| Basic Information | |
|---|---|
| Family ID | F073253 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVELA |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 68.91 % |
| % of genes near scaffold ends (potentially truncated) | 26.67 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (40.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (44.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (79.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 60.00% Coil/Unstructured: 40.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF08401 | ArdcN | 7.50 |
| PF03237 | Terminase_6N | 4.17 |
| PF13481 | AAA_25 | 0.83 |
| PF08241 | Methyltransf_11 | 0.83 |
| PF11753 | DUF3310 | 0.83 |
| PF00145 | DNA_methylase | 0.83 |
| PF10263 | SprT-like | 0.83 |
| PF00959 | Phage_lysozyme | 0.83 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 7.50 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.00 % |
| Unclassified | root | N/A | 40.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_110213025 | Not Available | 753 | Open in IMG/M |
| 3300003277|JGI25908J49247_10045123 | All Organisms → Viruses → Predicted Viral | 1172 | Open in IMG/M |
| 3300003393|JGI25909J50240_1015361 | All Organisms → Viruses → Predicted Viral | 1818 | Open in IMG/M |
| 3300003394|JGI25907J50239_1029319 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300003499|JGI25930J51415_1005892 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300004240|Ga0007787_10364583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED182 | 718 | Open in IMG/M |
| 3300004240|Ga0007787_10627117 | Not Available | 538 | Open in IMG/M |
| 3300004797|Ga0007764_10333010 | Not Available | 517 | Open in IMG/M |
| 3300005517|Ga0070374_10672943 | Not Available | 512 | Open in IMG/M |
| 3300005580|Ga0049083_10026909 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
| 3300005580|Ga0049083_10034225 | All Organisms → Viruses → Predicted Viral | 1811 | Open in IMG/M |
| 3300005581|Ga0049081_10027765 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
| 3300005581|Ga0049081_10042826 | Not Available | 1718 | Open in IMG/M |
| 3300005581|Ga0049081_10050397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1576 | Open in IMG/M |
| 3300005581|Ga0049081_10097036 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
| 3300005582|Ga0049080_10120664 | Not Available | 886 | Open in IMG/M |
| 3300005805|Ga0079957_1025851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3978 | Open in IMG/M |
| 3300005805|Ga0079957_1132488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1297 | Open in IMG/M |
| 3300005805|Ga0079957_1153927 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| 3300006805|Ga0075464_10084362 | All Organisms → Viruses → Predicted Viral | 1807 | Open in IMG/M |
| 3300006805|Ga0075464_10175797 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300006805|Ga0075464_10279007 | Not Available | 1003 | Open in IMG/M |
| 3300006805|Ga0075464_11068437 | Not Available | 508 | Open in IMG/M |
| 3300008107|Ga0114340_1108539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
| 3300008110|Ga0114343_1075785 | Not Available | 2109 | Open in IMG/M |
| 3300008266|Ga0114363_1013148 | All Organisms → cellular organisms → Bacteria | 3836 | Open in IMG/M |
| 3300008448|Ga0114876_1011245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5066 | Open in IMG/M |
| 3300009152|Ga0114980_10024440 | All Organisms → Viruses → Predicted Viral | 3756 | Open in IMG/M |
| 3300009155|Ga0114968_10032977 | All Organisms → Viruses → Predicted Viral | 3451 | Open in IMG/M |
