| Basic Information | |
|---|---|
| Family ID | F073282 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MAHFAKVENNIVQQVIVVSNDDCGGGNFPESEPIGQEFIASLGL |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 95.76 % |
| % of genes near scaffold ends (potentially truncated) | 98.33 % |
| % of genes from short scaffolds (< 2000 bps) | 88.33 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (80.000 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.44% β-sheet: 20.83% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF13469 | Sulfotransfer_3 | 1.67 |
| PF01844 | HNH | 0.83 |
| PF13022 | HTH_Tnp_1_2 | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.00 % |
| Unclassified | root | N/A | 10.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109231286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 646 | Open in IMG/M |
| 3300002835|B570J40625_100961543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300004112|Ga0065166_10108848 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300004112|Ga0065166_10407858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 568 | Open in IMG/M |
| 3300005581|Ga0049081_10249526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 623 | Open in IMG/M |
| 3300005583|Ga0049085_10156492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 767 | Open in IMG/M |
| 3300005613|Ga0074649_1217450 | Not Available | 568 | Open in IMG/M |
| 3300006802|Ga0070749_10155524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1328 | Open in IMG/M |
| 3300006802|Ga0070749_10214281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1099 | Open in IMG/M |
| 3300006810|Ga0070754_10233853 | Not Available | 845 | Open in IMG/M |
| 3300007363|Ga0075458_10044143 | Not Available | 1406 | Open in IMG/M |
| 3300007516|Ga0105050_10201742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1246 | Open in IMG/M |
| 3300007516|Ga0105050_10217614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1190 | Open in IMG/M |
| 3300007516|Ga0105050_10256053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1079 | Open in IMG/M |
| 3300007516|Ga0105050_10257422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1076 | Open in IMG/M |
| 3300007516|Ga0105050_10260913 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300007523|Ga0105052_10300221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
| 3300007523|Ga0105052_10303244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1060 | Open in IMG/M |
| 3300007523|Ga0105052_10335735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 998 | Open in IMG/M |
| 3300007523|Ga0105052_10409468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
| 3300007538|Ga0099851_1023286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2502 | Open in IMG/M |
| 3300007541|Ga0099848_1122016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 984 | Open in IMG/M |
| 3300007541|Ga0099848_1176350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 778 | Open in IMG/M |
| 3300007542|Ga0099846_1032368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2011 | Open in IMG/M |
| 3300007542|Ga0099846_1073599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctDWo9 | 1275 | Open in IMG/M |
