDFAF
Ga0210403_1018112433300020580SoilAWHNEYSWLRMRGSSPVSGTDLTSNSLMSGFDFDF
Ga0179596_1022099323300021086Vadose Zone SoilAFHNEFSWFRQRGVAPDGVSDLSTNSLMAGFDFAF
Ga0210405_1032810133300021171SoilPIMTSRAGFAWHNEYSWFRQRGTAPDGTDITNSSLLLGFDFDF
Ga0193719_1016187923300021344SoilTFGYRWYPIMTSRAGLAFHNEYSWVRVRGLAPITATDLTSNSLFFGFDFDF
Ga0210383_1173577913300021407SoilGNIDMYTVGFRYYPIMTPRAGFAFHNEYSWFRQRGTSPVTGTDLTSSSLLLGWDFDF
Ga0182009_1013297413300021445SoilMTSRAGFAFHNEYSWIRQRGTSPVTATDLSSNSLMLGFDFDF
Ga0126371_1315126123300021560Tropical Forest SoilSSRAGFAFHNEYAWLRQRGTAPDGTDLSSTSLMLGFDFAF
Ga0242657_113814923300022722SoilTPRAGFAFHNEYSWFRQRGTSPVTGTDLTSSSLLLGWDFDF
Ga0247668_108644713300024331SoilGFAFHNEYSWIRQRGTSPVSGTDLSSNSLMLGFDFDF
Ga0208478_104036623300025475Arctic Peat SoilYNPFMTSRAGFAFHNEFSWFRQRGVAPDGTTDLSSSSLMLGFDFAF
Ga0207695_1078795213300025913Corn RhizosphereVGFRYIPIMTSRAGFAWHNEYSWIKQYGLAPDGTNLTSSSLMSGFDFDF
Ga0207646_1027117713300025922Corn, Switchgrass And Miscanthus RhizosphereMYTFGYRWYPIMNPRAGFALHNEYSWLRQRGTSPVTATDLTSSALMLGFDFDF
Ga0207646_1176342313300025922Corn, Switchgrass And Miscanthus RhizosphereSRAGFAWHNEYSWVRQRGTSLVTFTDLTSSSLMSGFDFDF
Ga0207646_1189815123300025922Corn, Switchgrass And Miscanthus RhizosphereIMTSRAGFAWHNEYSWVRQRGTAPDGISDLTSSSLMLGFDFDF
Ga0207681_1029353313300025923Switchgrass RhizosphereRAGVAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF
Ga0207700_1052178323300025928Corn, Switchgrass And Miscanthus RhizosphereTFGYRWYPIMNPRAGFAVHNEYSWFRQRGTSPVTGTDLTSSALLLGFDFDF
Ga0207651_1161492423300025960Switchgrass RhizosphereRYMPTMNSRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF
Ga0209688_107057123300026305SoilAFHNEYSWIRQRGTSPVTGTDLSSNSLLLGFDFDF
Ga0209687_112388423300026322SoilYPIMTSRAGLAFHNEYSWVRQRGTSPVSATDLTNNSLFFGFDFDF
Ga0257171_110333113300026377SoilFISSRAGFAFHNEYSFLRQRGVSPVNALDVSSNSLLVGFDFAF
Ga0209219_112193713300027565Forest SoilGFAWHNEYSWVRRRGVAPDLTDLTSSSLLTGFDFDF
Ga0209073_1038463923300027765Agricultural SoilGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF
Ga0265338_1018548233300028800RhizosphereYNPFMTSRAGFAFHNEYAWLRQRGTSPVTGTDLTSTSLMLGFYFDF
Ga0311338_1179434413300030007PalsaMTSRAGFAWFQEYSWNRQTGTAPDGTDLTSSSLMMGIDFDF
