| Basic Information | |
|---|---|
| Family ID | F073133 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MLASGKMVGFIPTKDYDKARAFYEGKLGFEFVSLDQF |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.83 % |
| % of genes near scaffold ends (potentially truncated) | 97.50 % |
| % of genes from short scaffolds (< 2000 bps) | 89.17 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.92% β-sheet: 0.00% Coil/Unstructured: 83.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02311 | AraC_binding | 25.00 |
| PF12833 | HTH_18 | 11.67 |
| PF00174 | Oxidored_molyb | 5.83 |
| PF00903 | Glyoxalase | 3.33 |
| PF01833 | TIG | 1.67 |
| PF08338 | DUF1731 | 1.67 |
| PF05973 | Gp49 | 1.67 |
| PF01061 | ABC2_membrane | 0.83 |
| PF13495 | Phage_int_SAM_4 | 0.83 |
| PF12543 | DUF3738 | 0.83 |
| PF01261 | AP_endonuc_2 | 0.83 |
| PF08002 | DUF1697 | 0.83 |
| PF01053 | Cys_Met_Meta_PP | 0.83 |
| PF00753 | Lactamase_B | 0.83 |
| PF12704 | MacB_PCD | 0.83 |
| PF02687 | FtsX | 0.83 |
| PF13365 | Trypsin_2 | 0.83 |
| PF01740 | STAS | 0.83 |
| PF13360 | PQQ_2 | 0.83 |
| PF04191 | PEMT | 0.83 |
| PF01435 | Peptidase_M48 | 0.83 |
| PF13570 | PQQ_3 | 0.83 |
| PF07228 | SpoIIE | 0.83 |
| PF04055 | Radical_SAM | 0.83 |
| PF13847 | Methyltransf_31 | 0.83 |
| PF00196 | GerE | 0.83 |
| PF04255 | DUF433 | 0.83 |
| PF00106 | adh_short | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 5.83 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 5.83 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 1.67 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 1.67 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 1.67 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.83 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.83 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.83 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.83 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.83 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.83 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.83 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.83 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.83 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.83 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.50 % |
| Unclassified | root | N/A | 7.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100325107 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300004092|Ga0062389_104401310 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300004635|Ga0062388_100144547 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300005176|Ga0066679_10816631 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005363|Ga0008090_15426605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300005548|Ga0070665_101539786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 673 | Open in IMG/M |
| 3300005586|Ga0066691_10939788 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005602|Ga0070762_10268101 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300005921|Ga0070766_11265287 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300007255|Ga0099791_10543214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300009038|Ga0099829_10993627 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300009088|Ga0099830_10130367 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
| 3300009088|Ga0099830_11769185 | Not Available | 516 | Open in IMG/M |
