NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072982

Metagenome / Metatranscriptome Family F072982

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072982
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 55 residues
Representative Sequence MSFSPAGNQQSNLPQSTVKYYDKKFRENLKAQTPFVACAERLDLPMKSGNQYE
Number of Associated Samples 100
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.44 %
% of genes near scaffold ends (potentially truncated) 59.17 %
% of genes from short scaffolds (< 2000 bps) 80.83 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.167 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(22.500 % of family members)
Environment Ontology (ENVO) Unclassified
(65.833 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(41.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.22%    β-sheet: 0.00%    Coil/Unstructured: 77.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF13673Acetyltransf_10 3.33
PF00583Acetyltransf_1 2.50
PF02945Endonuclease_7 2.50
PF00782DSPc 1.67
PF00961LAGLIDADG_1 1.67
PF03237Terminase_6N 0.83
PF00476DNA_pol_A 0.83
PF13365Trypsin_2 0.83
PF13508Acetyltransf_7 0.83
PF11999Ice_binding 0.83
PF00300His_Phos_1 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.33 %
UnclassifiedrootN/A1.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001131|JGI12631J13338_1006368All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1981Open in IMG/M
3300003293|Ga0006843J48913_108926All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium863Open in IMG/M
3300004080|Ga0062385_10429751All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon797Open in IMG/M
3300004100|Ga0058904_1136285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M
3300004473|Ga0068919_1378367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium791Open in IMG/M
3300004473|Ga0068919_1393055All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium638Open in IMG/M
3300004476|Ga0068966_1174837All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium524Open in IMG/M
3300004558|Ga0068979_1066473All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium626Open in IMG/M
3300004601|Ga0068934_1000804All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1611Open in IMG/M
3300004609|Ga0068958_1178420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium688Open in IMG/M
3300004611|Ga0068925_1370024All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium597Open in IMG/M
3300004614|Ga0068956_1307760All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium647Open in IMG/M
3300004631|Ga0058899_11835418All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium774Open in IMG/M
3300004799|Ga0058863_11915448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium663Open in IMG/M
3300004969|Ga0072327_1034462All Organisms → Viruses → Predicted Viral1025Open in IMG/M
3300004969|Ga0072327_1173343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium564Open in IMG/M
3300004973|Ga0072322_1301410All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium964Open in IMG/M
3300005541|Ga0070733_10809086All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium629Open in IMG/M
3300009518|Ga0116128_1010988All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3244Open in IMG/M
3300009518|Ga0116128_1029130All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1839Open in IMG/M
3300009545|Ga0105237_10659819All Organisms → Viruses → Predicted Viral1053Open in IMG/M
3300009548|Ga0116107_1053528All Organisms → Viruses → Predicted Viral1359Open in IMG/M
3300009548|Ga0116107_1057528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1293Open in IMG/M
3300009548|Ga0116107_1059394All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1263Open in IMG/M
3300009548|Ga0116107_1160313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium614Open in IMG/M
3300009616|Ga0116111_1035548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1555Open in IMG/M
3300009618|Ga0116127_1014837All Organisms → Viruses → Predicted Viral2650Open in IMG/M
3300009618|Ga0116127_1040374All Organisms → Viruses → Predicted Viral1383Open in IMG/M
3300009618|Ga0116127_1041400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1361Open in IMG/M
3300009621|Ga0116116_1071744All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium992Open in IMG/M
3300009636|Ga0116112_1006099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5583Open in IMG/M
3300009636|Ga0116112_1068515All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1023Open in IMG/M
3300009636|Ga0116112_1077502All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium949Open in IMG/M
3300009636|Ga0116112_1081185All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium924Open in IMG/M
3300009637|Ga0116118_1190094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium648Open in IMG/M
3300009640|Ga0116126_1237873All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium574Open in IMG/M