| 3300009158|Ga0114977_10727600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300009159|Ga0114978_10112320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1787 | Open in IMG/M |
| 3300009159|Ga0114978_10125512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1672 | Open in IMG/M |
| 3300009160|Ga0114981_10176108 | Not Available | 1176 | Open in IMG/M |
| 3300009161|Ga0114966_10024562 | All Organisms → Viruses → Predicted Viral | 4518 | Open in IMG/M |
| 3300009184|Ga0114976_10579510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300010354|Ga0129333_10598082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300011114|Ga0151515_10036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 52859 | Open in IMG/M |
| 3300011335|Ga0153698_1036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 56649 | Open in IMG/M |
| 3300012012|Ga0153799_1020189 | Not Available | 1347 | Open in IMG/M |
| 3300012666|Ga0157498_1064654 | Not Available | 563 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10129898 | All Organisms → Viruses → Predicted Viral | 1704 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10144678 | All Organisms → Viruses → Predicted Viral | 1580 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10372764 | Not Available | 816 | Open in IMG/M |
| 3300015050|Ga0181338_1009061 | Not Available | 1652 | Open in IMG/M |
| 3300015050|Ga0181338_1033038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300015050|Ga0181338_1067279 | Not Available | 511 | Open in IMG/M |
| 3300017700|Ga0181339_1009217 | Not Available | 1175 | Open in IMG/M |
| 3300017700|Ga0181339_1009396 | Not Available | 1162 | Open in IMG/M |
| 3300017716|Ga0181350_1043057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED282 | 1217 | Open in IMG/M |
| 3300017716|Ga0181350_1064015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
| 3300017716|Ga0181350_1093697 | Not Available | 746 | Open in IMG/M |
| 3300017722|Ga0181347_1044117 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300017747|Ga0181352_1008439 | All Organisms → cellular organisms → Bacteria | 3376 | Open in IMG/M |
| 3300017747|Ga0181352_1011798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2815 | Open in IMG/M |
| 3300017777|Ga0181357_1142256 | Not Available | 888 | Open in IMG/M |
| 3300017777|Ga0181357_1207977 | Not Available | 695 | Open in IMG/M |
| 3300017777|Ga0181357_1259685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300017778|Ga0181349_1065343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED282 | 1403 | Open in IMG/M |
| 3300017780|Ga0181346_1044693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1805 | Open in IMG/M |
| 3300017780|Ga0181346_1180286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300017780|Ga0181346_1240647 | Not Available | 636 | Open in IMG/M |
| 3300017780|Ga0181346_1328233 | Not Available | 512 | Open in IMG/M |
| 3300017784|Ga0181348_1191602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Aquicella → Aquicella siphonis | 739 | Open in IMG/M |
| 3300017785|Ga0181355_1161665 | Not Available | 899 | Open in IMG/M |
| 3300017785|Ga0181355_1183968 | Not Available | 829 | Open in IMG/M |
| 3300017785|Ga0181355_1202754 | Not Available | 779 | Open in IMG/M |
| 3300017785|Ga0181355_1296402 | Not Available | 608 | Open in IMG/M |
| 3300019783|Ga0181361_103207 | All Organisms → Viruses → Predicted Viral | 1212 | Open in IMG/M |
| 3300019784|Ga0181359_1044345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1721 | Open in IMG/M |