| 3300007542|Ga0099846_1088090 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300007722|Ga0105051_10322422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1162 | Open in IMG/M |
| 3300007722|Ga0105051_10410866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300007722|Ga0105051_10626753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 789 | Open in IMG/M |
| 3300007864|Ga0105749_1147317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 551 | Open in IMG/M |
| 3300007960|Ga0099850_1181668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 835 | Open in IMG/M |
| 3300008116|Ga0114350_1124156 | Not Available | 771 | Open in IMG/M |
| 3300008266|Ga0114363_1160562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 735 | Open in IMG/M |
| 3300009051|Ga0102864_1007336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2745 | Open in IMG/M |
| 3300009149|Ga0114918_10321354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 860 | Open in IMG/M |
| 3300009159|Ga0114978_10241447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1125 | Open in IMG/M |
| 3300009469|Ga0127401_1104637 | Not Available | 745 | Open in IMG/M |
| 3300010370|Ga0129336_10076487 | Not Available | 1978 | Open in IMG/M |
| 3300010370|Ga0129336_10235847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10380323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 805 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10378356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 820 | Open in IMG/M |
| 3300017707|Ga0181363_1072042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 597 | Open in IMG/M |
| 3300017736|Ga0181365_1153914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 544 | Open in IMG/M |
| 3300017736|Ga0181365_1176387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 500 | Open in IMG/M |
| 3300017747|Ga0181352_1145406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 630 | Open in IMG/M |
| 3300017774|Ga0181358_1057380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1459 | Open in IMG/M |
| 3300017774|Ga0181358_1153085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 786 | Open in IMG/M |
| 3300017777|Ga0181357_1093630 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
| 3300017777|Ga0181357_1108498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1048 | Open in IMG/M |
| 3300017777|Ga0181357_1290717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 557 | Open in IMG/M |
| 3300017778|Ga0181349_1106977 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| 3300017778|Ga0181349_1169544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 772 | Open in IMG/M |
| 3300017780|Ga0181346_1123366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 991 | Open in IMG/M |
| 3300017780|Ga0181346_1147499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 883 | Open in IMG/M |
| 3300017780|Ga0181346_1260136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 603 | Open in IMG/M |
| 3300017784|Ga0181348_1084515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1255 | Open in IMG/M |
| 3300017784|Ga0181348_1087546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1229 | Open in IMG/M |
| 3300017784|Ga0181348_1127153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctDWo9 | 974 | Open in IMG/M |
| 3300017785|Ga0181355_1049081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1795 | Open in IMG/M |