3300009646|Ga0116132_1020401All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2366Open in IMG/M
3300009646|Ga0116132_1175228All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium652Open in IMG/M
3300009697|Ga0116231_10253788All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium982Open in IMG/M
3300010143|Ga0126322_1036238All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300011025|Ga0138561_110713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium537Open in IMG/M
3300011028|Ga0138577_129546All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium622Open in IMG/M
3300011031|Ga0138543_103734All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium825Open in IMG/M
3300011056|Ga0138538_1091189All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium776Open in IMG/M
3300011072|Ga0138563_1013734All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1321Open in IMG/M
3300011072|Ga0138563_1043545All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium672Open in IMG/M
3300011077|Ga0138572_1107367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium728Open in IMG/M
3300011088|Ga0138576_1106335All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium502Open in IMG/M
3300011305|Ga0138532_1097905All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium722Open in IMG/M
3300012350|Ga0137372_10381352All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas → unclassified Halomonas → Halomonas sp. IOP_311072Open in IMG/M
3300012354|Ga0137366_10000676All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium23381Open in IMG/M
3300014151|Ga0181539_1004641All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium11636Open in IMG/M
3300014495|Ga0182015_10277356All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas → unclassified Halomonas → Halomonas sp. IOP_311101Open in IMG/M
3300014501|Ga0182024_12302026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium586Open in IMG/M
3300016702|Ga0181511_1259684All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4911Open in IMG/M
3300016750|Ga0181505_10110463All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium555Open in IMG/M
3300017925|Ga0187856_1025274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2929Open in IMG/M
3300017929|Ga0187849_1099551All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1236Open in IMG/M
3300017931|Ga0187877_1255345All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium676Open in IMG/M
3300017935|Ga0187848_10000967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium25210Open in IMG/M
3300017937|Ga0187809_10065777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1183Open in IMG/M
3300017938|Ga0187854_10320991All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium659Open in IMG/M
3300017938|Ga0187854_10491775All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium509Open in IMG/M
3300017940|Ga0187853_10488333All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium538Open in IMG/M
3300018002|Ga0187868_1003412All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium9910Open in IMG/M
3300018002|Ga0187868_1078642All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1323Open in IMG/M
3300018004|Ga0187865_1050355All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1675Open in IMG/M
3300018005|Ga0187878_1098214All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1201Open in IMG/M
3300018009|Ga0187884_10005884All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium8411Open in IMG/M
3300018012|Ga0187810_10482740All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium528Open in IMG/M
3300018013|Ga0187873_1003194All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium11954Open in IMG/M
3300018013|Ga0187873_1087926All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1249Open in IMG/M
3300018015|Ga0187866_1025155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2973Open in IMG/M
3300018015|Ga0187866_1031036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2590Open in IMG/M
3300018016|Ga0187880_1093532All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1494Open in IMG/M
3300018019|Ga0187874_10090880All Organisms → Viruses → Predicted Viral1341Open in IMG/M
3300018020|Ga0187861_10336252All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium641Open in IMG/M
3300018023|Ga0187889_10039872All Organisms → Viruses → Predicted Viral2588Open in IMG/M
3300018023|Ga0187889_10148909All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1111Open in IMG/M
3300018025|Ga0187885_10254772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium801Open in IMG/M
3300018057|Ga0187858_10081905All Organisms → Viruses → Predicted Viral2230Open in IMG/M
3300019230|Ga0181501_1206287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium777Open in IMG/M
3300019230|Ga0181501_1336062All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1054Open in IMG/M