Ga0310039_1004304513300030706Peatlands SoilGFAFHNEYSWLRQNGVSPVTGTDQTASSLLFGFDFDF
Ga0265460_1307511323300030740SoilPIMTSRAGFAWHNEYSWLRQRGTAPDGSDLTSSSLLLGFDFDF
Ga0265461_1362853513300030743SoilNYGNLDTYLIGYRYMPFMTNRAGFAWHNEYSWIRYKGLAPDGSDLTSSSLMLGFDFAF
Ga0170824_10571821523300031231Forest SoilPIMNSRAGFAWHNEYSWIKQAGGAPDGSDITSNSLMAGFDFDF
Ga0265331_1049493313300031250RhizosphereYRYNPFMNSRAGFAFHNEYSWFRQRGGAPDGSDLSSNSLMLGFDFAF
Ga0170820_1578375323300031446Forest SoilLAWHNEYSWIKYYGLAPDGTDLTASSLMLGFDFDF
Ga0170819_1281844113300031469Forest SoilMTSRAGFAIHNEYSWIRQRGTSPVTASDLSSSSLMLGFDFDF
Ga0170819_1438368123300031469Forest SoilNLGNIDNYVFGYRYYPIMTSRTGFAFHNEYSWIRGRGLAPDGSDLSSNSLMLGFDFDF
Ga0170818_10859278823300031474Forest SoilACFFIMNSRAGFAWHNEYSWIKQAGGAPDGSDITSNSLMAGFDFDF
Ga0311364_1002146193300031521FenMTSRAGFAFHNEYSWIRQRGTSPTTQTDLTGSSLMLGMDFDF
Ga0307468_10244875823300031740Hardwood Forest SoilSRAGFAIHNEYSWIRQRGTSPVSGTDLTSNSLMLGFDFDF
Ga0307473_1008226333300031820Hardwood Forest SoilRAGFAFHNEYSWIRQRGTAPDGTDLTSGSILLGFDFAF
Ga0308175_10088964923300031938SoilNPFMTSRAGFAFHNEYSWIRQRGTSPVTATDLSSNSLLLGFDFDF
Ga0307479_1199997613300031962Hardwood Forest SoilTSRAGFAWHNEYSWFRQRGTAPDGTDLTNSSLLLGFDFDF
Ga0306924_1082736813300032076SoilRAGFAFHNEYSWIRQRGTAPDASDLSSNSLMLGFDFDF
Ga0307471_10074995513300032180Hardwood Forest SoilGFRWMPFMTSRAGFAWHNEYSWIRGQGLAPDGSALTQSSLMSGFDFDF
Ga0307472_10147378123300032205Hardwood Forest SoilWYPIMTSRAGFAFHNEYSRIIQHSAAPDGTDLTSSSVFVGFDFDF
Ga0335079_1068739823300032783SoilMYTFGFRWYPIMLPRAGFAFHNEYSWLRQNGVSSVTGTDLTSSSLMFGWDFDF
Ga0335079_1082669613300032783SoilAGFAWHNEYSWIRQRGGAPDGTDLTSSSVLLGFDFDF
Ga0335078_1230746713300032805SoilFAWHNEYSWIRWQGMAPDGTALTSSSLMSGFDFDF
Ga0335081_1046223533300032892SoilFTSSLGNIDNYVFGFRWMPIMNNRAGFAWHNEYSWIRWQGMAPDGTALTSSSLMSGFDFD
Ga0335074_1128879513300032895SoilMNPRAGFAWHNEYSWLRTQGLSPVTGTALTSSSLFSGFDFDF
Ga0335084_1238024613300033004SoilNPRAGFALHNEYSWLRQRGTSPVTGTDLTTSSLILGFDFDF
Ga0335077_1023264533300033158SoilDTYVFGMRWMPFMTSRAGLAWHNEYSWNRVQGAAQDGTAVTGSSLMSGLDFDF
Ga0335077_1115968313300033158SoilNIDSYVFGMRWMPFMTNRAGFAWHNEYSWIRWQGMAPDGTALTSSSLMSGFDFDF
Ga0370515_0019060_31_1653300034163Untreated Peat SoilMPIMTSRAGFAWHNEYNWLRQSKAAPDGTDLTSSELLLGFDFAF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.