| 3300017785|Ga0181355_1057352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1649 | Open in IMG/M |
| 3300017785|Ga0181355_1097616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1217 | Open in IMG/M |
| 3300017785|Ga0181355_1117738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1089 | Open in IMG/M |
| 3300017788|Ga0169931_10370224 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300017971|Ga0180438_10773949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 702 | Open in IMG/M |
| 3300019784|Ga0181359_1260731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 520 | Open in IMG/M |
| 3300020074|Ga0194113_10081041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2933 | Open in IMG/M |
| 3300020179|Ga0194134_10047696 | All Organisms → Viruses → Predicted Viral | 2394 | Open in IMG/M |
| 3300020190|Ga0194118_10275448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 913 | Open in IMG/M |
| 3300020193|Ga0194131_10124594 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
| 3300020197|Ga0194128_10152393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1316 | Open in IMG/M |
| 3300020200|Ga0194121_10401829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 678 | Open in IMG/M |
| 3300020214|Ga0194132_10544984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 565 | Open in IMG/M |
| 3300020220|Ga0194119_10282390 | Not Available | 1122 | Open in IMG/M |
| 3300021091|Ga0194133_10090474 | All Organisms → Viruses → Predicted Viral | 2391 | Open in IMG/M |
| 3300021960|Ga0222715_10532721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 618 | Open in IMG/M |
| 3300021963|Ga0222712_10028511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4466 | Open in IMG/M |
| 3300021963|Ga0222712_10336009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 936 | Open in IMG/M |
| 3300021963|Ga0222712_10731785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 553 | Open in IMG/M |
| 3300022167|Ga0212020_1063241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 626 | Open in IMG/M |
| 3300022179|Ga0181353_1055434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C449 | 1031 | Open in IMG/M |
| 3300022179|Ga0181353_1104836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 691 | Open in IMG/M |
| 3300022190|Ga0181354_1195544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 606 | Open in IMG/M |
| 3300022200|Ga0196901_1210030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 621 | Open in IMG/M |
| 3300022407|Ga0181351_1130345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctDWo9 | 931 | Open in IMG/M |
| 3300022752|Ga0214917_10208066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 956 | Open in IMG/M |
| 3300022752|Ga0214917_10438814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 524 | Open in IMG/M |
| 3300023184|Ga0214919_10828614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 501 | Open in IMG/M |
| 3300024348|Ga0244776_10035572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3981 | Open in IMG/M |
| 3300024515|Ga0255183_1108205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 539 | Open in IMG/M |
| 3300025647|Ga0208160_1010292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3186 | Open in IMG/M |
