NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073170

Metagenome / Metatranscriptome Family F073170

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073170
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 113 residues
Representative Sequence MSEEQVVAQKLRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAASGSENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Number of Associated Samples 107
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 10.00 %
% of genes near scaffold ends (potentially truncated) 39.17 %
% of genes from short scaffolds (< 2000 bps) 70.83 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(22.500 % of family members)
Environment Ontology (ENVO) Unclassified
(30.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.55%    β-sheet: 11.72%    Coil/Unstructured: 51.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF05717TnpB_IS66 52.50
PF13007LZ_Tnp_IS66 18.33
PF13551HTH_29 0.83
PF00436SSB 0.83
PF04041Glyco_hydro_130 0.83
PF00072Response_reg 0.83
PF00027cNMP_binding 0.83
PF00239Resolvase 0.83
PF13655RVT_N 0.83
PF08388GIIM 0.83
PF00271Helicase_C 0.83
PF13751DDE_Tnp_1_6 0.83
PF13103TonB_2 0.83
PF01610DDE_Tnp_ISL3 0.83
PF13646HEAT_2 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG3436TransposaseMobilome: prophages, transposons [X] 52.50
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 0.83
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.83
COG2152Predicted glycosyl hydrolase, GH43/DUF377 familyCarbohydrate transport and metabolism [G] 0.83
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.83
COG2965Primosomal replication protein NReplication, recombination and repair [L] 0.83
COG3464TransposaseMobilome: prophages, transposons [X] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.00 %
UnclassifiedrootN/A5.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001084|JGI12648J13191_1007643All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300001124|JGI12692J13336_1001915All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300001131|JGI12631J13338_1002289All Organisms → cellular organisms → Bacteria4332Open in IMG/M
3300001170|JGI12704J13340_1001932All Organisms → cellular organisms → Bacteria → Acidobacteria2380Open in IMG/M
3300001175|JGI12649J13570_1004562All Organisms → cellular organisms → Bacteria1885Open in IMG/M
3300001593|JGI12635J15846_10376131All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium864Open in IMG/M
3300001593|JGI12635J15846_10791158Not Available544Open in IMG/M
3300002245|JGIcombinedJ26739_100026132All Organisms → cellular organisms → Bacteria5102Open in IMG/M
3300002910|JGI25615J43890_1062410All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300004080|Ga0062385_10150509All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300004082|Ga0062384_100954124All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300005591|Ga0070761_10040879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium2601Open in IMG/M
3300005591|Ga0070761_10652816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300006162|Ga0075030_100514883All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300006893|Ga0073928_10004670All Organisms → cellular organisms → Bacteria20002Open in IMG/M
3300009519|Ga0116108_1122369All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium779Open in IMG/M
3300009520|Ga0116214_1349680All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300009552|Ga0116138_1013444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2666Open in IMG/M
3300009623|Ga0116133_1022998All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300009623|Ga0116133_1023483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1525Open in IMG/M
3300009624|Ga0116105_1054317All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium927Open in IMG/M
3300009627|Ga0116109_1172487All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300009631|Ga0116115_1203219All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300009634|Ga0116124_1086377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium894Open in IMG/M
3300009636|Ga0116112_1096829All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium834Open in IMG/M
3300009641|Ga0116120_1104691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium932Open in IMG/M