| 3300019784|Ga0181359_1045443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1697 | Open in IMG/M |
| 3300019784|Ga0181359_1074077 | Not Available | 1285 | Open in IMG/M |
| 3300019784|Ga0181359_1125881 | Not Available | 910 | Open in IMG/M |
| 3300020205|Ga0211731_11563239 | Not Available | 525 | Open in IMG/M |
| 3300022179|Ga0181353_1058183 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300022407|Ga0181351_1162666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300022407|Ga0181351_1188030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300022407|Ga0181351_1207542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300023179|Ga0214923_10381403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300024346|Ga0244775_10213965 | All Organisms → Viruses → Predicted Viral | 1614 | Open in IMG/M |
| 3300025896|Ga0208916_10251701 | Not Available | 768 | Open in IMG/M |
| 3300027608|Ga0208974_1026356 | All Organisms → Viruses → Predicted Viral | 1776 | Open in IMG/M |
| 3300027621|Ga0208951_1024343 | All Organisms → Viruses → Predicted Viral | 1893 | Open in IMG/M |
| 3300027644|Ga0209356_1188396 | Not Available | 560 | Open in IMG/M |
| 3300027659|Ga0208975_1060244 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300027707|Ga0209443_1128821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300027732|Ga0209442_1013285 | All Organisms → Viruses → Predicted Viral | 3963 | Open in IMG/M |
| 3300027734|Ga0209087_1000467 | Not Available | 25814 | Open in IMG/M |
| 3300027744|Ga0209355_1223328 | Not Available | 756 | Open in IMG/M |
| 3300027754|Ga0209596_1092776 | Not Available | 1442 | Open in IMG/M |
| 3300027754|Ga0209596_1106434 | Not Available | 1314 | Open in IMG/M |
| 3300027763|Ga0209088_10219116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300027770|Ga0209086_10023044 | All Organisms → Viruses → Predicted Viral | 3856 | Open in IMG/M |
| 3300027770|Ga0209086_10047245 | All Organisms → Viruses → Predicted Viral | 2440 | Open in IMG/M |
| 3300027782|Ga0209500_10152462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
| 3300027785|Ga0209246_10058494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1491 | Open in IMG/M |
| 3300027785|Ga0209246_10234995 | Not Available | 712 | Open in IMG/M |
| 3300027798|Ga0209353_10048285 | All Organisms → Viruses → Predicted Viral | 1960 | Open in IMG/M |
| 3300027798|Ga0209353_10289780 | Not Available | 696 | Open in IMG/M |
| 3300027798|Ga0209353_10385530 | Not Available | 578 | Open in IMG/M |
| 3300027804|Ga0209358_10529257 | Not Available | 531 | Open in IMG/M |
| 3300027808|Ga0209354_10386296 | Not Available | 546 | Open in IMG/M |
| 3300027900|Ga0209253_10043311 | All Organisms → Viruses → Predicted Viral | 3748 | Open in IMG/M |
| 3300027973|Ga0209298_10092015 | All Organisms → Viruses → Predicted Viral | 1334 | Open in IMG/M |
| 3300031746|Ga0315293_11038273 | Not Available | 581 | Open in IMG/M |
| 3300031758|Ga0315907_10833201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300031787|Ga0315900_10235477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1581 | Open in IMG/M |
| 3300031885|Ga0315285_10614443 | Not Available | 718 | Open in IMG/M |
| 3300031951|Ga0315904_10090896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3236 | Open in IMG/M |
| 3300031963|Ga0315901_10464932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300031999|Ga0315274_10228603 | All Organisms → Viruses → Predicted Viral | 2280 | Open in IMG/M |
| 3300031999|Ga0315274_10428889 | Not Available | 1522 | Open in IMG/M |