| 3300009089|Ga0099828_10028200 | All Organisms → cellular organisms → Bacteria | 4489 | Open in IMG/M |
| 3300009089|Ga0099828_11041243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300009520|Ga0116214_1017710 | All Organisms → cellular organisms → Bacteria | 2533 | Open in IMG/M |
| 3300010325|Ga0134064_10117459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300010343|Ga0074044_10471174 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300010359|Ga0126376_12907002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 529 | Open in IMG/M |
| 3300010360|Ga0126372_10022437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3758 | Open in IMG/M |
| 3300010360|Ga0126372_12032943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300010376|Ga0126381_103113569 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300011269|Ga0137392_11078003 | Not Available | 659 | Open in IMG/M |
| 3300012189|Ga0137388_11032495 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300012202|Ga0137363_10901064 | Not Available | 751 | Open in IMG/M |
| 3300012923|Ga0137359_10621100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300012944|Ga0137410_10187014 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300012944|Ga0137410_10464854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| 3300012948|Ga0126375_10601581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300012971|Ga0126369_12481006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300014156|Ga0181518_10396631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300014654|Ga0181525_10386104 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300015051|Ga0137414_1116217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300015053|Ga0137405_1322547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1528 | Open in IMG/M |
| 3300016270|Ga0182036_10045779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2717 | Open in IMG/M |
| 3300016270|Ga0182036_11370511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300016294|Ga0182041_11700522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300016387|Ga0182040_10011716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4545 | Open in IMG/M |
| 3300017927|Ga0187824_10060744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
| 3300017993|Ga0187823_10381243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300017994|Ga0187822_10048524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1188 | Open in IMG/M |
| 3300018007|Ga0187805_10391156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300018012|Ga0187810_10161107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300020580|Ga0210403_10645139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300020581|Ga0210399_10314057 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300020581|Ga0210399_10758254 | Not Available | 795 | Open in IMG/M |
| 3300020581|Ga0210399_10834784 | Not Available | 751 | Open in IMG/M |
| 3300020583|Ga0210401_11007023 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300020583|Ga0210401_11556031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300021170|Ga0210400_11001106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300021178|Ga0210408_11492248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300021181|Ga0210388_11659315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300021404|Ga0210389_10448215 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300021404|Ga0210389_11279592 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300021405|Ga0210387_10598760 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300021406|Ga0210386_11572362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300021407|Ga0210383_10771650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300021420|Ga0210394_10452770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
| 3300021420|Ga0210394_10983944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300021432|Ga0210384_10016158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7330 | Open in IMG/M |
| 3300021477|Ga0210398_10277497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1366 | Open in IMG/M |
| 3300021559|Ga0210409_10853166 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300021559|Ga0210409_11096092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300023255|Ga0224547_1036231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300025922|Ga0207646_11574929 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300026317|Ga0209154_1056452 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300026320|Ga0209131_1304896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300026333|Ga0209158_1291948 | Not Available | 560 | Open in IMG/M |
| 3300027497|Ga0208199_1004739 | All Organisms → cellular organisms → Bacteria | 3554 | Open in IMG/M |
| 3300027583|Ga0209527_1154010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300027671|Ga0209588_1231681 | Not Available | 568 | Open in IMG/M |
| 3300027862|Ga0209701_10045941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2814 | Open in IMG/M |
| 3300027875|Ga0209283_10417751 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300027875|Ga0209283_10423534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300027884|Ga0209275_10199316 | Not Available | 1082 | Open in IMG/M |
| 3300027884|Ga0209275_10749948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300028379|Ga0268266_11812184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 585 | Open in IMG/M |
| 3300028745|Ga0302267_10475016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300028765|Ga0302198_10038272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3082 | Open in IMG/M |
| 3300028775|Ga0302231_10239102 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300028788|Ga0302189_10080467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1519 | Open in IMG/M |
| 3300028789|Ga0302232_10524962 | All Organisms → cellular organisms → Bacteria → FCB group | 582 | Open in IMG/M |
| 3300028906|Ga0308309_11277220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300029883|Ga0311327_10062419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2885 | Open in IMG/M |
| 3300029910|Ga0311369_10384987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
| 3300029914|Ga0311359_10603791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 808 | Open in IMG/M |
| 3300029919|Ga0302141_1124127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300029943|Ga0311340_10759001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300029952|Ga0311346_10156915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2678 | Open in IMG/M |
| 3300030007|Ga0311338_11691831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300030043|Ga0302306_10125437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300030044|Ga0302281_10011350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 5522 | Open in IMG/M |