3300009646|Ga0116132_1014745All Organisms → cellular organisms → Bacteria → Acidobacteria2939Open in IMG/M
3300009762|Ga0116130_1027206All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300010866|Ga0126344_1412970All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300010876|Ga0126361_11097740Not Available644Open in IMG/M
3300012363|Ga0137390_11295603All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300014164|Ga0181532_10034774All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3452Open in IMG/M
3300014169|Ga0181531_10004356All Organisms → cellular organisms → Bacteria8521Open in IMG/M
3300014169|Ga0181531_10024524All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3468Open in IMG/M
3300014489|Ga0182018_10740907All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300014493|Ga0182016_10264956All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681068Open in IMG/M
3300014499|Ga0182012_10037455All Organisms → cellular organisms → Bacteria4055Open in IMG/M
3300014501|Ga0182024_10154915All Organisms → cellular organisms → Bacteria → Acidobacteria3212Open in IMG/M
3300014654|Ga0181525_10033002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3069Open in IMG/M
3300014655|Ga0181516_10526771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300014657|Ga0181522_10041237All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682577Open in IMG/M
3300014839|Ga0182027_10554698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681244Open in IMG/M
3300015078|Ga0167660_1006659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681225Open in IMG/M
3300015167|Ga0167661_1003512All Organisms → cellular organisms → Bacteria → Acidobacteria2750Open in IMG/M
3300017931|Ga0187877_1154746All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium919Open in IMG/M
3300017938|Ga0187854_10100737All Organisms → cellular organisms → Bacteria1355Open in IMG/M
3300017941|Ga0187850_10245736All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300017998|Ga0187870_1192475All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300018008|Ga0187888_1136314All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1015Open in IMG/M
3300018009|Ga0187884_10101944All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681250Open in IMG/M
3300018014|Ga0187860_1189452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium851Open in IMG/M
3300018023|Ga0187889_10093762All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300018034|Ga0187863_10673289All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300018043|Ga0187887_10063862All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2241Open in IMG/M
3300018047|Ga0187859_10695974All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300019887|Ga0193729_1024588All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Candidatus Magnetoglobus → Candidatus Magnetoglobus multicellularis → Candidatus Magnetoglobus multicellularis str. Araruama2585Open in IMG/M
3300019890|Ga0193728_1295569All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300020022|Ga0193733_1048676All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681197Open in IMG/M
3300020034|Ga0193753_10011612All Organisms → cellular organisms → Bacteria5564Open in IMG/M
3300020579|Ga0210407_10141924All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681847Open in IMG/M
3300020582|Ga0210395_10077127All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682454Open in IMG/M
3300021170|Ga0210400_11328096All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300021171|Ga0210405_10682290All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300021411|Ga0193709_1009401All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682442Open in IMG/M
3300022521|Ga0224541_1001279All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682485Open in IMG/M
3300022557|Ga0212123_10009615All Organisms → cellular organisms → Bacteria → Acidobacteria14025Open in IMG/M
3300022881|Ga0224545_1003967All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium2514Open in IMG/M
3300025404|Ga0208936_1001594All Organisms → cellular organisms → Bacteria → Acidobacteria2679Open in IMG/M
3300025412|Ga0208194_1008078All Organisms → cellular organisms → Bacteria1794Open in IMG/M