| 3300025896|Ga0208916_10446081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300027079|Ga0255188_1025154 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
| 3300027079|Ga0255188_1027998 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300027157|Ga0255204_1067331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 641 | Open in IMG/M |
| 3300027213|Ga0208555_1068247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 542 | Open in IMG/M |
| 3300027503|Ga0255182_1004814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5340 | Open in IMG/M |
| 3300027804|Ga0209358_10078783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1874 | Open in IMG/M |
| 3300027832|Ga0209491_10808166 | Not Available | 501 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10505630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 585 | Open in IMG/M |
| 3300027956|Ga0209820_1026017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1511 | Open in IMG/M |
| 3300027974|Ga0209299_1144339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctDWo9 | 902 | Open in IMG/M |
| 3300027976|Ga0209702_10135241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
| 3300027976|Ga0209702_10144019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
| 3300027976|Ga0209702_10178687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 917 | Open in IMG/M |
| 3300027983|Ga0209284_10182732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1092 | Open in IMG/M |
| 3300028073|Ga0255180_1055512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 768 | Open in IMG/M |
| 3300028083|Ga0255190_1036507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 774 | Open in IMG/M |
| 3300028086|Ga0255201_1029455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 890 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1232288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 731 | Open in IMG/M |
| 3300031519|Ga0307488_10361801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 911 | Open in IMG/M |
| 3300031565|Ga0307379_10395139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1327 | Open in IMG/M |
| 3300031885|Ga0315285_10656244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 684 | Open in IMG/M |
| 3300032462|Ga0335396_10362340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 940 | Open in IMG/M |
| 3300034062|Ga0334995_0110308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2064 | Open in IMG/M |
| 3300034062|Ga0334995_0313049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1023 | Open in IMG/M |
| 3300034092|Ga0335010_0649067 | Not Available | 527 | Open in IMG/M |
| 3300034105|Ga0335035_0052614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2680 | Open in IMG/M |
| 3300034279|Ga0335052_0489723 | Not Available | 638 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 15.