| 3300030399|Ga0311353_11015801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300030399|Ga0311353_11323333 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300030509|Ga0302183_10186663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300030519|Ga0302193_10033700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3505 | Open in IMG/M |
| 3300030519|Ga0302193_10329891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300030617|Ga0311356_10618661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300030693|Ga0302313_10189104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300030737|Ga0302310_10571364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 600 | Open in IMG/M |
| 3300031236|Ga0302324_102801084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300031258|Ga0302318_10207660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300031261|Ga0302140_10421711 | Not Available | 1066 | Open in IMG/M |
| 3300031525|Ga0302326_10603644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1631 | Open in IMG/M |
| 3300031561|Ga0318528_10780191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300031668|Ga0318542_10255173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300031708|Ga0310686_114606079 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300031718|Ga0307474_10385166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300031771|Ga0318546_10338401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300031771|Ga0318546_11017976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300031788|Ga0302319_11515450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300031796|Ga0318576_10637425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300031946|Ga0310910_10475040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300032059|Ga0318533_10852255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300032076|Ga0306924_11091995 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300032091|Ga0318577_10535317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300032094|Ga0318540_10313083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300032160|Ga0311301_12202786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300032783|Ga0335079_10248383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1958 | Open in IMG/M |
| 3300033290|Ga0318519_10734605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.67% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.83% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1003251073 | 3300002245 | Forest Soil | MGNSGGGMLTSGKLVGFLITTDYEKARAFYEGKLGFEFVSLDQFALA |
| Ga0062389_1044013101 | 3300004092 | Bog Forest Soil | MLTAGKMVGFLVTTDYEKARTFYEGKLGFEFVSLDQFALA |
| Ga0062388_1001445475 | 3300004635 | Bog Forest Soil | VLASIEMIGFLLTKDYEQARTFYEGNLGFEFVSLDQFALVM |
| Ga0066679_108166311 | 3300005176 | Soil | MLASGKMVGFVPTTDYDQARAFYEGKLEFDFVSLDQYALVVSVG |
| Ga0008090_154266052 | 3300005363 | Tropical Rainforest Soil | MLASGKMVGFVPTRDYDKARAFYQDQLGFEFVSLDQYALVMSVGGHKV |
| Ga0070665_1015397862 | 3300005548 | Switchgrass Rhizosphere | MLASCRMMGFVVTTDYDKARAFYEGGLGFEFVSVDE |
| Ga0066691_109397883 | 3300005586 | Soil | MLSGNMVGFVLTKDYAKARAFFEGKLGFQFVSQDQFALA |
| Ga0070762_102681013 | 3300005602 | Soil | MLAAMNMVGFLLTKDYDKSRAFYEGNLGFEFVSLDQFALVM |
| Ga0070766_112652872 | 3300005921 | Soil | MLASMKMAGFLLTKDYEKARAFYEGNLGFEFVSLDQFALVMQAGKSM |