3300025477|Ga0208192_1096367All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300025612|Ga0208691_1014974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1884Open in IMG/M
3300026469|Ga0257169_1005015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681472Open in IMG/M
3300026551|Ga0209648_10063876All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3115Open in IMG/M
3300027370|Ga0209010_1041363All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300027535|Ga0209734_1006739All Organisms → cellular organisms → Bacteria2049Open in IMG/M
3300027559|Ga0209222_1005628All Organisms → cellular organisms → Bacteria → Acidobacteria2686Open in IMG/M
3300027567|Ga0209115_1014560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681706Open in IMG/M
3300027648|Ga0209420_1159935All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300027648|Ga0209420_1214206All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300027676|Ga0209333_1187986All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300027692|Ga0209530_1220758Not Available519Open in IMG/M
3300027698|Ga0209446_1042892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681141Open in IMG/M
3300027853|Ga0209274_10070415All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681689Open in IMG/M
3300027853|Ga0209274_10276175All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300027853|Ga0209274_10666719All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300027882|Ga0209590_10194762All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1278Open in IMG/M
3300027895|Ga0209624_11116415All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300027908|Ga0209006_10342374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681268Open in IMG/M
3300028013|Ga0265350_107678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300028731|Ga0302301_1014293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682423Open in IMG/M
3300028747|Ga0302219_10443723Not Available509Open in IMG/M
3300028759|Ga0302224_10272234All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300028775|Ga0302231_10228148All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300028776|Ga0302303_10024460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682575Open in IMG/M
3300028780|Ga0302225_10436019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300028798|Ga0302222_10442661All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300029882|Ga0311368_10189344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681641Open in IMG/M
3300029882|Ga0311368_10988363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300029916|Ga0302148_1209734All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300029943|Ga0311340_11560895Not Available514Open in IMG/M
3300029944|Ga0311352_10409247All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681109Open in IMG/M
3300029944|Ga0311352_10896488All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300029999|Ga0311339_10008818All Organisms → cellular organisms → Bacteria16046Open in IMG/M
3300030042|Ga0302300_1076282All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681035Open in IMG/M
3300030043|Ga0302306_10272555All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300030399|Ga0311353_10444561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1159Open in IMG/M
3300030509|Ga0302183_10024247All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682481Open in IMG/M
3300030520|Ga0311372_11795319All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300030524|Ga0311357_10840571All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300030618|Ga0311354_10858454All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium850Open in IMG/M
3300030618|Ga0311354_11053254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium746Open in IMG/M
3300031090|Ga0265760_10146031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium773Open in IMG/M
3300031234|Ga0302325_10313747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682530Open in IMG/M
3300031236|Ga0302324_100175888All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3459Open in IMG/M
3300031236|Ga0302324_100200316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3187Open in IMG/M
3300031236|Ga0302324_100784181All Organisms → cellular organisms → Bacteria → Acidobacteria1329Open in IMG/M