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.50% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 6.67% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.50% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.50% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.67% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.67% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.83% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.83% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.83% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.83% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.83% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.83% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.83% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027079 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027157 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
| 3300028073 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d | Environmental | Open in IMG/M |
| 3300028083 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300028086 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1092312861 | 3300002408 | Freshwater | MAHFAKITGDTVVQVIVVSNEDCGNLEFPESEPVGQAFIASIGLDGEWR |
| B570J40625_1009615432 | 3300002835 | Freshwater | MAHFAQIVGDTVVQVIVVSNDDCGNLEFPASEQLGRDFIASIGLQG |
| Ga0065166_101088482 | 3300004112 | Freshwater Lake | MAHFAQLAGDTVTQVIVVSNDDCGNLEFPASEPVGQEFIASIGLDGVW |
| Ga0065166_104078582 | 3300004112 | Freshwater Lake | MAHFAEISGNTVTQVIVVSNDDCGNLEFPASEPVGQEFIASIGLDGVW |
| Ga0049081_102495261 | 3300005581 | Freshwater Lentic | MAHFAKMENDFVREVIVIGNDDCGGGDFPASEPVGQAFIASIGLTGEWLQT |
| Ga0049085_101564922 | 3300005583 | Freshwater Lentic | MAHFAEMKNQIVQQVIVVSNDDCDNLPFPESEPVGQAFIASLGFT |
| Ga0074649_12174502 | 3300005613 | Saline Water And Sediment | VVIIAHFAKIENGVVTQVIVVDNKDCGDVDFPESEPIGAAFINSI |
| Ga0070749_101555242 | 3300006802 | Aqueous | MAHFAKIENNKVTSVIVVSNDDCGGGEFPESEPAGQAFLAS |
| Ga0070749_102142811 | 3300006802 | Aqueous | MAHFAKIENDTVTEVIVVSNDDCGGGEFPESETIGQAFLASLGLEG |
| Ga0070754_102338532 | 3300006810 | Aqueous | MAHFAKIENNKVTQVIVVSNNVLEGKDFPESEPIGQQFISSLNLGGTWKQ |
| Ga0075458_100441433 | 3300007363 | Aqueous | MAHFAQVNSNNKVEQVIVVSNDDCGGGTFPDSEPIGQAFIASLG |
| Ga0105050_102017422 | 3300007516 | Freshwater | MAHFAKVDNGIVGQVIVVANDDCGGGTFPASEPIGQAF |
| Ga0105050_102176141 | 3300007516 | Freshwater | MAHFAQTQNGVVGQVIVVSNDDCGGGSFPASEPIGQAFIASLGLDGDWLQTSYHANFRGL |
| Ga0105050_102560532 | 3300007516 | Freshwater | MAHFAQVTDNIVRNVIVVNNSDCGGGEFPESEPIGQA |
| Ga0105050_102574222 | 3300007516 | Freshwater | VAHFAEVDEGQIVRSVIVVNNSDCGGGDFPESEPIGQAFIADIGITGDWLQ |
| Ga0105050_102609131 | 3300007516 | Freshwater | VAHFAEVDEYQIVRNVIVVNNSDCGGGDFPESEPIGQA |
| Ga0105052_103002211 | 3300007523 | Freshwater | MAHFAKVDNGIVGQVIVVANDDCGGGTFPASEPIGQAFIASLGLTGDWLQTSYHAN |
| Ga0105052_103032442 | 3300007523 | Freshwater | VAHFAEVDEYQIVRNVIVVNNSDCGGGDFPESEPIGQAFIA |
| Ga0105052_103357351 | 3300007523 | Freshwater | MAHFAKIENGVVGQVIVVSNDDCGGGTMPESEPIGQAFIASL |
| Ga0105052_104094681 | 3300007523 | Freshwater | MAHFARIENDVVREVIVVANDDCGGGTMPESEPIGQAF |
| Ga0099851_10232861 | 3300007538 | Aqueous | MAHFARVEGGIVREVIVINNSDCGGGDFPESEPIGQTFIAAIGLSGEYLQ |
| Ga0099848_11220161 | 3300007541 | Aqueous | MAHFAKVDNGIVSQVIVVSNDDCGGGNFPESEAVGQAFIASL |
| Ga0099848_11763501 | 3300007541 | Aqueous | MAHFAKVDNGIVSQVIVVSNDDCGGGDFPASEAPGQA |
| Ga0099846_10323684 | 3300007542 | Aqueous | MAHFAKVDNGIVSQVIVVSNDDCGGGNFPESEAVGQAFIALLGLAG |
| Ga0099846_10735992 | 3300007542 | Aqueous | MAHFAQVQDGMVQQVIVVSNDDCGGGDFPASEPIGQAFIADLGLPGEWLQTSY |
| Ga0099846_10880901 | 3300007542 | Aqueous | MAHFAKVDNGIVSQVIVVSNDDCGGGDFPASEAAGQAFIASLGLAGEWKQTSYSASF |
