| Basic Information | |
|---|---|
| Family ID | F072975 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MTGIVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVP |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.83 % |
| % of genes near scaffold ends (potentially truncated) | 96.67 % |
| % of genes from short scaffolds (< 2000 bps) | 86.67 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.94% β-sheet: 0.00% Coil/Unstructured: 84.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF01965 | DJ-1_PfpI | 9.17 |
| PF08281 | Sigma70_r4_2 | 7.50 |
| PF04542 | Sigma70_r2 | 5.83 |
| PF00135 | COesterase | 2.50 |
| PF00962 | A_deaminase | 1.67 |
| PF04055 | Radical_SAM | 1.67 |
| PF12900 | Pyridox_ox_2 | 1.67 |
| PF12833 | HTH_18 | 0.83 |
| PF01545 | Cation_efflux | 0.83 |
| PF03720 | UDPG_MGDP_dh_C | 0.83 |
| PF00132 | Hexapep | 0.83 |
| PF09250 | Prim-Pol | 0.83 |
| PF07690 | MFS_1 | 0.83 |
| PF12697 | Abhydrolase_6 | 0.83 |
| PF07730 | HisKA_3 | 0.83 |
| PF03008 | DUF234 | 0.83 |
| PF13738 | Pyr_redox_3 | 0.83 |
| PF07731 | Cu-oxidase_2 | 0.83 |
| PF00005 | ABC_tran | 0.83 |
| PF13360 | PQQ_2 | 0.83 |
| PF02771 | Acyl-CoA_dh_N | 0.83 |
| PF01243 | Putative_PNPOx | 0.83 |
| PF12323 | HTH_OrfB_IS605 | 0.83 |
| PF13278 | Obsolete Pfam Family | 0.83 |
| PF00196 | GerE | 0.83 |
| PF06441 | EHN | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 5.83 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 5.83 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 5.83 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 5.83 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 2.50 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 1.67 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.83 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.83 |
| COG1672 | Predicted ATPase, archaeal AAA+ ATPase superfamily | General function prediction only [R] | 0.83 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.83 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.83 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.83 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.83 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.83 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.83 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.33 % |
| Unclassified | root | N/A | 46.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_5614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1453 | Open in IMG/M |
| 3300001356|JGI12269J14319_10032149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3457 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10247334 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005435|Ga0070714_102390994 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005436|Ga0070713_102030955 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005439|Ga0070711_100853805 | Not Available | 775 | Open in IMG/M |
| 3300005541|Ga0070733_10254724 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300005591|Ga0070761_10605432 | Not Available | 682 | Open in IMG/M |
| 3300005712|Ga0070764_10691214 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006059|Ga0075017_101163065 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006162|Ga0075030_100713235 | Not Available | 794 | Open in IMG/M |
| 3300009522|Ga0116218_1221746 | Not Available | 851 | Open in IMG/M |
| 3300009698|Ga0116216_10328704 | Not Available | 930 | Open in IMG/M |
| 3300009698|Ga0116216_10811541 | Not Available | 561 | Open in IMG/M |
| 3300009700|Ga0116217_10057152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2795 | Open in IMG/M |
| 3300009824|Ga0116219_10165261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1275 | Open in IMG/M |
| 3300010048|Ga0126373_12956798 | Not Available | 530 | Open in IMG/M |
| 3300010335|Ga0134063_10238401 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300010343|Ga0074044_10817372 | Not Available | 609 | Open in IMG/M |
| 3300010371|Ga0134125_11560617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300010371|Ga0134125_12465466 | Not Available | 565 | Open in IMG/M |
| 3300010376|Ga0126381_103030523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300010396|Ga0134126_11460681 | Not Available | 754 | Open in IMG/M |
| 3300010876|Ga0126361_10977413 | Not Available | 641 | Open in IMG/M |
| 3300013105|Ga0157369_10082573 | All Organisms → cellular organisms → Bacteria | 3438 | Open in IMG/M |