3300019786|Ga0182025_1385096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1539Open in IMG/M
3300020077|Ga0206351_10974411All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium626Open in IMG/M
3300020081|Ga0206354_10657241All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium563Open in IMG/M
3300021405|Ga0210387_11022248All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium723Open in IMG/M
3300021420|Ga0210394_10009541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium9767Open in IMG/M
3300021477|Ga0210398_11275714All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium578Open in IMG/M
3300022507|Ga0222729_1026334All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium716Open in IMG/M
3300022523|Ga0242663_1072740All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium645Open in IMG/M
3300022531|Ga0242660_1240174All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium513Open in IMG/M
3300023068|Ga0224554_1058844All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium972Open in IMG/M
3300024179|Ga0247695_1064198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300025442|Ga0208034_1024425All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1573Open in IMG/M
3300025454|Ga0208039_1049625All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium777Open in IMG/M
3300025460|Ga0208562_1001666All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium8016Open in IMG/M
3300025627|Ga0208220_1094746All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium809Open in IMG/M
3300027692|Ga0209530_1000513All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium26827Open in IMG/M
3300028558|Ga0265326_10006184All Organisms → Viruses → Predicted Viral3735Open in IMG/M
3300028558|Ga0265326_10111505All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium777Open in IMG/M
3300028653|Ga0265323_10078408All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1119Open in IMG/M
3300028800|Ga0265338_10008879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium12116Open in IMG/M
3300028859|Ga0302265_1032027All Organisms → Viruses → Predicted Viral1906Open in IMG/M
3300029951|Ga0311371_12142977All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium586Open in IMG/M
3300030602|Ga0210254_10851893All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium603Open in IMG/M
3300030741|Ga0265459_13218900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium571Open in IMG/M
3300030805|Ga0265756_104618All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium784Open in IMG/M
3300030879|Ga0265765_1002142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1889Open in IMG/M
3300031041|Ga0265755_111973All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium558Open in IMG/M
3300031446|Ga0170820_11484316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium509Open in IMG/M
3300031708|Ga0310686_117948258All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium506Open in IMG/M
3300031759|Ga0316219_1259214All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium606Open in IMG/M
3300031870|Ga0316029_106036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium635Open in IMG/M
3300032562|Ga0316226_1131737All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1120Open in IMG/M
3300032665|Ga0316221_1185304All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium701Open in IMG/M
3300033402|Ga0326728_10291632All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1500Open in IMG/M
3300034091|Ga0326724_0446193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium675Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland22.50%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland18.33%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil17.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.17%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.17%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.33%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater2.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.67%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.67%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.67%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.83%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.83%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.83%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.83%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.83%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.83%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.83%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.83%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001131Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1EnvironmentalOpen in IMG/M