| 3300032053|Ga0315284_11788106 | Not Available | 635 | Open in IMG/M |
| 3300032177|Ga0315276_12385585 | Not Available | 532 | Open in IMG/M |
| 3300033233|Ga0334722_10353521 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300034012|Ga0334986_0630158 | Not Available | 507 | Open in IMG/M |
| 3300034062|Ga0334995_0028651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4824 | Open in IMG/M |
| 3300034062|Ga0334995_0281770 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300034093|Ga0335012_0236434 | Not Available | 953 | Open in IMG/M |
| 3300034104|Ga0335031_0008866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7431 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 44.17% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.33% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 8.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.50% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.83% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.33% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.50% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.50% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.83% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.83% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.83% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.83% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1102130252 | 3300001213 | Wetland | MSFMVVDLVTDEIVESNFEYKHHAELFIEVHGKDYPDAELIVESA* |
| JGI25908J49247_100451233 | 3300003277 | Freshwater Lake | MEFMVVDAVTDEIVEINFEYKTHAEMWIEVFGKNYPNAELVVELA* |
| JGI25909J50240_10153611 | 3300003393 | Freshwater Lake | RGDSMSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVELS* |
| JGI25907J50239_10293192 | 3300003394 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVELS* |
| JGI25930J51415_10058925 | 3300003499 | Freshwater Lake | MSFMVVDAVTDEIVESNFEYKNHAELFIEVHGKDYPNAELMVELA* |
| Ga0007787_103645833 | 3300004240 | Freshwater Lake | MSFMVVDAVTDEIVESNFEYKNHAELFIEVHGKDYPDAELVVESA* |
| Ga0007787_106271171 | 3300004240 | Freshwater Lake | LAFTREKAMEFMVVDAVTDEIVEINFEYKTHAEMWIEVFGKNYPDAELYVDRA* |
| Ga0007764_103330103 | 3300004797 | Freshwater Lake | MSFMVVDAVTDEIVESNFEYKNHAELFIEVHGKDYPNAEL |
| Ga0070374_106729432 | 3300005517 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVEIA* |
| Ga0049083_100269094 | 3300005580 | Freshwater Lentic | VALVFTKGKAMEFMVVDAVTDEIVEINFEYKTHAEMWIEVFGKNYPNAELVVELA* |
| Ga0049083_100342258 | 3300005580 | Freshwater Lentic | MDYVVIDENTDEIIASNFECKNHAELFIEVHKKDYPHASLYVESL* |
| Ga0049081_100277653 | 3300005581 | Freshwater Lentic | MDYAVIDAVTDQIIESNFECKAHAELFIEVHGKDYPQTELYIELI* |
| Ga0049081_100428262 | 3300005581 | Freshwater Lentic | MEFMVVDAVTDEIVESNFEYKNHAELFIEVFGKNYPNAELVVELA* |
| Ga0049081_100503977 | 3300005581 | Freshwater Lentic | MDYVVIDENTDEIIASNFECKNHAELFIEVHKKDYPNASLYVESL* |
| Ga0049081_100970362 | 3300005581 | Freshwater Lentic | MSFMVVDAVTDEIVESNFEYKHHAELFIEVHGKDYPDAELIVEVA* |
| Ga0049080_101206643 | 3300005582 | Freshwater Lentic | DVVSAFTRENAMEFMVVDAVTDEIVESNFEYKNHAELFIEVFGKNYPNAELVVELA* |
| Ga0079957_10258518 | 3300005805 | Lake | MEFMVVDAVTDEIVEINFEYKTHAEMWIEVFGKNYPDAELYVERA* |
| Ga0079957_11324883 | 3300005805 | Lake | MDYAVIDAVTDQIIESNFECKAHAELFIEVHGKEYPNAELYIEAL* |
| Ga0079957_11539272 | 3300005805 | Lake | MSFMVVDLVTDEIVESNFEYRHHAELFIEVHGKDYPNAELVVESA* |
| Ga0075464_100843621 | 3300006805 | Aqueous | MSFMVVDAVTDEIVESNFEYKNHAELFIEVHGKDYPNAELIVERS* |
| Ga0075464_101757976 | 3300006805 | Aqueous | MSFMVVDAVTDEIVESNFEYKNHAELFIEVHGKDYPNAEFIVEVA* |