| 3300014325|Ga0163163_10280894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinokineospora → Actinokineospora alba | 1716 | Open in IMG/M |
| 3300014969|Ga0157376_11709807 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300015356|Ga0134073_10401449 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300016294|Ga0182041_10257450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1424 | Open in IMG/M |
| 3300016387|Ga0182040_11689904 | Not Available | 540 | Open in IMG/M |
| 3300017822|Ga0187802_10087697 | Not Available | 1164 | Open in IMG/M |
| 3300017823|Ga0187818_10072375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1485 | Open in IMG/M |
| 3300017823|Ga0187818_10397870 | Not Available | 611 | Open in IMG/M |
| 3300017932|Ga0187814_10204257 | Not Available | 743 | Open in IMG/M |
| 3300017937|Ga0187809_10190081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
| 3300017942|Ga0187808_10083248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1381 | Open in IMG/M |
| 3300017942|Ga0187808_10201767 | Not Available | 884 | Open in IMG/M |
| 3300017959|Ga0187779_10365989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 934 | Open in IMG/M |
| 3300017974|Ga0187777_10965995 | Not Available | 615 | Open in IMG/M |
| 3300017975|Ga0187782_11311308 | Not Available | 568 | Open in IMG/M |
| 3300017994|Ga0187822_10222562 | Not Available | 638 | Open in IMG/M |
| 3300018007|Ga0187805_10391740 | Not Available | 644 | Open in IMG/M |
| 3300018009|Ga0187884_10242768 | Not Available | 735 | Open in IMG/M |
| 3300018482|Ga0066669_11015684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 748 | Open in IMG/M |
| 3300021170|Ga0210400_11445948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 547 | Open in IMG/M |
| 3300021171|Ga0210405_10932569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300021171|Ga0210405_11195365 | Not Available | 563 | Open in IMG/M |
| 3300021181|Ga0210388_10332937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1334 | Open in IMG/M |
| 3300021363|Ga0193699_10213954 | Not Available | 801 | Open in IMG/M |
| 3300021388|Ga0213875_10188393 | Not Available | 970 | Open in IMG/M |
| 3300021403|Ga0210397_10107013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1898 | Open in IMG/M |
| 3300021407|Ga0210383_10031616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4423 | Open in IMG/M |
| 3300021474|Ga0210390_10060573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3119 | Open in IMG/M |
| 3300021475|Ga0210392_10216852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Motilibacterales → Motilibacteraceae → Motilibacter | 1343 | Open in IMG/M |
| 3300023056|Ga0233357_1022412 | Not Available | 755 | Open in IMG/M |
| 3300023101|Ga0224557_1269521 | Not Available | 554 | Open in IMG/M |
| 3300025899|Ga0207642_10576588 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300025909|Ga0207705_10507701 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300025910|Ga0207684_10354295 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300025915|Ga0207693_10694918 | Not Available | 788 | Open in IMG/M |
| 3300025922|Ga0207646_10055825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3531 | Open in IMG/M |
| 3300025928|Ga0207700_10532591 | Not Available | 1041 | Open in IMG/M |
| 3300025929|Ga0207664_10057063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3103 | Open in IMG/M |
| 3300025929|Ga0207664_10801421 | Not Available | 847 | Open in IMG/M |
| 3300025986|Ga0207658_11588493 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300026095|Ga0207676_11785201 | Not Available | 614 | Open in IMG/M |
| 3300026551|Ga0209648_10071097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2927 | Open in IMG/M |
| 3300026551|Ga0209648_10378614 | Not Available | 949 | Open in IMG/M |
| 3300026899|Ga0209326_1004866 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300027029|Ga0208731_1011801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 904 | Open in IMG/M |
| 3300027502|Ga0209622_1068966 | Not Available | 645 | Open in IMG/M |
| 3300027787|Ga0209074_10100317 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300027812|Ga0209656_10040346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2703 | Open in IMG/M |
| 3300027812|Ga0209656_10209837 | Not Available | 939 | Open in IMG/M |
| 3300027824|Ga0209040_10085117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1819 | Open in IMG/M |