| Ga0099791_105432141 | 3300007255 | Vadose Zone Soil | MLADSKIVGFIFTRDYDNARAFYEGKLGFQFVSQDQFALAVRT |
| Ga0099829_109936272 | 3300009038 | Vadose Zone Soil | MLTTGKMIGFVLTKDYDKAREFYEQKLGFEFVSHDQHALVVR |
| Ga0099830_101303671 | 3300009088 | Vadose Zone Soil | MLASGKVVGFLLTKDYDKARAFFEGALGFQFVSVDQYALVMNAGGTM |
| Ga0099830_117691852 | 3300009088 | Vadose Zone Soil | MLSGSMIGFVLTKDYAKARAFFEGKLGFQFVSQDQFALAM |
| Ga0099828_100282001 | 3300009089 | Vadose Zone Soil | MLAAGEMIGFVHTTDYDKARDFYEGKLGFEFVSLDKFALVMSVGGHMIRI |
| Ga0099828_110412431 | 3300009089 | Vadose Zone Soil | MLASGKVVGSLLTKDYDKARAFFEGALGFQFVSVDQYAMVMNAG |
| Ga0116214_10177101 | 3300009520 | Peatlands Soil | MLASGKLTGFIPTKDYDKARTFYVDKLGFEFVSLDQFALVLSLGGHKF |
| Ga0134064_101174591 | 3300010325 | Grasslands Soil | MMLASGKMVGFVPTTDYDQARAFYEGKLEFDFVSLDQYALV |
| Ga0074044_104711741 | 3300010343 | Bog Forest Soil | MIGFLLTKDYEQARTFYEGNLGFEFVSLDQFALVMQAGKSM |
| Ga0126376_129070021 | 3300010359 | Tropical Forest Soil | MLDSGKMVGFVPTTDYDKAREFYEGKLQFKFVSLDQY |
| Ga0126372_100224371 | 3300010360 | Tropical Forest Soil | MLASGKMVGFVPTRDYEKARAFYQDQLGFEFVSLDQYALVM |
| Ga0126372_120329432 | 3300010360 | Tropical Forest Soil | MLDSGKLAGFLATTDYDRAREFYEGKLGFKFLSLDQY |
| Ga0126381_1031135691 | 3300010376 | Tropical Forest Soil | MLASGRLSGFLATTDYDKAREFYEGKLGFEFVSLD |
| Ga0137392_110780033 | 3300011269 | Vadose Zone Soil | MLSGSMIGFVLTKDYARARAFFEGMLGFQFVSQDQFALAMKAGGNM |
| Ga0137388_110324951 | 3300012189 | Vadose Zone Soil | MLAFGKIVGFLLTKDYDKARAFFEGALGFQFVSVDQYAMVMNAG |
| Ga0137363_109010641 | 3300012202 | Vadose Zone Soil | MPDKSKMVGFVPTTDYEAAREFYVGKLGFTFVSLDQFA |
| Ga0137359_106211002 | 3300012923 | Vadose Zone Soil | MLASAKMVGFIPTKDYDKARAFYEGKLGFKFVSLDNLPWS* |
| Ga0137410_101870143 | 3300012944 | Vadose Zone Soil | MLAAGKMVGFIPTKDYDKARAFYEGKLGFEFVSLD |
| Ga0137410_104648542 | 3300012944 | Vadose Zone Soil | MLASGKMVGFIPTKDYDKARAFYEGKLGFEFVSLDQF |
| Ga0126375_106015813 | 3300012948 | Tropical Forest Soil | GKMLASGKMVGFIPTRDYDKARAFYQNLLGFEFVS* |
| Ga0126369_124810061 | 3300012971 | Tropical Forest Soil | MLGSGKMVAFIPTTDYGKARAFYERQLEFEFVSLDQYALVMRIG |
| Ga0181518_103966311 | 3300014156 | Bog | MLDSAKMVGFIPTKDYDKARAFFEGKLGFEFVRLDQFALVVSVGGHKIR |
| Ga0181525_103861042 | 3300014654 | Bog | MLISGKLVGFLMTTDYDKARAFFENKLGFKFVSLDQFALVMRSGENQI |
| Ga0137414_11162171 | 3300015051 | Vadose Zone Soil | MLASAKMVGFIPTTDYDKARSFYEGKLGFEFVSLDK |
| Ga0137405_13225472 | 3300015053 | Vadose Zone Soil | MLASGKMVGFIPTKDYDKARAFYEGNLGLEFVSLDKLPWS* |
| Ga0182036_100457794 | 3300016270 | Soil | MLESGKLAGFLATTDYDKAREFYEGKLGFEFVSLALYALVM |
| Ga0182036_113705112 | 3300016270 | Soil | MVGFVITTDYEKARAFYEGKLGFKFVSLDQFALVM |
| Ga0182041_117005222 | 3300016294 | Soil | MLESGKLAGFLATTDYDKARKFYEGKLGFEFISLDHYALVMRVGGHS |
| Ga0182040_100117168 | 3300016387 | Soil | MLASAKMVGFVPTSDYDNARAFYEKKLGFEFVSLDQ |
| Ga0187824_100607441 | 3300017927 | Freshwater Sediment | MLAAGKLTGFIPTRDYDKARAFYVDKLGFEFVSLD |
| Ga0187823_103812431 | 3300017993 | Freshwater Sediment | MLAAGKLTGFIPTRDYEKARAFYVDKLGFEFVSLDQFA |
| Ga0187822_100485243 | 3300017994 | Freshwater Sediment | MLTTGKLVGFLLTKEYERARGFYEGKLGFEFVSLDQFALVMRAGE |
| Ga0187805_103911562 | 3300018007 | Freshwater Sediment | MLSFGNMVGFLLTRDYDKARDFFEGKLGFQFVSVDQFALVM |
| Ga0187810_101611071 | 3300018012 | Freshwater Sediment | MLSFGNMVGFLLTRDYDKARYFFEGKLGFQVVSVDQFALV |
| Ga0210403_106451391 | 3300020580 | Soil | MLASGKMTGFVLTKDYDKSRAFYEGKLGFKFVSLDQFALVMN |