3300031236|Ga0302324_103015848All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300031837|Ga0302315_10728951Not Available518Open in IMG/M
3300032160|Ga0311301_11073538All Organisms → cellular organisms → Bacteria → Acidobacteria1052Open in IMG/M
3300033547|Ga0316212_1003883All Organisms → cellular organisms → Bacteria2167Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa22.50%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil15.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland13.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.83%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.17%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.17%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.50%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.67%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.67%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.67%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.67%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.83%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.83%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.83%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.83%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.83%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001084Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1EnvironmentalOpen in IMG/M
3300001124Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3EnvironmentalOpen in IMG/M
3300001131Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1EnvironmentalOpen in IMG/M
3300001170Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2EnvironmentalOpen in IMG/M
3300001175Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002910Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cmEnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009627Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015078Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015167Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300025404Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025477Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028013Soil microbial communities from Maridalen valley, Oslo, Norway - NSE2EnvironmentalOpen in IMG/M
3300028731Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029916Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030042Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300033547Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12648J13191_100764333300001084Forest SoilMSEEQVVPQRIRRTSAEVKQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRMQAAVDGSASRLVAVEWGSKKPSAERARSCGLSVVLSSGREITVNTGFDAATLQRLVEVLETM*
JGI12692J13336_100191533300001124Forest SoilMSEEQVVAQKVRRTAVEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLSRYLERMRGAADSGASGDGLVAVEWGGKKPSAERASSCSLSVVLRSGREIRVNTGFDAATLQRLVEVLETM*
JGI12631J13338_100228983300001131Forest SoilLCVEVSSMGEEQVVAQKVRRTAAEIKQIVSEFQSSGMNRSQFCRVRGLTFGVLNRYLERAAASRSENGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREI
JGI12704J13340_100193223300001170Forest SoilMSEEQVVPQRIRRTSAEVKQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRAAASRSENGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREIGVNTGFDAATLQRLVEVLETM*
JGI12649J13570_100456213300001175Forest SoilLCVEVSSMGEEQVVAQKVRRTAAEIKQIVSEFQSSGMNRSQFCRVRGLTFGVLNRYLERAAASRSENGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREIGVNTGFDAATLQRLVEVLETM*
JGI12635J15846_1037613113300001593Forest SoilMSEEQVVAQKLRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAGSGRENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM*
JGI12635J15846_1079115813300001593Forest SoilMGEEQVVAQKVRRTAAEIKQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRMQAAVDGSASRLVAVEWGSKKPSAERARSCGLSVVLSSGREITVNTGFDAATLQRLVEVLETM*
JGIcombinedJ26739_10002613213300002245Forest SoilMSEEQVVARKGRRRSAEIEQIVSEFQSSGVNRNEFCRGRGLTWGVLNRYLKRMQVAAPGGGIGDGLVAVEWGGKKPGAERTGSCGLSVVLRSGREIAVKAGFDSATLQRLVEVLETM*
JGI25615J43890_106241023300002910Grasslands SoilMSEEQVVAQKLRRTATEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAGSGSENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM*
Ga0062385_1015050913300004080Bog Forest SoilMSDEQVVARKGRRTAAEIEQIVSEFQSSGLNRSQFCQGRGLTFGVLNRYLKRMRAASDGGASGDGLVAVEWAGKKLGAERAGGCGLAVVLRGGREIAVSTGFDAATLRRLVEVLETM*
Ga0062384_10095412413300004082Bog Forest SoilMSEEQVVAQKVRRTAAEIEQMVSEFQSSGLNRSQFCRVRGLTFGVLNRYLERRRAAAKSSANGDGLVAVEWGGKKPSAERVSGCGLSVVLGSGREIAVKTGFDAATLQRLVEVLETM*
Ga0070761_1004087933300005591SoilMGEEQVVAQKVRRTAAEIKQIVSEFQSSGMNRSQFCRVRGLTFGVLNRYLERAAASRSENGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREIGVNTGFDAATLQRLVEVLETM*
Ga0070761_1065281623300005591SoilMSEEQVVAQKVRRTAGEIEQIASEFQSSGMSRNQFCRVRGLTFGVLNRYLERMRAAANNSANGDRLVAVEWGGKKPSAERARSCGLSVVLGSGREIAVNTGFDAATLQRLVEVLETM*
Ga0075030_10051488313300006162WatershedsMSEEQVVPGKLRRTAAEIGQIVSEFQSSGMSRSKFCRVRGLTFGVLNRYLERMRAAANSSATGDGLVAVEWGGKKASVERAGSGGLSVVLRSGREIAVNTGFDAATLRRLVEMLETM*
Ga0073928_10004670183300006893Iron-Sulfur Acid SpringMSEEQVVAQKLRRTAAEIEQIVSEFQSSGMSRSRFCRVRGLTFGVLNRYLERIRAAASGSENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM*
Ga0116108_112236913300009519PeatlandIEQIVSEFQSSGLNRSQFCQGRGLTFGVLNRYLKRMRAASDGGARGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSAGFDAATLQRLVEVLETM*
Ga0116214_134968013300009520Peatlands SoilMSEEQVVAQKVRRTAAEIGQIVSEFESSGMSRSQFCRVRGLTFGVLNRYLERMRAAADSSANSDGLVAVEWGGKKPSAERALSVVLRSGREIAVNTGFDAATLQRLVEVLETM*
Ga0116138_101344443300009552PeatlandMSNEQVVAPKGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSAGFDAATLQRLVEVLETM*
Ga0116133_102299833300009623PeatlandMINEQVVAPKGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSAGFDAATLQRLVEVLETM*
Ga0116133_102348333300009623PeatlandKGRRTAAEIEQIVSEFQSSGLNRSQFCQGRGLTFGVLNRYLKRMRAASDGGARGDGLVAVEWAGKKLGAERAGGCGLAVVLRSGREIAVSTGFDAATLQRLVEVLETM*
Ga0116105_105431723300009624PeatlandMINEQVVAPKGRRTAAEIEQIVGEYQSSGLNRSQFCRHRGLTFGVLNRYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSTGFDAATLQRLVEVLETM*
Ga0116109_117248723300009627PeatlandMSEEQVVAQKLRRTSAEIEQIVSEFQSSGISRSQFCRVRGLTFGVLNRYLERMRAAANSGATGGGLVAVEWGGKKESAERAASCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM*
Ga0116115_120321913300009631PeatlandMINEQVVAPKGRRTAAEIEQIVGEYQSSGLNRSQFCRHRGLTFGVLNRYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSAGFD
Ga0116124_108637723300009634PeatlandMSNEQVVAPKGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSTGFDAATLQRLVEVLETM*
Ga0116112_109682913300009636PeatlandTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSAGFDAATLQRLVEVLETM*
Ga0116120_110469133300009641PeatlandGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSAGFDAATLQRLVEVLETM*
Ga0116132_101474543300009646PeatlandMSNEQVVAPKGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAGEWAGKKLGAERAGGCGLAVVLKSGREVAVSAGFDAATLQRLVEVLETM*
Ga0116130_102720613300009762PeatlandIVSEFQSSGLNRSQFCRHRGLTFGVLNRYLKRMRAASDGGARGDGLVAVEWAGKKLGAERAGGCGLAVVLRSGREIAVSTGFDAATLQRLVEVLETM*
Ga0126344_141297023300010866Boreal Forest SoilEVSSMSEEQVVAQKVRRTAGEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLSRYLERMRGVADSGANGDRLVAVEWGGKKQSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLMEVLETM*
Ga0126361_1109774013300010876Boreal Forest SoilMSEEQVVSGKLRRTSAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERMRAAANSGATGGGLVAVEWAGKKPSAERVASCGLSVVLRSGREIAVNPGFDA
Ga0137390_1129560313300012363Vadose Zone SoilMSEEQVVAQKLRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAGSGSENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM*
Ga0181532_1003477423300014164BogMSDEQVVARKGRRTAAEIEQIVSEFQSSGLNRSQFCQGRGLTFGVLNRYLKRMRAASDGGARGDGLVAVEWAGKKLGAERAGGCGLAVVLRSGREIAVSTGFDAATLQRLVEVLETM*
Ga0181531_1000435633300014169BogMSEEQVVGQKVRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLMRMRGAAKSSANGDGLVAVEWGGKKPSVERANGCGLSVVLGSGREIAVNTGFDAATLLRLVEVLERL*
Ga0181531_1002452433300014169BogMSEEQVGAQKMRRTAAEIEQIVSEYKSSGLNRSQFCRSRGLTLGVLNRYLKRLRAAANGGAGGDGLVAVEWGGKKPSAKRAGSCGLSVVLRSGREIEVNAGFDAATLQRLMEVLETM*
Ga0182018_1074090713300014489PalsaMSDEQVVAQKGRRTAAEIERIVSEFQSSGLNRSQFCRVRGLTFGVLNRYLERMRGAAHSSANGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREIAVNTGFDAATLQRLVE
Ga0182016_1026495613300014493BogQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERMRAAANSGATRGGLVAVEWAGKKPSAERAASCGLSVVLRSGREIAVNPGFDAATLQRLMEVLETK*
Ga0182012_1003745533300014499BogMSEEQVVAQKLRRTSAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERMRAAANSGATRGGLVAVEWAGKKPSAERAASCGLSVVLRSGREIAVNPGFDAATLQRLMEVLETK*
Ga0182024_1015491543300014501PermafrostMSDEQVVAQKGRRTAAEIERIVSEFQSSGLNRSQFCRVRGLTFGVLNRYLERMRGAAHSSANGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM*