| 3300027824|Ga0209040_10383888 | Not Available | 657 | Open in IMG/M |
| 3300027825|Ga0209039_10265744 | Not Available | 682 | Open in IMG/M |
| 3300027867|Ga0209167_10545875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis thailandensis | 635 | Open in IMG/M |
| 3300028780|Ga0302225_10393562 | Not Available | 651 | Open in IMG/M |
| 3300028877|Ga0302235_10459765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300029920|Ga0302142_1191831 | Not Available | 622 | Open in IMG/M |
| 3300029943|Ga0311340_10107955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3041 | Open in IMG/M |
| 3300029999|Ga0311339_10087107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3925 | Open in IMG/M |
| 3300030054|Ga0302182_10396707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300030057|Ga0302176_10099473 | Not Available | 1137 | Open in IMG/M |
| 3300030520|Ga0311372_12320442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300030580|Ga0311355_10024658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 7420 | Open in IMG/M |
| 3300030730|Ga0307482_1259715 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031090|Ga0265760_10035328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1480 | Open in IMG/M |
| 3300031234|Ga0302325_10096529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5557 | Open in IMG/M |
| 3300031234|Ga0302325_10214034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3287 | Open in IMG/M |
| 3300031525|Ga0302326_10104894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5043 | Open in IMG/M |
| 3300031525|Ga0302326_12030741 | Not Available | 741 | Open in IMG/M |
| 3300031525|Ga0302326_12208968 | Not Available | 702 | Open in IMG/M |
| 3300031543|Ga0318516_10137312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1401 | Open in IMG/M |
| 3300031682|Ga0318560_10355129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 792 | Open in IMG/M |
| 3300031708|Ga0310686_109638760 | Not Available | 1253 | Open in IMG/M |
| 3300031708|Ga0310686_117741799 | Not Available | 573 | Open in IMG/M |
| 3300031723|Ga0318493_10634905 | Not Available | 596 | Open in IMG/M |
| 3300031748|Ga0318492_10332538 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300031748|Ga0318492_10556723 | Not Available | 610 | Open in IMG/M |
| 3300031753|Ga0307477_10743758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita | 654 | Open in IMG/M |
| 3300031754|Ga0307475_10791130 | Not Available | 753 | Open in IMG/M |
| 3300031771|Ga0318546_10520150 | Not Available | 835 | Open in IMG/M |
| 3300031782|Ga0318552_10155331 | Not Available | 1151 | Open in IMG/M |
| 3300031792|Ga0318529_10393523 | Not Available | 645 | Open in IMG/M |
| 3300031799|Ga0318565_10327133 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300031805|Ga0318497_10249332 | Not Available | 985 | Open in IMG/M |
| 3300031910|Ga0306923_10551335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1299 | Open in IMG/M |
| 3300031910|Ga0306923_11251377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 790 | Open in IMG/M |
| 3300031942|Ga0310916_10900549 | Not Available | 742 | Open in IMG/M |
| 3300032001|Ga0306922_11010498 | Not Available | 858 | Open in IMG/M |
| 3300032001|Ga0306922_12090557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300032008|Ga0318562_10653019 | Not Available | 606 | Open in IMG/M |
| 3300032060|Ga0318505_10541877 | Not Available | 548 | Open in IMG/M |
| 3300032805|Ga0335078_10055283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5850 | Open in IMG/M |
| 3300032828|Ga0335080_11580608 | Not Available | 646 | Open in IMG/M |
| 3300032893|Ga0335069_10553285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1327 | Open in IMG/M |
| 3300032898|Ga0335072_10578443 | Not Available | 1136 | Open in IMG/M |
| 3300033807|Ga0314866_075301 | Not Available | 583 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.33% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 10.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.83% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.83% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.83% | |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_01459820 | 2124908016 | MTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLM | |
| JGI12269J14319_100321495 | 3300001356 | Peatlands Soil | MTSIVPSGQGHLLTARGNVMAFKAVADQTGGDFSLMERTVPPGA |
| JGIcombinedJ51221_102473341 | 3300003505 | