Metagenome Family F073074

Select file to download:
Download

Basic Information
Family ID	F073074
Family Type	Metagenome
Number of Sequences	120
Average Sequence Length	124 residues
Representative Sequence	MDIITKTAKDAARLLNAIRAQYIIVLPTGEQIIQGDLKLHVPDAKPAKKVRAQSRHPHGFLNQHILPYLKDMKIGDVAVIPVPSGADMDEIQGSSASIAAKLWGNGNYKTMRNYNTGNLEVLRMA
Number of Associated Samples	74
Number of Associated Scaffolds	120

Basic Information

Family ID

F073074

Family Type

Metagenome

Number of Sequences

120

Average Sequence Length

124 residues

Representative Sequence

MDIITKTAKDAARLLNAIRAQYIIVLPTGEQIIQGDLKLHVPDAKPAKKVRAQSRHPHGFLNQHILPYLKDMKIGDVAVIPVPSGADMDEIQGSSASIAAKLWGNGNYKTMRNYNTGNLEVLRMA

Number of Associated Samples

Number of Associated Scaffolds

120

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	85.83 %
% of genes near scaffold ends (potentially truncated)	30.83 %
% of genes from short scaffolds (< 2000 bps)	75.00 %
Associated GOLD sequencing projects	70
AlphaFold2 3D model prediction	No

Quality Assessment

Transcriptomic Evidence

Most common taxonomic group

Unclassified

% of genes with valid RBS motifs

85.83 %

% of genes near scaffold ends (potentially truncated)

30.83 %

% of genes from short scaffolds (< 2000 bps)

75.00 %

Associated GOLD sequencing projects

AlphaFold2 3D model prediction

Hidden Markov Model

Powered by Skylign

Most Common Taxonomy
Group	Unclassified (43.333 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Taxonomy

Group

Unclassified (43.333 % of family members)

NCBI Taxonomy ID

N/A

Taxonomy

N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (49.167 % of family members)
Environment Ontology (ENVO)	Unclassified (84.167 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (84.167 % of family members)

Most Common Ecosystem

GOLD Ecosystem

Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(49.167 % of family members)

Environment Ontology (ENVO)

Unclassified
(84.167 % of family members)

Earth Microbiome Project Ontology (EMPO)

Free-living → Non-saline → Water (non-saline)
(84.167 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 36.80% β-sheet: 13.60% Coil/Unstructured: 49.60%
Feature Viewer

Powered by Feature Viewer

Predicted Topology & Secondary Structure

Classification:

Globular

Signal Peptide:

Secondary Structure distribution:

α-helix: 36.80% β-sheet: 13.60% Coil/Unstructured: 49.60%

Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF13203	DUF2201_N	3.33
PF11348	DUF3150	1.67
PF03237	Terminase_6N	1.67
PF12728	HTH_17	1.67
PF01612	DNA_pol_A_exo1	0.83
PF11753	DUF3310	0.83
PF00271	Helicase_C	0.83