3300003293Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004100Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004473Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004476Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004558Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 76 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004601Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004609Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004611Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004614Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004969Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004973Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009697Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300010143Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011025Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 46 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011028Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 64 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011031Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 24 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011056Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 16 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011072Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011077Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011088Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011305Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019230Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028653Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaGHost-AssociatedOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028859Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030805Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031041Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031759Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003PEnvironmentalOpen in IMG/M
3300031870Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300032665Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12631J13338_100636833300001131Forest SoilMAFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPVNSGNQYL*
Ga0006843J48913_10892623300003293Peatlands SoilMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEMFMYD
Ga0062385_1042975113300004080Bog Forest SoilMAGYSPSSNNQSNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPAKSGNQYI*
Ga0058904_113628513300004100Forest SoilMAGFNPASNSTSNLPQSRVIYYDKRFIENLKAQTPFVRCAERRELPLNSGNQLEL
Ga0068919_137836723300004473Peatlands SoilMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEII*
Ga0068919_139305523300004473Peatlands SoilMAGYTPAQNTQSNLPQSTVKYYDKKFRENLKAQTPFLACSERLDLPMKSGNQYQMFMYVPLAANV
Ga0068966_117483723300004476Peatlands SoilMSFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPVNSGNQYE
Ga0068979_106647313300004558Peatlands SoilMSFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACAERLELPMNSGNQYEMFM
Ga0068934_100080423300004601Peatlands SoilMTGYSPAINNQSNLPQSTVKYIVDFSKQRTLQLDKLAGGSSSKLYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEITG*
Ga0068958_117842023300004609Peatlands SoilMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYEMFM
Ga0068925_137002413300004611Peatlands SoilMTGYSPAINNQSNLPHSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEITG*
Ga0068956_130776023300004614Peatlands SoilMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYEMFMYV
Ga0058899_1183541823300004631Forest SoilMAGYNPASNTTSNLPQSRVIYYDKRFIENLKAQTPFVRCAERRELPLNSGNQLE
Ga0058863_1191544823300004799Host-AssociatedMSYTPAGNLQSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPKNSGNQYI*
Ga0072327_103446223300004969Peatlands SoilMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEIDIIVS
Ga0072327_117334313300004969Peatlands SoilMSFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACAERLELPMNSGNQYEMFMYLPL
Ga0072322_130141013300004973Peatlands SoilMPGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEMFMY
Ga0070733_1080908613300005541Surface SoilMAAVNVQNNLPQSTVKFYDKKFRDNLKQQTPFVAIAERLDLPKNSGNQYQMFMYVPLAAN
Ga0116128_101098843300009518PeatlandMSFSPAGNQQSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYI*
Ga0116128_102913023300009518PeatlandMSFSPAGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLPMKSGNQYEII*
Ga0105237_1065981933300009545Corn RhizosphereMAGYSPSSNSQSNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEMFMYV
Ga0116107_105352823300009548PeatlandMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPPKSGNQYKAKAFAAAA*
Ga0116107_105752823300009548PeatlandMSFSPAGNQQSNLPQSTVKYYDKKFRENLKAQTPFVACAERLDLPMKSGNQYEIF*
Ga0116107_105939423300009548PeatlandMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLPMKSGNQYEIF*
Ga0116107_116031323300009548PeatlandMSFSPAGNQQSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYEIF*
Ga0116111_103554833300009616PeatlandMSFSPSGNQLSNLPQSTLKYYDKRFRENLKAQTPFVRCAERLDLPMKSGNQYEIF*
Ga0116127_101483743300009618PeatlandMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYEI
Ga0116127_104037433300009618PeatlandVPMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPPKSGNQYKAKAFAAAA*
Ga0116127_104140023300009618PeatlandMAFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPMNSGNQYI*
Ga0116116_107174413300009621PeatlandPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPMNSGNQYI*
Ga0116112_100609953300009636PeatlandMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYEIL*
Ga0116112_106851523300009636PeatlandMAGSYTPAGNVQANLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQY*
Ga0116112_107750233300009636PeatlandGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCSQRLDLPKNSGNQYI*
Ga0116112_108118523300009636PeatlandMAFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPMNSGNQYEMFMYVPM
Ga0116118_119009413300009637PeatlandNQQANLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPVNSGNQYI*
Ga0116126_123787323300009640PeatlandSPAGNQQANLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPVNSGNQYEIL*
Ga0116132_102040153300009646PeatlandMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLPMKSGNQYL*
Ga0116132_117522813300009646PeatlandMSFSPAGNQQANLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPVNSGNQYI*
Ga0116231_1025378823300009697Host-AssociatedMAYTPAVNVQSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPPKSGNQYEMNTLLLAA*
Ga0126322_103623813300010143SoilMPGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQ
Ga0138561_11071313300011025Peatlands SoilMAFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPM
Ga0138577_12954613300011028Peatlands SoilMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEIT
Ga0138543_10373423300011031Peatlands SoilMPGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEIDIIVS
Ga0138538_109118923300011056Peatlands SoilMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGN
Ga0138563_101373433300011072Peatlands SoilINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEITG*
Ga0138563_104354513300011072Peatlands SoilMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYEMFMYVPLAANTTA
Ga0138572_110736723300011077Peatlands SoilMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKS
Ga0138576_110633523300011088Peatlands SoilMSLEASTFQANLPQAQVTYYDRKFRENLKQQTVFVACSERLDLPLNSGNKIELFMYETYGTD
Ga0150983_1139578223300011120Forest SoilMAGFNPASNSTSNLPQSRVIYYDKRFIENLKAQTPFVRCAERRELPLNSGNQLELF
Ga0138532_109790513300011305Peatlands SoilMPGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEITG*
Ga0137372_1038135213300012350Vadose Zone SoilLMSFSPSGNQLSNLPQSTVKYYDKRFRENLKANTPFVRCAERLDLPMKSGNQYEIL*
Ga0137366_10000676183300012354Vadose Zone SoilMSFSPSGNQLSNLPQSTVKYYDKRFRENLKANTPFVRCAERLDLPMKSGNQYEIL*
Ga0181539_100464183300014151BogMSFSPAGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLPMKSGNQYL*
Ga0182015_1027735613300014495PalsaNQLSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYEIL*
Ga0182024_1230202613300014501PermafrostMSFSPAGNGQSNLPQSTVKFYDSKFRENLKAQTPFVACSERLNLPMK
Ga0181511_125968413300016702PeatlandMAFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPMNSGNQYE
Ga0181505_1011046323300016750PeatlandMAGFNPAANNTGNLPQSTVKYYDKKFRENLKAQTPFVACAERLDLPMKSGNQYQMFM
Ga0187856_102527423300017925PeatlandMSFSPAGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLPMKSGNQYEII
Ga0187849_109955123300017929PeatlandMSFSPAGNQQSNLPQSTVKYYDKKFRENLKAQTPFVACAERLDLPMKSGNQYEIF
Ga0187877_125534523300017931PeatlandAGNQQSNLPQSTVKYYDKKFRENLKAQTPFVACAERLDLPMKSGNQYEIF
Ga0187848_10000967233300017935PeatlandMSFSPAGNQQSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYI
Ga0187809_1006577713300017937Freshwater SedimentMAYSPASNVQSNLPQSTIKYYDKKFRENLKTQTPFVACAERLDLPMKS
Ga0187854_1032099123300017938PeatlandMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYEIL
Ga0187854_1049177513300017938PeatlandMANNMTGYSPAINGQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPPKSGNQYKAKAFAAAA
Ga0187853_1048833323300017940PeatlandMSFSPAGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLPMKSG
Ga0187868_100341213300018002PeatlandMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLPMKSGNQYEIF
Ga0187868_107864223300018002PeatlandMSFSPAGNQQANLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPVNSGNQYF
Ga0187865_105035533300018004PeatlandMSFSPAGNQQANLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPVNSGNQYEIL
Ga0187878_109821423300018005PeatlandMSFSPAGNQQANLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPVNSGNQYI
Ga0187884_10005884153300018009PeatlandMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLPMKSGNQYL
Ga0187810_1048274013300018012Freshwater SedimentKYPMAGYSPSSNNQSNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPRNAGNQYI
Ga0187873_1003194103300018013PeatlandMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPPKSGNQYKAKAFAAAA
Ga0187873_108792613300018013PeatlandMSFSPAGNQQSNLPQSTVKYYDKKFRENLKAQTPFVACAERLDLPMKSGNQYE
Ga0187866_102515543300018015PeatlandMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCSQRLDL
Ga0187866_103103613300018015PeatlandMSFSPAGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLP
Ga0187880_109353223300018016PeatlandMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLPMKSGNQYEII
Ga0187874_1009088013300018019PeatlandGNQLSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYEIL
Ga0187861_1033625213300018020PeatlandMSFSPAGNQQSNLPQSTVKYYDKKFRENLKAQTPFVACAERLDLPMKSGNQYEIL
Ga0187889_1003987243300018023PeatlandMAFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPMNSGNQYI
Ga0187889_1014890923300018023PeatlandMSFSPAGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLPMKSGN
Ga0187885_1025477223300018025PeatlandMSFSPAGNQQSNLPQSTVKYYDKKFRENLKAQTPFVACAERLDLTMKSGNQYEIF
Ga0187858_1008190513300018057PeatlandMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDL
Ga0181501_120628713300019230PeatlandMAGYTPSSNNQGNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPMK
Ga0181501_133606223300019230PeatlandNNQGNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEMESYAIA
Ga0182025_138509613300019786PermafrostMSFSPSGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACAERLNLPTNSGNQYI
Ga0206351_1097441113300020077Corn, Switchgrass And Miscanthus RhizosphereMAGYSPSSNSQSNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEMFMYVP
Ga0206354_1065724123300020081Corn, Switchgrass And Miscanthus RhizosphereMPGYSPAQNTTSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPTKSGNQYEMFMY
Ga0154015_103633823300020610Corn, Switchgrass And Miscanthus RhizosphereMSALMTAGNVQSNLPQSTVKYYDKKFRENLKAQTPFVACAERLDLPKNSGNDYNLFMYVPLAAN
Ga0210387_1102224813300021405SoilMAGYSPTSNAQSNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYE
Ga0210394_1000954173300021420SoilMSFSPSGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACAERLNLPTNSGNQYEIM
Ga0210398_1127571423300021477SoilMSFSPAGNQLSNLPQSTVKYYDKRFRENLKANTPFVRCSERLDLPMKSGNQYEMF
Ga0222729_102633423300022507SoilMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEMFMYVPLAAN
Ga0242663_107274013300022523SoilMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEMFMYV
Ga0242660_124017413300022531SoilMAGFNPASNATSNLPQSRVIFYDKRFIENLKAQTPFVRCAERRELPMNSGN
Ga0224554_105884413300023068SoilMANYSPASVGQSSLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPMKS
Ga0247695_106419813300024179SoilMSFSPSGNQLSNLPQSTVKYYDKRFRENLKANTPFVRCAERLDLPMKSGNQYEMFMYV
Ga0208034_102442523300025442PeatlandMSFSPSGNQLSNLPQSTLKYYDKRFRENLKAQTPFVRCAERLDLPMKSGNQYEIF
Ga0208039_104962513300025454PeatlandMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCSQRLDLP
Ga0208562_100166633300025460PeatlandMSFSPAGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLDLPMKSGNQYL
Ga0208220_109474623300025627Arctic Peat SoilMSFSPAGNGLSNLPQSTVRFYDKKFRENLKANTPFVRCSERLDLMKNAGNQYEMFMYVP
Ga0209530_1000513123300027692Forest SoilMAFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPVNSGNQYL
Ga0265326_1000618453300028558RhizosphereMAGYSPSSNNQSNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYELFMY
Ga0265326_1011150523300028558RhizosphereMGYSPASNVQSNLPQSTVKYYDKKFRENLKAQTPFIACSERLDLPAKSGNQYEMFMY
Ga0265323_1007840813300028653RhizosphereMALYSPSSNQQSNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYE
Ga0265338_10008879103300028800RhizosphereMGYSPAGNNQSNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYNMYQHTGTLAA
Ga0302265_103202733300028859BogMAGYTPAGNLQSNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPAKSGNQYI
Ga0311371_1214297713300029951PalsaMGYTPAGNLQGNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPTKSGNQYEMFMYVPLAANTA
Ga0210254_1085189313300030602SoilMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYE
Ga0265459_1321890013300030741SoilMAFSPAGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCSTRLDLPKNSGNQYEM
Ga0265756_10461823300030805SoilMAFSPAGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCSTRLDLPKNSGNQYEMFMYVP
Ga0265765_100214223300030879SoilMAFSPAGNQLSNLPQSTVKYYDKRFRENLKANTPFVRCSQRLDLPMKSGNQYEIT
Ga0265755_11197313300031041SoilMSFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYEMF
Ga0170820_1148431613300031446Forest SoilVAQYSPASNGQSNLPQSTVRYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYELFMYVP
Ga0310686_11794825813300031708SoilMTGYSPAINNQSNLPQSTVKYYDKKFRENLKAQTPFVACSERLDLPMKSGNQYEMFM
Ga0316219_125921413300031759FreshwaterMSFSPAGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCSQRLDLPKN
Ga0316029_10603623300031870SoilMAFSPSGNQLSNLPQSTVKYYDKRFRENLKAQTPFVRCAERLNLPTKSG
Ga0316226_113173713300032562FreshwaterMAFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPMNSGNQYL
Ga0316221_118530423300032665FreshwaterMAFSPAGNQLSNLPQSTVKFYDKKFRENLKAQTPFVACSERLDLPMNSGNQY
Ga0326728_1029163223300033402Peat SoilMSFSPAGNQQSNLPQSTVKYYDKRFRENLKAQTPFVACAERLDLPMKSGNQYEIF
Ga0326724_0446193_532_6753300034091Peat SoilMAGYSPAQNTQSNLPQSTIKYYDKKFRENLKAQTPFIACSERLDLPMK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.