| Ga0105051_103224224 | 3300007722 | Freshwater | MAHFAKVDNGIVGQVIVVANDDCGGGTFPASEPIGQAFIASLGLTGDWLQTSYHANFRAL |
| Ga0105051_104108662 | 3300007722 | Freshwater | MAHFAQVTNGIVQTVIAVSNDDCGGGTMPESEPIGQAFIASLGLEGDWLQT |
| Ga0105051_106267532 | 3300007722 | Freshwater | MAHFAQTQNGVVGQVIVVSNDDCGGGSFPASEPIGQAFIASLGLDGDW |
| Ga0105749_11473171 | 3300007864 | Estuary Water | MAHFAKVNNNTVEEVIVIANDDCGGGNFPESEPIGKAFIALLG |
| Ga0099850_11816681 | 3300007960 | Aqueous | MAHFAQVQDGMVQQVIVVSNDDCGGGDFPASEPIGQAFIADLG |
| Ga0114350_11241561 | 3300008116 | Freshwater, Plankton | MAHFAQLNDNNTVTQVIVVANNDCGALDFPASDPVGQAFIA |
| Ga0114363_11605622 | 3300008266 | Freshwater, Plankton | MAHFANLKNGIVEQVIVVANENCGGGDFPDSEPIGQEFLASI |
| Ga0102864_10073361 | 3300009051 | Estuarine | MAHFAKVNNNTVEEVIVIANDDCGGGNFPESELIG |
| Ga0114918_103213541 | 3300009149 | Deep Subsurface | MAHFAQISGNSVIQVIVISNEDCGGGDFPTSEPIGQAFIASLGLTGEWLQTSYHANF |
| Ga0114978_102414473 | 3300009159 | Freshwater Lake | MAHFAELKNGTVVRVIVIANSDCGGGNFPESEPIGQAFIASLGIDGEWL |
| Ga0127401_11046371 | 3300009469 | Meromictic Pond | VAHFARVEDGIVREVIVVADSDCAGGDYPTAEPAGQAFIASIGLAGTWRQTSYNSN |
| Ga0129336_100764874 | 3300010370 | Freshwater To Marine Saline Gradient | MAHFAKIENNIVQDVIVVSNDVCGSEFPASEPVGQEFIANVLKLDGEWKQT |
| Ga0129336_102358472 | 3300010370 | Freshwater To Marine Saline Gradient | MAHFARIDSGNIVRDVIVISNDDCGGGDFPASEPVGQAFIN |
| (restricted) Ga0172367_103803233 | 3300013126 | Freshwater | VAHFARVENGIVQQVIVIGNDDCAGGDFPESEAAGQAFIASIG |
| (restricted) Ga0172376_103783563 | 3300014720 | Freshwater | VAHFARVENGIVQQVIVIGNDDCAGGDFPESEAAGQAFIASIGLS |
| Ga0181363_10720422 | 3300017707 | Freshwater Lake | MAHFAKVENNIVQQVIVVSNDDCGGGNFPESEPIGQEFIASLGL |
| Ga0181365_11539142 | 3300017736 | Freshwater Lake | MAHFAQVDQNKVQQVIVIANDDCGGGEFPESEPIGQAFIASLGLS |
| Ga0181365_11763872 | 3300017736 | Freshwater Lake | MAHFAQVSNGIVSQVIVVSNDDCGGGDFPASEPVGQAFIASL |
| Ga0181352_11454062 | 3300017747 | Freshwater Lake | MAHFAKITNDNKVEQVIVISNDDCGNGKFPESEPIGQAYIASLGLTGLWLQ |
| Ga0181358_10573801 | 3300017774 | Freshwater Lake | MAHFAQLDNNNIVQTVIVVANDDCGGGDYPASEPVGQTFLASLGFTGLW |
| Ga0181358_11530851 | 3300017774 | Freshwater Lake | MAHFAEITNNTVAQVIVIANDDCGGGNFPESEPIGQAFIASLGF |
| Ga0181357_10936303 | 3300017777 | Freshwater Lake | MAHFAEVFDGIVQQVIVVANSDCGDREFPESEPIGQAFIASLGIDGEWK |
| Ga0181357_11084981 | 3300017777 | Freshwater Lake | MAHFAKIINDTVTQVIVVNNDDCGGGVFPESEPIGQTYI |
| Ga0181357_12907171 | 3300017777 | Freshwater Lake | MAHFAQVDQNKVQQVIVIANDDCGGGEFPESEPIGQAFIASLGLSGLWLQCSYHANF |
| Ga0181349_11069771 | 3300017778 | Freshwater Lake | MAHFAQVSDGIVRIVIVVSNVDCAGGDFPASEAVCQAFIASLGLAGE |
| Ga0181349_11695441 | 3300017778 | Freshwater Lake | MAHFAKIENNIVQQVIVVSNDDCGGGVFPDSEVVGQEFLASLGLTGEW |
| Ga0181346_11233662 | 3300017780 | Freshwater Lake | MAHFAEVFDGIVQQVIVVANSDCGDREFPESEPIGQAFIASLGI |
| Ga0181346_11474991 | 3300017780 | Freshwater Lake | MAHFAQVDQNKVQQLIVIANDVCGGGESPESEPIGQAFIASLGLSGLWLQCSYHA |
| Ga0181346_12601361 | 3300017780 | Freshwater Lake | MAHFAQVDQNKGQQVIVIANDDCGGGEFPESEPIGQAFIASLGLSG |
| Ga0181348_10845153 | 3300017784 | Freshwater Lake | VAHFAQVSDGIVRCVIVVSNDDCGGGDFPTSEAVGQAFIASLGLAGEWK |
| Ga0181348_10875462 | 3300017784 | Freshwater Lake | MAHFAKIENGIVTNVIVISNDDCGGGNFPESNPIGQAFIASLN |