Pfam ID

Name

% Frequency in 120 Family Scaffolds

PF13203

DUF2201_N

3.33

PF11348

DUF3150

1.67

PF03237

Terminase_6N

1.67

PF12728

HTH_17

1.67

PF01612

DNA_pol_A_exo1

0.83

PF11753

DUF3310

0.83

PF00271

Helicase_C

0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	56.67 %
Unclassified	root	N/A	43.33 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	54.17 %
Unclassified	root	N/A	43.33 %
cellular organisms	root	All Organisms → cellular organisms	2.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.33 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	27.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.67 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	2.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.33 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	27.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.67 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.33 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	27.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.67 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.33 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	27.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.67 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.33 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	27.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.67 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.33 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	27.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.67 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.33 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	27.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.67 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.33 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	27.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.67 %
unclassified Flavobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.33 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	27.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.67 %
Flavobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002408\|B570J29032_109376696	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	722	Open in IMG/M
3300003490\|JGI25926J51410_1033764	Not Available	939	Open in IMG/M
3300003490\|JGI25926J51410_1037739	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	874	Open in IMG/M
3300003493\|JGI25923J51411_1090237	Not Available	517	Open in IMG/M
3300005527\|Ga0068876_10092398	All Organisms → Viruses → Predicted Viral	1809	Open in IMG/M
3300005528\|Ga0068872_10435609	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	710	Open in IMG/M
3300005528\|Ga0068872_10773504	Not Available	501	Open in IMG/M
3300005581\|Ga0049081_10075387	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	1267	Open in IMG/M
3300005581\|Ga0049081_10199695	Not Available	717	Open in IMG/M
3300005581\|Ga0049081_10280019	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	578	Open in IMG/M
3300005581\|Ga0049081_10332072	Not Available	518	Open in IMG/M
3300005582\|Ga0049080_10009366	All Organisms → Viruses → Predicted Viral	3396	Open in IMG/M
3300005584\|Ga0049082_10104264	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	993	Open in IMG/M
3300005805\|Ga0079957_1000495	Not Available	35471	Open in IMG/M
3300007973\|Ga0105746_1104165	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	933	Open in IMG/M
3300008110\|Ga0114343_1227612	Not Available	516	Open in IMG/M
3300008113\|Ga0114346_1296497	Not Available	560	Open in IMG/M
3300008266\|Ga0114363_1026507	All Organisms → Viruses → Predicted Viral	2489	Open in IMG/M
3300008267\|Ga0114364_1158830	Not Available	610	Open in IMG/M
3300008448\|Ga0114876_1188250	Not Available	710	Open in IMG/M
3300008448\|Ga0114876_1242025	Not Available	568	Open in IMG/M
3300009068\|Ga0114973_10027529	All Organisms → Viruses → Predicted Viral	3465	Open in IMG/M
3300009161\|Ga0114966_10045356	All Organisms → Viruses → Predicted Viral	3147	Open in IMG/M
3300009161\|Ga0114966_10350993	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	877	Open in IMG/M
3300009183\|Ga0114974_10349921	Not Available	857	Open in IMG/M
3300010885\|Ga0133913_13293704	All Organisms → Viruses → Predicted Viral	1063	Open in IMG/M
3300011114\|Ga0151515_10629	Not Available	14917	Open in IMG/M
3300011334\|Ga0153697_1020	Not Available	55290	Open in IMG/M
3300013004\|Ga0164293_10031574	All Organisms → Viruses → Predicted Viral	4390	Open in IMG/M
3300013005\|Ga0164292_10040447	All Organisms → Viruses → Predicted Viral	3719	Open in IMG/M
3300013372\|Ga0177922_10474636	Not Available	590	Open in IMG/M
3300013372\|Ga0177922_10653079	All Organisms → Viruses → Predicted Viral	2062	Open in IMG/M
3300013372\|Ga0177922_10766091	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	722	Open in IMG/M
3300015050\|Ga0181338_1004991	All Organisms → Viruses → Predicted Viral	2251	Open in IMG/M
3300015050\|Ga0181338_1033129	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	782	Open in IMG/M
3300015050\|Ga0181338_1053236	Not Available	588	Open in IMG/M
3300015050\|Ga0181338_1055655	Not Available	573	Open in IMG/M
3300015050\|Ga0181338_1057911	Not Available	560	Open in IMG/M
3300017701\|Ga0181364_1079147	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	500	Open in IMG/M
3300017701\|Ga0181364_1079249	Not Available	500	Open in IMG/M
3300017716\|Ga0181350_1032398	All Organisms → Viruses → Predicted Viral	1436	Open in IMG/M
3300017716\|Ga0181350_1151893	Not Available	540	Open in IMG/M
3300017716\|Ga0181350_1152552	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	538	Open in IMG/M
3300017716\|Ga0181350_1168592	Not Available	504	Open in IMG/M
3300017722\|Ga0181347_1082638	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	934	Open in IMG/M
3300017722\|Ga0181347_1155465	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	622	Open in IMG/M
3300017722\|Ga0181347_1206442	Not Available	515	Open in IMG/M
3300017723\|Ga0181362_1121961	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	510	Open in IMG/M