| Ga0210399_103140571 | 3300020581 | Soil | MLASTNMMGFLLTKDYEKARAFYQGNLGFEFLSLD |
| Ga0210399_107582542 | 3300020581 | Soil | MLASMDMIGFLLTKDYEKARSFYEGNLGFEFVSLDQFALVMQAGKSMIRIVKD |
| Ga0210399_108347841 | 3300020581 | Soil | MLADMKMMGFLLTKDYDKARAFYEGNLGFEFVSLDKFALVMRA |
| Ga0210401_110070231 | 3300020583 | Soil | MLAAAKMVGFLLTKDYDRARAFFEGQLGFQFVSLDQFALVMSVGGHNIR |
| Ga0210401_115560311 | 3300020583 | Soil | MLASSKMAGFVLTKDYDKARAFYEGKMGFEFVSLDQFAL |
| Ga0210400_110011061 | 3300021170 | Soil | MLASAKLVGFIPTKDYDKARAFYEGKLGFEFVSLDQF |
| Ga0210408_114922481 | 3300021178 | Soil | MLTSGRIVGFVLTKDYEKARAFFEGKLGFAFVSLDQFALVMKAGEHMIRISKV |
| Ga0210388_116593151 | 3300021181 | Soil | MLDSGKMVGFVPTTDYEKARDFYLGKLGFEFISLDQFALAVKV |
| Ga0210389_104482151 | 3300021404 | Soil | MLASMEMIGFLLTKDYEKSRAFYEGKLGFEFVSLDQFA |
| Ga0210389_112795921 | 3300021404 | Soil | MLASMDMVGFLLTRDYDKARAFYEGKLGFEFVSLDQF |
| Ga0210387_105987601 | 3300021405 | Soil | MLASMSMIGFLLTKDYEKARAFYEGTLGFEFVSLDQF |
| Ga0210386_115723622 | 3300021406 | Soil | MLDKSKMVGFVPTKDYEAAREFYVGKLGFAFVSLDQFALV |
| Ga0210383_107716502 | 3300021407 | Soil | MLASAKMVGFIPTTDYHKARAFYEGQLGFTFVSLDQF |
| Ga0210394_104527702 | 3300021420 | Soil | MLASMEMVGFLLTKDYEKARGFYEGNLGFDFVSLDQFALVMQAGKNTIRIVKVPDFTPL |
| Ga0210394_109839442 | 3300021420 | Soil | MLASGKMVGFVLTKDYEKARAFYEGKLRFEFVSLDQFA |
| Ga0210384_100161583 | 3300021432 | Soil | MLASGKMVGFVLTKDYEQARAFYEGKLGFEFVSLDQFALAMKVGGHS |
| Ga0210398_102774971 | 3300021477 | Soil | MLASGKMVGFVLTKDYDQARAFYEGKLGFEFVSQDQFA |
| Ga0210409_108531662 | 3300021559 | Soil | MLASMNMMGFVLTKDYDKARVFYESNLGFEFVSLDKFALVMKAGKSMIRIVKVP |
| Ga0210409_110960921 | 3300021559 | Soil | MLAAAKMVGFLLTKDYDRARAFFEGQLGFQFVSLDQFALVMSVGGHNIRIVKVPN |
| Ga0224547_10362312 | 3300023255 | Soil | MLASAKMVGFVPTKDYDKARAFYEGKLGCDFVSLDQFAL |
| Ga0207646_115749292 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSAGKLVGFVLTKDYEQARAFYEGKLGFEFVSLD |
| Ga0209154_10564521 | 3300026317 | Soil | MLASGKMVGFIPTKDYDKARAFYEGKLGFEFVSLDKFA |
| Ga0209131_13048962 | 3300026320 | Grasslands Soil | MLASGKMVGFIPTKDYDKARAFYGGKLGLEFVSLDKFA |
| Ga0209158_12919481 | 3300026333 | Soil | MLSGNMVGFVLTKDYAKARAFFEGKLGFQFVSQDQFALAMK |
| Ga0208199_10047391 | 3300027497 | Peatlands Soil | MLASGKLTGFIPTKDYDKARTFYVDKLGFEFVSLDQFALVLSLG |
| Ga0209527_11540102 | 3300027583 | Forest Soil | MLGSANMVGFIPTKDYDKARSFYEGKLGFEFESLDKFA |
| Ga0209588_12316811 | 3300027671 | Vadose Zone Soil | MLSGNMVGFVLTKDYAKARAFFEGKLGFQFVSQDQFALAMKAG |
| Ga0209701_100459411 | 3300027862 | Vadose Zone Soil | MLASGKVVGFLLTKDYDKARTFFEGALGFQFVSVDQYAMVMN |
| Ga0209283_104177513 | 3300027875 | Vadose Zone Soil | MLSGNMVGFVLTKDYAKARAFFEGKLGFQFVSQDQFALAMKAGGNM |
| Ga0209283_104235341 | 3300027875 | Vadose Zone Soil | MLASGKMVGFIPTKDYDKARAFYEGKLGLEFVSLDK |
| Ga0209275_101993162 | 3300027884 | Soil | MLAAMNMVGFLLTKDYDKSRAFYEGNLGFEFVSLDQFA |
| Ga0209275_107499481 | 3300027884 | Soil | MLTSGKMVGFVATTDYGKARDFYEGKLGFEFISLD |
| Ga0268266_118121842 | 3300028379 | Switchgrass Rhizosphere | MLASCRMMGFVVTTDYDKARAFYEGELGFEFVSVDEFAMVV |
| Ga0302267_104750161 | 3300028745 | Bog | MLASGKLVGFVPTTDYEKARAFYEGKLEFEFISLDQFALVVKV |
| Ga0302198_100382725 | 3300028765 | Bog | MLTASKLVGFITATDYEKARAFYEGKLGFEFVSLDQFAL |
| Ga0302231_102391022 | 3300028775 | Palsa | MLASAKMVGFVHTTDYEQARAFYEGKLGMEFIDLNPFALVM |
| Ga0302189_100804673 | 3300028788 | Bog | MLTASKLVGFITATDYEKARAFYEGKLGFEFVSLDQ |