Ga0181525_1003300223300014654BogMSDEQVVAQKIRRTTSEIKQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRMRAAVDGNASGDRLVAVEWGSKKPSVERASGCGLSVVLRSGREITVNTGFDATTLQRLVEVLETM*
Ga0181516_1052677113300014655BogMSEEQVGAQKMRRTAAEIEQIVSEYKSSGLNRSQFCRSRGLTLGVLNRYLKRLRAAANGGAGGDGLVAVEWGGKKQSGERARGCGLSVVLRSGREIAVNTGFDAATLQRLVE
Ga0181522_1004123733300014657BogMSEEQVGAQKMRRTAAEIEQIVTEYKSSGLNRSQFCRSRGLTLGVLNRYLKRLRAAANGGAGGDGLVAVEWGGKKPSAKRAGSCGLSVVLRSGREIEVNAGFDAATLQRLMEVLETM*
Ga0182027_1055469813300014839FenVEVSSMSDEQVVAQKGRRTAAEIERIVSEFQSSGLNRSQFCRVRGLTFGVLNRYLERMRGAAHSSANGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM*
Ga0167660_100665933300015078Glacier Forefield SoilMSEEQVVSGKLRRTSAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERMGAAANRGATGGGLVAVEWAGKKPSAERAASCGLSVVLRSGREIAVNIGFDAARLQRLVEVLETK*
Ga0167661_100351213300015167Glacier Forefield SoilMSEEQVVSGKLRRTSAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERMGAAANRGATGGGLVAVEWAGKKPSAERAASCGLSVVLRSGREIAVNIGFDAATLQRLVEVLETK*
Ga0187877_115474623300017931PeatlandMSNEQVVAPKGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSAGFDAATLQRLVEVLETM
Ga0187854_1010073723300017938PeatlandMSDEQVVARKGRRTAAEIEQIVSEFQSSGLNRSQFCQGRGLTFGVLNRYLKRMRAASDGGARGDGLVAVEWAGKKLGAERAGGCGLAVVLRSGREIAVSTGFDAATLQRLVEVLETM
Ga0187850_1024573623300017941PeatlandLCVEVSSMSNEQVVAPKGRRTAAEIEQIVSEFQSSGLNRSQFCQGRGLTFGVLNRYLKRMRATSDGGARGDGLVAVEWAGKKLGAERAGGCGLAVVLRSGREIAVSTGFDAATLQRLVEVLETM
Ga0187870_119247513300017998PeatlandNEQVVAPKGRRTAAEIEQIVGEYQSSGLNRSQFCRHRGLTFGVLNRYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSAGFDAATLQRLVEVLETM
Ga0187888_113631413300018008PeatlandMSNEQVVAPKGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSTGFDAATLQRLVEVLETM
Ga0187884_1010194413300018009PeatlandMSDEQVVARKGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSAGFDAATLQRLVEVLETM
Ga0187860_118945223300018014PeatlandLCVEVSSMINEQVVAPKGRRTAAEIEQIVGEYQSSGLNRSQFCRHRGLTFGVLNRYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVS
Ga0187889_1009376233300018023PeatlandMINEQVVAPKGRRTAAEIEQIVGEYQSSGLNRSQFCRHRGLTFGVLNRYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSAGFDAATLQRLVEVLETM
Ga0187863_1067328913300018034PeatlandLCVEVSSMSNEQVVAPKGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGRE
Ga0187887_1006386213300018043PeatlandMSNEQVVAPKGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGRE
Ga0187859_1069597423300018047PeatlandLCVEVSSMSNEQVVAPKGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSAGFDAATLQRLVEVLETM
Ga0193729_102458823300019887SoilAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAGSGSENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0193728_129556913300019890SoilMSEEQVVAQKLRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAGSGSENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0193733_104867613300020022SoilMSEEQVVAQKVRRTTAEIEQIVSEFQSSGMSRSQFCRVRGVTFGVLNRYLERMRAAVKSNASGDGLVAVEWGGKKPSAERASGCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETI
Ga0193753_1001161233300020034SoilMSEEQVVAQKVRRTTVEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERMRAAVKSNANGDGLVAVEWGGKKPSAERASGCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETT
Ga0210407_1014192413300020579SoilSEEQVAQKLRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAASGSENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0210395_1007712713300020582SoilMSEEKVVAQKVRRTAAEIEQIVSEYKSSGLNRSQFCQSRGLRFGVLNRYLERMRVAAQSSATGDGLVAVEWGGKKSSVERAGSCGLSVVLRSGREIAVNPGFDAATLRRLAEVLETM
Ga0210400_1132809623300021170SoilMSEEQVVAQKLRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAASGSENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDGATLQRLVEVLETM
Ga0210405_1068229023300021171SoilMSEEQVVAQKLRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAASGRENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0193709_100940113300021411SoilMSEEQVVAQKVRRTTVEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERMRAAVKSNANGDGLVAVEWGGKKPSAERASGCGLSVVLRSGREIAINTGFDAATLQRLVEVLETT
Ga0224541_100127933300022521SoilSEEQVVAQKVRRTAGEIEQIASEFQSSGMSRNQFCRVRGLTFGVLNRYLERMRAAANNSANGDRLVAVEWGGKKPSAERARSCGLSVVLGSGREIAVNTGFDAATLQRLVEVLETM
Ga0212123_10009615143300022557Iron-Sulfur Acid SpringMSEEQVVAQKLRRTAAEIEQIVSEFQSSGMSRSRFCRVRGLTFGVLNRYLERIRAAASGSENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0224545_100396713300022881SoilMSDEQVVAQKGRRTAAEIERIVSEFQSSGLNRSQFCRVRGLTFGVLNRYLERMRGAAHSSANGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0208936_100159433300025404PeatlandMINEQVVAPKGRRTAAEIEQIVGEYQSSGLNRSQFCRHRGLTFGVLNRYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSTGFDAATLQRLVEVLETM
Ga0208194_100807813300025412PeatlandVVARKGRRTAAEIEQIVSEFQSSGLNRSQFCQGRGLTFGVLNRYLKRMRAASDGGARGDGLVAVEWAGKKLGAERAGGCGLAVVLRSGREIAVSTGFDAATLQRLVEVLETM
Ga0208192_109636723300025477PeatlandVVAPKGRRTAAEIEQIVSEFQSSGLNRSQFCRHRGLTFGVLNGYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGREVAVSTGFDAATLQRLVEVLETM
Ga0208691_101497413300025612PeatlandMSEEQVVPQRIRRTSAEVKQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRMQAAVDGSASRLVAVEWGSKKPSAERARSCGLSVVLSSGREITVNTGFDAATLQRLVEVLETM
Ga0257169_100501513300026469SoilMSEEQVVAQKLRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAASGSENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0209648_1006387623300026551Grasslands SoilMSEEQVVAQKLRRTATEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAGSGSENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0209010_104136323300027370Forest SoilMSEEQVVPQRIRRTSAEVKQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRAAASRSENGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREIGVNTGFDAATLQRLVEVLETM
Ga0209734_100673913300027535Forest SoilMSEEQVVAQKLRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERIRAAGSGRENGDGLVAVEWSGKKPSAERASSCGLSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0209222_100562823300027559Forest SoilMSEEQVVAQKVRRTAVEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLSRYLERMRGAADSGASGDGLVAVEWGGKKPSAERASSCSLSVVLRSGREIRVNTGFDAATLQRLVEVLETM
Ga0209115_101456033300027567Forest SoilMSDEQVVAQRIRRTSAEVKQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRMQAAVDGSASRLVAVEWGSKKPSAERARSCGLSVVLSSGREITVNTGFDAATLQRLVEVLETM
Ga0209420_115993523300027648Forest SoilQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRAAASRSENGDGLVAVEWGGKKPSAERARSCGLSVVLGSGREIAVNTGFDAATLQRLVEVLETM
Ga0209420_121420623300027648Forest SoilQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRMQAAVDGSASRLVAVEWGSKKPSAERARSCGLSVVLSSGREITVNTGFDAATLQRLVEVLETM
Ga0209333_118798623300027676Forest SoilMGEEQVVAQKVRRTAAEIKQIVSEFQSSGMNRSQFCRVRGLTFGVLNRYLERAAASRSENGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREIGVNTGFDAATLQRLVEVLETM
Ga0209530_122075813300027692Forest SoilMGEEQVVAQKVRRTAAEIKQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERAAASRSENGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREIGVNTGFDAATLQRLVEVLETM
Ga0209446_104289213300027698Bog Forest SoilMSDEQVVARKGRRTAAEIEQIVSEFQSSGLNRSQFCQGRGLTFGVLNRYLKRMRAASDGGASGDGLVAVEWAGKKLGAERAGGCGLAVVLRGGREIAVSTGFDAATLRRLVEVLETM
Ga0209274_1007041533300027853SoilVEVSSMGEEQVVAQKVRRTAAEIKQIVSEFQSSGMNRSQFCRVRGLTFGVLNRYLERAAASRSENGDGLVAVEWGGKKPSAERAGSCGLSVVLRSGREIGVNTGFDAATLQRLVEVLETM
Ga0209274_1027617523300027853SoilVSEFESSGMSRSQFCRVRGLTFGVLNRYLERMRAAVDGSVSGDRLVAVECGKKPSAERASGCGLSVVLRSGREITVNTGFDAATLQRLVEVLETM
Ga0209274_1066671923300027853SoilIASEFQSSGMSRNQFCRVRGLTFGVLNRYLERMRAAANNSANGDRLVAVEWGGKKPSAERARSCGLSVVLGSGREIAVNTGFDAATLQRLVEVLETM
Ga0209590_1019476213300027882Vadose Zone SoilMSDEQVVARKGRRTAAEIEQIVSEFQRSGLNRSQFCQGRGLTFGVLNRYLKRMRAASDGGASGDGLVAVEWSGKKLGAERAGGCGLAVVLRSGREIAVSTG
Ga0209624_1111641523300027895Forest SoilLYVEVSSMSEEQVVARKGRRRSAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLSRYLERMRGAADSGASGDGLVAVEWGGKKPSAERASSCSLSVVLRSGREIRVNTGFDAATLQRLLEVLETM
Ga0209006_1034237413300027908Forest SoilMSEEQGVAQKLRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLSRYLERMRGAADSGASGDGLVAVEWGGKKPSAERASSCSLSVVLRSGREIRVNTGFDAATLQRLVEVLETM
Ga0265350_10767813300028013SoilMSEEQVVAQKVRRTAVEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERMRGAADSGASGDGLVAVEWGGKKPSAERASSCSLSVVLRSGREIRVNTGFDAATLQRLVEVLETM
Ga0302301_101429313300028731PalsaMSEEQVVAQKVRRTAGEIEQIASEFQSSGMSRNQFCRVRGLTFGVLNRYLERMRAAANNSANGDRLVAVEWGGKKPSAERARSCGLSVVLGSGREIAVNTGFDAATLQRLVEVLETM
Ga0302219_1044372313300028747PalsaMSDEQVVAQKIRRTTSEIKQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRMRAAVDGNASGDRLVAVEWGSKKPSVERASGCGLSVVLRSGREITVNTGFDATTLQRLVEVLETM
Ga0302224_1027223423300028759PalsaMIEEQVVAQKVRRTAAEIRQIVSEFESSGVSRNRFCRERGLTFGVLNRYLKRMHAAVDGSASGNRLVAVEWGGKKPSAERFRSCGLSVVVSSGREITVNTGFDAATLQRLVEVLETM
Ga0302231_1022814823300028775PalsaAEIRQIVSEFESSGVSRNRFCRERGLTFGVLNRYLKRMHAAVDGSASGNRLVAVEWGGKKPSAERFRSCGLSVVVSSGREITVNTGFDAATLQRLVEVLETM
Ga0302303_1002446033300028776PalsaRQNFCVEVSSMSEEQVVAQKVRRTAGEIEQIASEFQSSGMSRNQFCRVRGLTFGVLNRYLERMRAAANNSANGDRLVAVEWGGKKPSAERARSCGLSVVLGAGERLR
Ga0302225_1043601923300028780PalsaMIEEQVVAQKVRRTAAEIRQIVSEFESSGMSRNRFCRVRGLTFGVLNRYLQRMRAAADHTANSDGLVAVEWGGKKPSAERALSVVLRSGRE
Ga0302222_1044266113300028798PalsaTAAEIRQIVSEFESSGMSRNRFCRERGLTFGVLNRYLKRMHAAVDGSASGNRLVAVEWGGKKPSAERFRSCGLSVVVSSGREITVNTGFDAATLQRLVEVLETM
Ga0311368_1018934413300029882PalsaVVAQKIRRTTSEIKQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRMRAAVDGNASGDRLVAVEWGSKKPSVERASGCGLSVVLRSGREITVNTGFDATTLQRLVEVLETM
Ga0311368_1098836323300029882PalsaMSEEQVVAQKVRRTAAEIEQIASEFQSSGMSRSQFCRVRGLSFGVLNRYLERMRAAANRSSNGDGLVAVEWGGKKPSAERASSCSLSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0302148_120973413300029916BogLCVEVSSMINEQVVAPKGRRTAAEIEQIVGEYQSSGLNRSQFCRHRGLTFGVLNRYLKRMRAASDGGATGDGLVAVEWAGKKLGAERAGSCGLAVVLKSGR
Ga0311340_1156089513300029943PalsaMSEEQVVGQKVRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLMRMRGAAKSSANGDGLVAVEWGGKKPSVERANGCGLSVVLGSGREIAVNTGF
Ga0311352_1040924733300029944PalsaDFCVEVSSMSEEQVVGQKVRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLMRMRGAAKSSANGDGLVAVEWGGKKPSVERANGCGLSVVLGSGREIAVNTGFDAATLLRLVEVLERL
Ga0311352_1089648813300029944PalsaMIEEQVVAQKVRRTAAEIRQIVSEFESSGMSRNRFCRVRGLTFGVLNRYLQRMRAAADHTANSDGLVAVEWGGKKPSAERALSVVLRSGREIAVNTGFDAATLQPRDVLYHAHLT
Ga0311339_1000881863300029999PalsaMSEEQVVGQKVRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLMRMRGAAKSSANGDGLVAVEWGGKKPSVERANGCGLSVVLGSGREIAVNTGFDAATLLRLVEVLERL
Ga0302300_107628233300030042PalsaVAQKVRRTAAEIRQIVSEFESSGVSRNRFCRERGLTFGVLNRYLKRMHAAVDGSASGNRLVAVEWGGKKPSAERFRSCGLSVVVSSGREITVNTGFDAATLQRLVEVLETM
Ga0302306_1027255513300030043PalsaKVRRTAAEIRQIVSEFESSGVSRNRFCRERGLTFGVLNRYLKRMHAAVDGSASGNRLVAVEWGGKKPSAERFRSCGLSVVVSSGREITVNTGFDAATLQRLVEVLETM
Ga0311353_1044456123300030399PalsaMSEEQVVGQKVRRTAAEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLMRMRGAAKSSANGDGLVAVEWGGKKPSVERANGCGLSVVLGSGREIAVNTGFDA
Ga0302183_1002424733300030509PalsaVSEFQSSGMSRNQFCRVRGLTFGVLNRYLERMRAAANNSANGDRLVAVEWGGKKPSAERARSCGLSVVLGSGREIAVNTGFDAATLQRLVEVLETM
Ga0311372_1179531923300030520PalsaSMIEEQVVAQKVRRTAAEIRQIVSEFESSGVSRNRFCRERGLTFGVLNRYLKRMHAAVDGSASGNRLVAVEWGGKKPSAERFRSCGLSVVVSSGREITVNTGFDAATLQRLVEVLETM
Ga0311357_1084057123300030524PalsaNFCGEVSSMSDEQVVAQKIRRTTSEIKQIVSEFQSSGMSRSQFCRMRGLTFGVLNRYLKRMRAAVDGNASGDRLVAVEWGSKKPSVERASGCGLSVVLRSGREITVNTGFDATTLQRLVEVLETM
Ga0311354_1085845423300030618PalsaMIEEQVVAQKVRRTAAEIRQIVSEFESSGMSRNRFCRVRGLTFGVLNRYLQRMRAAADHTANSDGLVAVEWGGKKPSAERALSVVLRSGREIAVNTGFDAATLQP
Ga0311354_1105325423300030618PalsaMIEEQVVAQKVRRTAAEIKQIAGEFESSGMSRSQFCRVRGLTFGVLSRYLERMRAAADRSANSDGLVAVEWAGKKPSTERALSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0265760_1014603123300031090SoilIVSEYESSGLTRSQFCRGRGLTLGILNRYLRRLRVTAEGGTNGDGLVAVELAGKKLGAEGTASWGLAVVLRSGRKIAVSPGFDAATLQRVVQVLETM
Ga0302325_1031374713300031234PalsaMSEEQVGAQKMRRTAAEIEQIVSEYKSSGLNRSQFCRSRGLTLGVLNRYLKRLRAAANGGAGGDGLVAVEWGGKKPSAKRAGSCGLSVVLRSGREIEVNAGFDAATLQRLMEVLETM
Ga0302324_10017588833300031236PalsaLCVEVSSMSEEQVGAQKMRRTAAEIEQIVSEYKSSGLNRSQFCRSRGLTLGVLNRYLKRLRAAANGGAGGDGLVAVEWGGKKPSAKRAGSCGLSVVLRSGREIEVNAGFDAATLQRLMEVLETM
Ga0302324_10020031613300031236PalsaMSEEQVVAQKVRRTAAEIEQIASEFQSSGMSRSQFCRVRGLSFGVLNRYLERMRAAANRSSNGDGLVAVEWGGKKPSAERASSCSLSVVLRSGREIAVNTGFDAATLQRLVEVL
Ga0302324_10078418113300031236PalsaMIEEQVVAQKVRRTAAEIKQIAGEFESSGMSRSQFCRVRGLTFGVMSRYLERMRAAADRSANSDGLVAVEWAGKKPSTERALSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0302324_10301584823300031236PalsaFCVEVSSMIEEQVVAQKVRRTAAEIRQIVSEFESSGVSRNRFCRERGLTFGVLNRYLKRMHAAVDGSASGNRLVAVEWGGKKPSAERFRSCGLSVVVSSGREITVNTGFDAATLQRLVEVLETM
Ga0302315_1072895113300031837PalsaPRQKFCVEVSSMIEEQVVAQKVRRTAAEIRQIVSEFESSGVSRNRFCRERGLTFGVLNRYLKRMHAAVDGSASGNRLVAVEWGGKKPSAERFRSCGLSVVVSSGREITVNTGFDAATLQRLVEVLETM
Ga0311301_1107353833300032160Peatlands SoilMSEEQVVAQKVRRTAAEIGQIVSEFESSGMSRSQFCRVRGLTFGVLNRYLERMRAAADSSANSDGLVAVEWGGKKPSAEHALSVVLRSGREIAVNTGFDAATLQRLVEVLETM
Ga0316212_100388333300033547RootsMSEEQVVAQKVRRTAVEIEQIVSEFQSSGMSRSQFCRVRGLTFGVLNRYLERMRGAADSGASDDGLVAVEWGGKKPSAERASSCSLSVVLRSGREIRVNTGFDAATLQRLVEVLETM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.