| Ga0075464_102790071 | 3300006805 | Aqueous | LRQTIMSFMVVDAVTDEIVESNFEYKHHAELFIEVHGKDYPDAELIVELA* |
| Ga0075464_110684372 | 3300006805 | Aqueous | MSFMVVDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELIVERS* |
| Ga0114340_11085394 | 3300008107 | Freshwater, Plankton | MNIFRENIMDYVVIDENTDEIIASNFECKNHAELFIEVHKKDYPNASLYVESL* |
| Ga0114343_10757853 | 3300008110 | Freshwater, Plankton | MDMSFMVVDAVTDKIVESNFEYKNHAELFIEVHGKDYPNAELVVESA* |
| Ga0114363_10131485 | 3300008266 | Freshwater, Plankton | MYNEYAVIDAITDEIIESNFECRAHAELFIEVHGKEYPNAELYVESI* |
| Ga0114876_10112456 | 3300008448 | Freshwater Lake | MDMSFMVVDAVTDEIVESNFEYKNHAELFIEVHGKDYPNAELVVESA* |
| Ga0114980_100244407 | 3300009152 | Freshwater Lake | MSFMVVDAVTDEIVESNFECKNHAELFIEVHGKDYPNAELFVEVS* |
| Ga0114968_100329776 | 3300009155 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELFVEVA* |
| Ga0114977_107276002 | 3300009158 | Freshwater Lake | MSYMVIDAVTDEIVESNFECKNHAELFIEVHGKNYPDAELFVEVS* |
| Ga0114978_101123205 | 3300009159 | Freshwater Lake | MYIVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPDAELQIELGG* |
| Ga0114978_101255122 | 3300009159 | Freshwater Lake | MDYVVIDENTDEIIANNFECKSHAELFVEVYKKDYPNASLYVELI* |
| Ga0114981_101761082 | 3300009160 | Freshwater Lake | MSFMVVDAVTDEIVESNFECKNHAELFIEVHGKDYPDAELFVEVS* |
| Ga0114966_100245626 | 3300009161 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFVEVHGKDYPNAELVVELA* |
| Ga0114976_105795101 | 3300009184 | Freshwater Lake | IDAVTDEIVESNFEYKHHAELFIEVHGKDYPDAELQIELGG* |
| Ga0129333_105980822 | 3300010354 | Freshwater To Marine Saline Gradient | MSFMVVDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELIVEVA* |
| Ga0151515_1003623 | 3300011114 | Freshwater | MSFMVVDAVTDEIVESNFEYRHHAELFIEVHGKDYPNAELIVESA* |
| Ga0153698_103646 | 3300011335 | Freshwater | MSFMVVDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELIVESA* |
| Ga0153799_10201894 | 3300012012 | Freshwater | VFTKGKAMEFMVVDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVELT* |
| Ga0157498_10646542 | 3300012666 | Freshwater, Surface Ice | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVELA* |
| (restricted) Ga0172367_101298985 | 3300013126 | Freshwater | MYNEYAVIDAVTDEIIESNFECRAHAELFIEVHGKEYPNAELYVESI* |
| (restricted) Ga0172367_101446784 | 3300013126 | Freshwater | MSFMVVDAVTDEIVESNFEYKQHAELFIEVHGKNYPDAELVVESA* |
| (restricted) Ga0172367_103727643 | 3300013126 | Freshwater | MSFMVVDLVTDEIVESNFEYKQHAELFIEVHGKDYPDAELVVELA* |
| Ga0181338_10090615 | 3300015050 | Freshwater Lake | VFTKGKAMEFMVVDAVTAEIVEINFEYKTHAEMWIEVFGKNYPNAELVVELA* |
| Ga0181338_10330382 | 3300015050 | Freshwater Lake | VFTKEKVMEFMVIDAVTDEIVESNFEYKHHAELFIEVLGKNYPNAELVVEVA* |
| Ga0181338_10672792 | 3300015050 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNTELVVELA* |
| Ga0181339_10092173 | 3300017700 | Freshwater Lake | MSYMVIDAVTDEILESNFEYKHHAELFIEVHGKHYPNAELVVELS |
| Ga0181339_10093961 | 3300017700 | Freshwater Lake | MSFMVVDAVTDEIVESNFEYKNHAELFIEVFGKNYPNAELVVELA |
| Ga0181350_10430575 | 3300017716 | Freshwater Lake | VIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELQIESE |
| Ga0181350_10640154 | 3300017716 | Freshwater Lake | MDYAVIDAVTDQIIESNFECKAHAELFIEVYGKDYPQTELYIELI |
| Ga0181350_10936972 | 3300017716 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPDAELIVELA |
| Ga0181347_10441174 | 3300017722 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPDAELIV |
| Ga0181352_10084395 | 3300017747 | Freshwater Lake | VALAFTREKAMEFMVVDAVTDEIVEINFEYKTHAEMWIEVFGKNYPDAELYVDRA |