| Ga0181348_11271531 | 3300017784 | Freshwater Lake | MAHFAQVDQNIVQQVIVIANDDCGGGEFPESEPIGQAFIA |
| Ga0181355_10490811 | 3300017785 | Freshwater Lake | MAHFAKIENGIVTNVIVVSNDDCGGGNFPESNPIGQAFIASLNIDGIWQQT |
| Ga0181355_10573521 | 3300017785 | Freshwater Lake | MAHFVKIENNLVTNGIVLNNDVCGGGEFPESEPIGQAFIASLGLTGLRLQTS |
| Ga0181355_10976162 | 3300017785 | Freshwater Lake | MAHFAKIENNKVTDVIVVSNDDCGGGDFPESEPIGQKFLASLGL |
| Ga0181355_11177382 | 3300017785 | Freshwater Lake | MAHFAQVDQNKVQQVIVIANDDCGGGEFPESEPIGQAFIASLGLSGLWLQCSYHA |
| Ga0169931_103702241 | 3300017788 | Freshwater | MAHFARVDNGVVREVIVVSNDDCAGGDFPESEAAGQAFIASIGLSGEWRQTSYN |
| Ga0169931_107686681 | 3300017788 | Freshwater | MAHFAKIENGIVREVIVVGNGDCAGGDFPESEAAGQAFIASIGLS |
| Ga0180438_107739492 | 3300017971 | Hypersaline Lake Sediment | MAHFARISDNIVQQVIVVSNDDCGGGNFPESEPIGQQFIAS |
| Ga0181359_12607311 | 3300019784 | Freshwater Lake | VAHFAQVSDGIVRCVIVVSNDDCGGGDFPTSEAVGQAFIASLGLAGEWKQ |
| Ga0194113_100810411 | 3300020074 | Freshwater Lake | MAHFAKIENGVVQNVIVVSNDDCGGGNFPESEPVGQAFIASLGIAGEWKQ |
| Ga0194134_100476961 | 3300020179 | Freshwater Lake | VAHFARVENGIVREVIVVGNDDCAGGDFPESEAAGQAFIASIGLSGEWR |
| Ga0194118_102754482 | 3300020190 | Freshwater Lake | VAHFAQINNGVVLEVIVVSNDDCAGGDFPESEAAGQAFIASLGLAGEWR |
| Ga0194131_101245941 | 3300020193 | Freshwater Lake | VAHFAKVENGVVQSVIVVSNDDCGGGEFPESEPIG |
| Ga0194128_101523931 | 3300020197 | Freshwater Lake | VAHFARVENGIVQQVIVVSNGDCAGGDFPEGEAAGQAFIASIGLAGEWRQTSYNNNFR |
| Ga0194121_104018292 | 3300020200 | Freshwater Lake | VAHFANINNGIVSQVIVVSNDDCAGGDFPESEAAGQAFIASIGLSGEWR |
| Ga0194132_105449841 | 3300020214 | Freshwater Lake | MAHFARIIGNTVVQVIVVSNDDCAGGDFPESEAAGQAFIASLGLSGEWRQT |
| Ga0194119_102823901 | 3300020220 | Freshwater Lake | MAHFALVENGIVRNVIVIGNGDCAGGDFPESEAAGQAFIASLGLA |
| Ga0194133_100904741 | 3300021091 | Freshwater Lake | VAHFARVENGIVSQVIVVSNGDCAGGDFPESEAAGQAFIASIGLAGEW |
| Ga0222715_105327211 | 3300021960 | Estuarine Water | MAHFAKIQNDTVIEVIVISNDDCGGGEFPESEPIGQAFIAS |
| Ga0222712_100285111 | 3300021963 | Estuarine Water | MAHFAKVENGVVQQVIVVSNDDCGGGEFPESEPIGQAFI |
| Ga0222712_103360091 | 3300021963 | Estuarine Water | MAHFAKIENGIVREVIVVGNDDCNGGNFPESEAPGQAFIASIGLVGEWRQTSYSASFRSK |
| Ga0222712_107317851 | 3300021963 | Estuarine Water | MAHFAKIENNTVTSVIVVSNDDCGGGEFPESEPIGQAFI |
| Ga0212020_10632412 | 3300022167 | Aqueous | MAHFAKVVNNKVTEVIVVSNDDCGNGDFPSSEAIGQAFIASLGLTGEWLQTSYSGS |
| Ga0181353_10554342 | 3300022179 | Freshwater Lake | MAHFAKIKNNTVAEVIVIGNDNCGGGEFPESEPIGQAFIASLGFDGLWLQTI |
| Ga0181353_11048361 | 3300022179 | Freshwater Lake | MAHFARVENNIVKQVIVVSNDDCGGGNFPESEPIGQEFIASLGLSGDWL |
| Ga0181354_11955442 | 3300022190 | Freshwater Lake | VAHFAQVSDGIVRCVIVVSNDDCGGGEFPASEQVGQAFI |
| Ga0196901_12100301 | 3300022200 | Aqueous | MAHFAKVNNNNVDEVIVIANDDCGNLEFPESEPVGQAFIASLGL |
| Ga0181351_11303452 | 3300022407 | Freshwater Lake | MAHFAQVDQNKVQQVIVIANDDCGGGEFPESEPIGQAFIASLGLSG |
| Ga0214917_102080661 | 3300022752 | Freshwater | MAHFARISNGQVAQVIVIANDDCGGGDFPASEAAGQAFIASLGLAGEWKQ |
| Ga0214917_104388141 | 3300022752 | Freshwater | MAHFARISNGQVAQVIVVSNDDCGGGDFPASEPIGQAFIASLGLA |
| Ga0214919_108286142 | 3300023184 | Freshwater | MAHFAKVENNIVQQVIVVSNDDCGGNEFPESEPIGQAFIASLG |