| Ga0302232_105249622 | 3300028789 | Palsa | MLASAKMVGFVHTTDYEQARAFYEGKVGMEFIDLNP |
| Ga0308309_112772201 | 3300028906 | Soil | MLASMNMVGFLLTKDYDKARAFYEGKLGFKFVSLDQFALV |
| Ga0311327_100624194 | 3300029883 | Bog | MLTASKLVGFITATDYEKARAFYEGKLGFEFVSLDQFALALRAG |
| Ga0311369_103849872 | 3300029910 | Palsa | MLTAGKLVGFLTTTDYEKARAFYEGKLGFEFLSLD |
| Ga0311359_106037911 | 3300029914 | Bog | MLTASKLVGFITATDYEKARAFYEGKLGFEFVSLDQFALA |
| Ga0302141_11241272 | 3300029919 | Bog | LTANKLIGFLTTTDYEKARAFYEGKLGFEFVSLDQ |
| Ga0311340_107590012 | 3300029943 | Palsa | MLTAGKLVGFLTTTDYEKARAFYEGKLGFEFLSLDQFALALR |
| Ga0311346_101569151 | 3300029952 | Bog | MLTASKLVGFITATDYEKARAFYEGKLGFEFVSLDQFALALR |
| Ga0311338_116918312 | 3300030007 | Palsa | MLTAGKLVGFLTTTDYQKARDFYEGKLGFDFVSLDAF |
| Ga0302306_101254372 | 3300030043 | Palsa | MLSSAKLAGFIITNDYDAARSFYVDRLGFEFVSLDQYA |
| Ga0302281_100113506 | 3300030044 | Fen | MLTASKLVGFITATDYEKARAFYEGKLGFEFVSLD |
| Ga0311353_110158012 | 3300030399 | Palsa | MLAASKLVGFLTTTDYDKARAFYEGKLGFAFVSLDQ |
| Ga0311353_113233331 | 3300030399 | Palsa | MVTSGKMVGFLTTTDYEKARAFYVGKLGFAFLSLDQFAL |
| Ga0302183_101866631 | 3300030509 | Palsa | MLSSAKLAGFIITNDYDAARSFYVDRLGFEFVSLDQYALVV |
| Ga0302193_100337005 | 3300030519 | Bog | MLTANKLIGFLTTTDYEKARAFYEGKLGFEFVSLDQFA |
| Ga0302193_103298912 | 3300030519 | Bog | MFYPGKLVGFLTTTDYDKARAFYEGKLGFEFISLDQFAL |
| Ga0311356_106186611 | 3300030617 | Palsa | MFHPGKLVGFLSTTDYEKARAFYEGKLGFEFVSLD |
| Ga0302313_101891042 | 3300030693 | Palsa | MLDAGKMVGFVPTSDYDRSRAFYEGKLGCEFVSLDPYAL |
| Ga0302310_105713641 | 3300030737 | Palsa | MLTANKLVGFITTTDYEKARAFYEGKLGFEFLKLDQF |
| Ga0302324_1028010841 | 3300031236 | Palsa | MLASGKLTGFVPTADYDKARAFYEGKLGFEFVSLD |
| Ga0302318_102076601 | 3300031258 | Bog | MLTANRLIGFLTTTDYEKARAFFEGKLGFEFVSLDQFALAVR |
| Ga0302140_104217111 | 3300031261 | Bog | MLTAGRMVGFLTTTDYEKARAFYEGKLGFEFISLDQFALA |
| Ga0302326_106036443 | 3300031525 | Palsa | MLTVNELVGFLTTTDYEKARAFYGGKLGFEFVSLDQFALAMRAGKNMIRI |
| Ga0318528_107801911 | 3300031561 | Soil | VLASAKLVGFVPTKDYEQARAFYEGKLGFDFVSLDQ |
| Ga0318542_102551733 | 3300031668 | Soil | MLASGKMVGFVPTRDYDKARAFFQDQLGFEFVGLDQYALLM |
| Ga0310686_1146060792 | 3300031708 | Soil | MLTVNELVGFLTTTDYEKARAFYGGKLGFEFVSLDQFALAMRAG |
| Ga0307474_103851661 | 3300031718 | Hardwood Forest Soil | MLSSCNLVGFLVTKDYDKARAFFETKLGFQFISLDQYALA |
| Ga0318546_103384012 | 3300031771 | Soil | MLASGKMVGFVPTRDYEKARAFYQDQLGFEFVSLDQY |
| Ga0318546_110179761 | 3300031771 | Soil | MLESGKMAGFLATSDYDKAREFYEGKLGFAFVSLDQYALVMEVG |
| Ga0302319_115154501 | 3300031788 | Bog | MLISGKLVGFLMTTDYDKARTFFESKLGFEFVSLDQFA |
| Ga0318576_106374251 | 3300031796 | Soil | MLASGKMVGFVPTRDYDKARAFFQDQLGFEFVGLD |
| Ga0310910_104750401 | 3300031946 | Soil | MLESGKMAGFLATSDYDKAREFYEGKLGFAFVSLDQYALVMEVGGHSIRISKIPDF |
| Ga0318533_108522552 | 3300032059 | Soil | MVGFVITTDYEKARAFYEGKLGFKFVSLDQFALVMK |
| Ga0306924_110919953 | 3300032076 | Soil | MLESGKLAGFLATTDYDKARKFYEGKLGFEFISLDH |
| Ga0318577_105353172 | 3300032091 | Soil | MLASGKMVGFVPTRDYEKARAFYQDQLGFEFVSLDQ |
| Ga0318540_103130831 | 3300032094 | Soil | MLAKSKLVGFVPTKDYEAARGFYEGKLGFAFASQDQFALVVRA |
| Ga0311301_122027861 | 3300032160 | Peatlands Soil | MLESGKMAGFVLTKDYEQARAFYEGKLGFEFVSLDEFALAMRV |
| Ga0335079_102483831 | 3300032783 | Soil | MLAAAKLMGFVLTKDYEKARAFYEGKVGMTFVSLDQF |
| Ga0318519_107346052 | 3300033290 | Soil | MLGSGKMVAFIPTTDYEKARAFYERHLGFEFVSLD |
| ⦗Top⦘ |