| Ga0181352_10117985 | 3300017747 | Freshwater Lake | MVVDAVTDEIVESNFEYKNHAELFIEVHGKDYPDAELVVESA |
| Ga0181357_11422562 | 3300017777 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELQIESE |
| Ga0181357_12079773 | 3300017777 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELIVEVA |
| Ga0181357_12596851 | 3300017777 | Freshwater Lake | IMSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELIVELA |
| Ga0181349_10653435 | 3300017778 | Freshwater Lake | GDSMSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELQIESE |
| Ga0181346_10446935 | 3300017780 | Freshwater Lake | DAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVELS |
| Ga0181346_11802863 | 3300017780 | Freshwater Lake | MDYAVIDAVTDQIFESNFECKAHAELFIEVHGKDYPQTELYIELI |
| Ga0181346_12406472 | 3300017780 | Freshwater Lake | MSFMVVDAVTDEIVESNFEYKNHAELFIEVFGKNYPNTELVVELA |
| Ga0181346_13282331 | 3300017780 | Freshwater Lake | EFMVVDAVTDEIVEINFEYKTHAEMWIEVHGKDYLNAELIVERS |
| Ga0181348_11916021 | 3300017784 | Freshwater Lake | MSFMVVDAVTDEIVESNFEYKNHAELFIEVFGKNYPNAEL |
| Ga0181355_11616654 | 3300017785 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPDA |
| Ga0181355_11839681 | 3300017785 | Freshwater Lake | MVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELQIESE |
| Ga0181355_12027541 | 3300017785 | Freshwater Lake | INVALVFTKEKVMEFMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELIVEVA |
| Ga0181355_12964023 | 3300017785 | Freshwater Lake | MVVDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELIVELA |
| Ga0181361_1032074 | 3300019783 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVELS |
| Ga0181359_10443454 | 3300019784 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVEIA |
| Ga0181359_10454432 | 3300019784 | Freshwater Lake | MEFMVIDAVTDEIVESNFEYKHHAELFIEVLGKNYPNAELVVEVA |
| Ga0181359_10740772 | 3300019784 | Freshwater Lake | VFTKGKAMEFMVVDAVTDEIVEINFEYKTHAEMWIEVFGKNYPNAELVVELA |
| Ga0181359_11258813 | 3300019784 | Freshwater Lake | MEFMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELIVEVA |
| Ga0211731_115632392 | 3300020205 | Freshwater | IMSFMVVDAVTDEIVESNFEYKHHAELFIEVYGKDYPDAELIVELA |
| Ga0181353_10581834 | 3300022179 | Freshwater Lake | MSFMVVDAVTDEIVESNFEYKNHAELFIEVHGKDYPDAELVVESA |
| Ga0181351_11626661 | 3300022407 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPN |
| Ga0181351_11880303 | 3300022407 | Freshwater Lake | HGKGDSMSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVELS |
| Ga0181351_12075422 | 3300022407 | Freshwater Lake | MSYMVIDAVTDEILESNFEYKHHAELFIEVHGKDYPNAELVVELS |
| Ga0214923_103814034 | 3300023179 | Freshwater | MSYMVIDAVTDEIVESNFECKNHAELFIEVHGKDYPDAELFVEVS |
| Ga0244775_102139656 | 3300024346 | Estuarine | MDYVVIDENTDEIIASNFECKNHAELFIEVHKKDYPNASLYVESL |
| Ga0208916_102517012 | 3300025896 | Aqueous | MSFMVVDAVTDEIVESNFEYKNHAELFIEVHGKDYPNAELIVERS |
| Ga0208974_10263563 | 3300027608 | Freshwater Lentic | MSFMVVDAVTDEIVESNFEYKNHAELFIEVHGKDYPNAELMVELA |
| Ga0208951_10243438 | 3300027621 | Freshwater Lentic | MDYVVIDENTDEIIASNFECKNHAELFIEVHKKDYPHASLYVESL |
| Ga0209356_11883961 | 3300027644 | Freshwater Lake | MEFMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVEIA |
| Ga0208975_10602441 | 3300027659 | Freshwater Lentic | MDYAVIDAVTDQIIESNFECKAHAELFIEVHGKDYPQTELYIELI |
| Ga0209443_11288213 | 3300027707 | Freshwater Lake | MEFMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPDAELIVELA |
| Ga0209442_10132858 | 3300027732 | Freshwater Lake | MEFMVVDAVTDEIVEINFEYKTHAEMWIEVFGKNYPNAELVVELA |
| Ga0209087_100046742 | 3300027734 | Freshwater Lake | MSYMVIDAVTDEIVESNFECKNHAELFIEVHGKNYPDAELFVEVS |