| Ga0244776_100355721 | 3300024348 | Estuarine | MAHFAQIVGDTVVQVIVVGNDDCAGGTFPESEPAGQEFIASLGLPGEWK |
| Ga0255183_11082051 | 3300024515 | Freshwater | MAHFAQVENGIVRTVTVIANDDCGGGNFPESEPIGQAFIASLGLAGEWKQTSY |
| Ga0208160_10102924 | 3300025647 | Aqueous | MAHFAQISNNIVRQVIVVSNDDCAGGDFPESEAPGQAFIASLGLE |
| Ga0208916_104460812 | 3300025896 | Aqueous | MAHFAQIKNGFVTQVIVVANADCGGGDFPASEPAGQAFIASLGIEGEWLQTSYSGSF |
| Ga0255188_10251542 | 3300027079 | Freshwater | MAHFAKVDNGIVQTVIVVSNDDCGGGDFPASEPVGQAFIASLGIAGEWKQT |
| Ga0255188_10279982 | 3300027079 | Freshwater | MAHFAKVENGVVQQVIVVSNDDCGGGEFPESEPIGQTFLASLGIEGNW |
| Ga0255204_10673312 | 3300027157 | Freshwater | MAHFAKVENGVVQQVIVVSNDDCGGGEFPESEPIGQTFLA |
| Ga0208555_10682472 | 3300027213 | Estuarine | MAHFAQIVNNVVNNVIVISNDDCGGGEFPASEPIGQ |
| Ga0255182_10048141 | 3300027503 | Freshwater | MAHFAQVENGIVRTVTVIANDDCGGGNFPESEPIGQAFIAS |
| Ga0209296_11195462 | 3300027759 | Freshwater Lake | MAHFAQIDDNGMVVQVHVINNHDIGGGDFPESEALGQAFQASLGITG |
| Ga0209358_100787831 | 3300027804 | Freshwater Lake | MAHFARVENNIVKQVIVVSNDDCGGGDFPESELIGQEFIASLGLSGD |
| Ga0209491_108081662 | 3300027832 | Freshwater | VAHFARVADGIVQEVIVVADSDCAGGSFPESETVGQSFIASVGLQGEWLQTSYNSNFRGM |
| (restricted) Ga0233415_105056301 | 3300027861 | Seawater | MAHFAKVENDNISNVIVISNDDCNGGDFPTSEATGQAFIADLGLSGTWK |
| Ga0209820_10260171 | 3300027956 | Freshwater Sediment | MAHFASVENKIVGQVIVVANEDCGGGDFPESEPIGQAFIASLGLEGEWLQTSY |
| Ga0209299_11443392 | 3300027974 | Freshwater Lake | MAHFAQIDQNKVQQVIVIANDDCGGGEFPESEPIGQAFIASLG |
| Ga0209702_101352411 | 3300027976 | Freshwater | MAHFAQTQNGVVGQVIVVSNDDCGGGSFPASEPIGQAFIASLGLDGDWLQTSYHA |
| Ga0209702_101440192 | 3300027976 | Freshwater | MAHFAQTQNGVVGQVIVVSNDDCGGGTFPESEPIGQAFIASLGLTGDW |
| Ga0209702_101786872 | 3300027976 | Freshwater | MAHFAKVTENIVQQVIVISNDDCGGGTMPASEPIGQAFIASLGLTGDWLQTSYHNN |
| Ga0209284_101827321 | 3300027983 | Freshwater | MAHFAEVTDNIVCNVIVVNNSDCGGGDFPESEPIGQAFIA |
| Ga0255180_10555122 | 3300028073 | Freshwater | MAHFARIQNRIVQEVNVINNADCGGGNFPDSEPIGQAFIASLGLAGEWKQTSY |
| Ga0255190_10365071 | 3300028083 | Freshwater | MAHFAKVDNGIVQTVIVVSNDDCGGGDFPASEPVGQAFIASLGL |
| Ga0255201_10294551 | 3300028086 | Freshwater | MAHFAKVDNGIVQTVIVVSNDDCGGGDFPASEPVGQAFIASLGLAGEWV |
| (restricted) Ga0247839_12322882 | 3300028553 | Freshwater | MAHFAKIDNGKVQQVIVVSNDDCAGGDFPESEAAGQAFIASL |
| Ga0307488_103618012 | 3300031519 | Sackhole Brine | MAHFARVENGIVREVIVVGNDDCGGGEHPAAEPIGQAFIASIGLTGEWRQT |
| Ga0307379_103951394 | 3300031565 | Soil | MAHFAKIENNKVTNCIVVKNEDCGGGNFPESEVIGQAFIAS |
| Ga0315285_106562441 | 3300031885 | Sediment | MAHFAKIENNTVRQVIAVSNDDCGGGDYPDSEPIGQAFIAS |
| Ga0335396_103623402 | 3300032462 | Freshwater | MAHFAQTQNGVVGQVIVVSNDDCGGGSFPASEPIGQAFIASLGLDGDWLQTSY |
| Ga0334995_0110308_2_151 | 3300034062 | Freshwater | MAHFAEMSNNIVQRVIVVSNDDCGGGDFPESEPIGQSFIASIGLTGEWLQ |
| Ga0334995_0313049_3_134 | 3300034062 | Freshwater | MAHFAKVQNNIVQQVIVVSNDDCGGGDFPESEPIGQAFLASLGL |
| Ga0335010_0649067_2_151 | 3300034092 | Freshwater | MAHFARVEDGIVREVIVVGNDDCDGGDFPGSEAAGQAFIASIGLAGQWHQ |
| Ga0335035_0052614_2541_2678 | 3300034105 | Freshwater | MAHFAKVENNIVVEVIVVANDDCAGGEFPEGEHVGQAFIASLGLDG |
| Ga0335052_0489723_497_637 | 3300034279 | Freshwater | MAHFAKVENNIVVEVIVVANDDCAGGEFPEGEHVGQAFIASLGLDGL |
| ⦗Top⦘ |