3300017723\|Ga0181362_1123953	Not Available	505	Open in IMG/M
3300017736\|Ga0181365_1007626	All Organisms → Viruses → Predicted Viral	2677	Open in IMG/M
3300017736\|Ga0181365_1100029	Not Available	702	Open in IMG/M
3300017747\|Ga0181352_1075999	Not Available	944	Open in IMG/M
3300017754\|Ga0181344_1068307	All Organisms → Viruses → Predicted Viral	1049	Open in IMG/M
3300017754\|Ga0181344_1090638	All Organisms → cellular organisms → Bacteria → Proteobacteria	893	Open in IMG/M
3300017754\|Ga0181344_1152785	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	658	Open in IMG/M
3300017754\|Ga0181344_1174328	Not Available	609	Open in IMG/M
3300017754\|Ga0181344_1228581	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	518	Open in IMG/M
3300017761\|Ga0181356_1169251	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	666	Open in IMG/M
3300017766\|Ga0181343_1029422	All Organisms → Viruses → Predicted Viral	1663	Open in IMG/M
3300017766\|Ga0181343_1107133	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	791	Open in IMG/M
3300017777\|Ga0181357_1245656	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	623	Open in IMG/M
3300017777\|Ga0181357_1338321	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	503	Open in IMG/M
3300017778\|Ga0181349_1151109	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	834	Open in IMG/M
3300017778\|Ga0181349_1210004	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	668	Open in IMG/M
3300017780\|Ga0181346_1163162	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	826	Open in IMG/M
3300017780\|Ga0181346_1336960	Not Available	503	Open in IMG/M
3300017784\|Ga0181348_1249379	Not Available	615	Open in IMG/M
3300017784\|Ga0181348_1259315	Not Available	598	Open in IMG/M
3300019784\|Ga0181359_1000201	Not Available	12540	Open in IMG/M
3300019784\|Ga0181359_1008056	All Organisms → Viruses → Predicted Viral	3622	Open in IMG/M
3300019784\|Ga0181359_1061385	All Organisms → Viruses → Predicted Viral	1438	Open in IMG/M
3300019784\|Ga0181359_1085362	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1177	Open in IMG/M
3300019784\|Ga0181359_1107453	All Organisms → Viruses → Predicted Viral	1015	Open in IMG/M
3300019784\|Ga0181359_1149513	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	802	Open in IMG/M
3300019784\|Ga0181359_1157565	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	772	Open in IMG/M
3300019784\|Ga0181359_1180599	Not Available	697	Open in IMG/M
3300019784\|Ga0181359_1238408	Not Available	560	Open in IMG/M
3300020159\|Ga0211734_10595953	Not Available	766	Open in IMG/M
3300020172\|Ga0211729_11328967	Not Available	670	Open in IMG/M
3300020506\|Ga0208091_1000187	Not Available	13860	Open in IMG/M
3300020530\|Ga0208235_1001020	Not Available	5449	Open in IMG/M
3300020536\|Ga0207939_1007092	All Organisms → Viruses → Predicted Viral	1914	Open in IMG/M
3300020553\|Ga0208855_1030285	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	756	Open in IMG/M
3300020571\|Ga0208723_1025934	Not Available	885	Open in IMG/M
3300022179\|Ga0181353_1014986	All Organisms → Viruses → Predicted Viral	2001	Open in IMG/M
3300022190\|Ga0181354_1127501	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	813	Open in IMG/M
3300022190\|Ga0181354_1130104	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	802	Open in IMG/M
3300022190\|Ga0181354_1137847	Not Available	772	Open in IMG/M
3300022190\|Ga0181354_1177164	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	650	Open in IMG/M
3300023184\|Ga0214919_10003602	Not Available	23255	Open in IMG/M
3300023184\|Ga0214919_10701065	Not Available	573	Open in IMG/M
3300027563\|Ga0209552_1000243	Not Available	17453	Open in IMG/M
3300027581\|Ga0209651_1006782	All Organisms → Viruses → Predicted Viral	3831	Open in IMG/M
3300027608\|Ga0208974_1001721	Not Available	8513	Open in IMG/M
3300027656\|Ga0209357_1010309	All Organisms → Viruses → Predicted Viral	3482	Open in IMG/M
3300027659\|Ga0208975_1009480	All Organisms → Viruses → Predicted Viral	3395	Open in IMG/M
3300027659\|Ga0208975_1182866	Not Available	569	Open in IMG/M
3300027754\|Ga0209596_1085505	All Organisms → Viruses → Predicted Viral	1525	Open in IMG/M
3300027785\|Ga0209246_10027831	All Organisms → Viruses → Predicted Viral	2141	Open in IMG/M
3300027971\|Ga0209401_1035453	All Organisms → Viruses → Predicted Viral	2379	Open in IMG/M
(restricted) 3300027977\|Ga0247834_1042357	All Organisms → Viruses → Predicted Viral	2593	Open in IMG/M
3300028394\|Ga0304730_1333335	Not Available	510	Open in IMG/M
3300031758\|Ga0315907_10083169	All Organisms → Viruses → Predicted Viral	2759	Open in IMG/M
3300031787\|Ga0315900_10947207	Not Available	572	Open in IMG/M
3300031963\|Ga0315901_10517452	Not Available	925	Open in IMG/M
3300032050\|Ga0315906_10204922	All Organisms → Viruses → Predicted Viral	1851	Open in IMG/M
3300032050\|Ga0315906_10611752	Not Available	894	Open in IMG/M
3300032092\|Ga0315905_10474031	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	1159	Open in IMG/M
3300032093\|Ga0315902_10230235	All Organisms → Viruses → Predicted Viral	1825	Open in IMG/M
3300032093\|Ga0315902_10618732	Not Available	904	Open in IMG/M
3300032116\|Ga0315903_11217511	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	506	Open in IMG/M
3300033995\|Ga0335003_0438708	Not Available	551	Open in IMG/M
3300034018\|Ga0334985_0005431	Not Available	10312	Open in IMG/M
3300034019\|Ga0334998_0698162	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	541	Open in IMG/M
3300034062\|Ga0334995_0279026	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1107	Open in IMG/M
3300034062\|Ga0334995_0791479	Not Available	520	Open in IMG/M
3300034101\|Ga0335027_0126077	All Organisms → Viruses → Predicted Viral	1914	Open in IMG/M
3300034104\|Ga0335031_0761521	Not Available	547	Open in IMG/M
3300034279\|Ga0335052_0055385	All Organisms → Viruses → Predicted Viral	2444	Open in IMG/M
3300034356\|Ga0335048_0074546	All Organisms → Viruses → Predicted Viral	2106	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat

Taxonomy

Distribution

Environmental

100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat

Taxonomy

Distribution

Aquatic

Environmental → Aquatic

100.00%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	99.17%
Marine	Environmental → Aquatic → Marine	0.83%

Habitat

Taxonomy

Distribution

Freshwater

Environmental → Aquatic → Freshwater

99.17%

Marine

Environmental → Aquatic → Marine

0.83%

Habitat	Taxonomy	Distribution
Lentic	Environmental → Aquatic → Freshwater → Lentic	61.67%
Lake	Environmental → Aquatic → Freshwater → Lake	29.17%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	7.50%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.83%
Coastal	Environmental → Aquatic → Marine → Coastal	0.83%

Habitat

Taxonomy

Distribution

Lentic

Environmental → Aquatic → Freshwater → Lentic

61.67%

Lake

Environmental → Aquatic → Freshwater → Lake

29.17%

Unclassified

Environmental → Aquatic → Freshwater → Unclassified

7.50%

Lotic

Environmental → Aquatic → Freshwater → Lotic

0.83%

Coastal

Environmental → Aquatic → Marine → Coastal

0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	59.17%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	29.17%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	7.50%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.50%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	0.83%

Habitat

Taxonomy

Distribution

Unclassified

Environmental → Aquatic → Freshwater → Lentic → Unclassified

59.17%

Unclassified

Environmental → Aquatic → Freshwater → Lake → Unclassified

29.17%

Unclassified

Environmental → Aquatic → Freshwater → Unclassified → Unclassified

7.50%

Epilimnion

Environmental → Aquatic → Freshwater → Lentic → Epilimnion

2.50%

Unclassified

Environmental → Aquatic → Freshwater → Lotic → Unclassified

0.83%

Unclassified

Environmental → Aquatic → Marine → Coastal → Unclassified

0.83%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	49.17%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	11.67%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	7.50%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	7.50%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	6.67%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	5.00%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	3.33%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.50%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	2.50%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.67%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.83%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.83%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.83%

Habitat

Taxonomy

Distribution

Freshwater Lake

Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake

49.17%

Freshwater

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater

11.67%

Freshwater Lentic

Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic

7.50%

Freshwater

Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater

7.50%

Freshwater Lake

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake

6.67%

Freshwater

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater

5.00%

Freshwater, Plankton

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton

3.33%

Freshwater

Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater

2.50%

Freshwater

Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater

2.50%

Freshwater Lake

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake

1.67%

Lake

Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake

0.83%

Freshwater

Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater

0.83%

Estuary Water

Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water

0.83%

Visualization

Powered by ApexCharts

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300003490	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN	Environmental	Open in IMG/M
3300003493	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300007973	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011114	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb	Environmental	Open in IMG/M
3300011334	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017701	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020506	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020530	Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020536	Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020553	Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020571	Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300027563	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027581	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027656	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027971	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027977 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m	Environmental	Open in IMG/M
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032093	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300033995	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056	Environmental	Open in IMG/M
3300034018	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021	Environmental	Open in IMG/M
3300034019	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034279	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163	Environmental	Open in IMG/M
3300034356	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152	Environmental	Open in IMG/M

Taxon OID

Sample Name

Habitat Type

IMG/M Link

3300002408

Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)

Environmental

Geographical Distribution

Zoom:	Powered by OpenStreetMap