| Ga0209355_10624955 | 3300027744 | Freshwater Lake | LINVALVFTKGKAMEFMVVDAVTDEIVEINFEYKTHAEMWIEVFGKNYPNAELVVELA |
| Ga0209355_12233281 | 3300027744 | Freshwater Lake | EKVMEFMVIDAVTDEIVESNFEYKHHAELFIEVLGKNYPNAELVVEVA |
| Ga0209596_10927765 | 3300027754 | Freshwater Lake | RQTIMSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELFVEVA |
| Ga0209596_11064341 | 3300027754 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFVEVHGKDYP |
| Ga0209088_102191164 | 3300027763 | Freshwater Lake | MYIVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPDAELQIELGG |
| Ga0209086_100230449 | 3300027770 | Freshwater Lake | MSYMVIDAVTDEIVESNFEYKHHAELFVEVHGKDYPNAELVVELA |
| Ga0209086_100472457 | 3300027770 | Freshwater Lake | TDEIVESNFEYKHHAELFVEVHGKDYPNAELVVELA |
| Ga0209500_101524622 | 3300027782 | Freshwater Lake | MDYVVIDENTDEIIANNFECKSHAELFVEVYKKDYPNASLYVELI |
| Ga0209246_100584943 | 3300027785 | Freshwater Lake | MEFMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVELS |
| Ga0209246_102349953 | 3300027785 | Freshwater Lake | DEIVESNFEYKHHAELFIEVHGKDYPNAELVVEIA |
| Ga0209353_100482855 | 3300027798 | Freshwater Lake | VALVFTKGKAMEFMVVDAVTDEIVEINFEYKTHAEMWIEVFGKNYPNAELVVELA |
| Ga0209353_102897801 | 3300027798 | Freshwater Lake | YMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELVVELS |
| Ga0209353_103855301 | 3300027798 | Freshwater Lake | TDEIVESNFEYKHHAELFIEVHGKDYPNAELVVELS |
| Ga0209358_105292572 | 3300027804 | Freshwater Lake | LAFTREKAMEFMVVDAVTDEIVEINFEYKTHAEMWIEVFGKNYPDAELYVDRA |
| Ga0209354_103862961 | 3300027808 | Freshwater Lake | FTKGKAMEFMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELIVEVA |
| Ga0209253_100433119 | 3300027900 | Freshwater Lake Sediment | MSFMVVDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELIVEVA |
| Ga0209298_100920152 | 3300027973 | Freshwater Lake | MSFMVVDAVTDEIVESNFECKNHAELFIEVHGKDYPNAELFVEVS |
| Ga0315293_110382732 | 3300031746 | Sediment | MSYMVIDAVTDEIVESNFEYKHHAELFIEVLGKNYPNAELVVELA |
| Ga0315907_108332011 | 3300031758 | Freshwater | MYNEYAVIDAITDEIIESNFECRAHAELFIEVHGKEYPNAELYVESI |
| Ga0315900_102354776 | 3300031787 | Freshwater | EYAVIDAITDEIIESNFECRAHAELFIEVHGKEYPNAELYVESI |
| Ga0315285_106144432 | 3300031885 | Sediment | MSYMVIDVVTDEIVESNFEYKHHAELFIEVHGKDYPNAELQIEIQ |
| Ga0315904_100908961 | 3300031951 | Freshwater | DAITDEIIESNFECRAHAELFIEVHGKEYPNAELYVESI |
| Ga0315901_104649323 | 3300031963 | Freshwater | MSFMVIDAVTDKIVESNFEYKNHAELFIEVHGKDYPNAELVVESA |
| Ga0315274_102286039 | 3300031999 | Sediment | MDYVVIDENTEEIIASNFECKNHAELFIEVHKKDYPNASLYVELL |
| Ga0315274_104288893 | 3300031999 | Sediment | MSYMVIDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELQIEIQ |
| Ga0315284_117881062 | 3300032053 | Sediment | MSYMVVDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELQIEIQ |
| Ga0315276_123855852 | 3300032177 | Sediment | MSYMVIDAVTDEIVESNFEYKNHAELFIEVHGKDYPNAELVVEIA |
| Ga0334722_103535212 | 3300033233 | Sediment | MSYMVIDTVTDEIVESNFEYKHHAELFIEVHGKDYPNTELVVELA |
| Ga0334986_0630158_162_299 | 3300034012 | Freshwater | MSFMVVDAVTDEIVESNFEYKNHAELFIEVHGKDYPDAELIVEVA |
| Ga0334995_0028651_1541_1669 | 3300034062 | Freshwater | MVVDAVTDEIVESNFEYKHHAELFIEVHGKDYPNAELIVERS |
| Ga0334995_0281770_790_927 | 3300034062 | Freshwater | MSFMVVDAVTDEIVESNFEYKNHAELFIEMHGKDYPNAELVVESA |
| Ga0335012_0236434_843_953 | 3300034093 | Freshwater | TDEIVESNFEYKNHAELFIEVHGKDYPDAELIVEVA |
| Ga0335031_0008866_666_827 | 3300034104 | Freshwater | MNIFRENIMDYVVIDENTDEIIASNFECKNHAELFIEVHKKDYPNASLYVESL |
| ⦗Top⦘ |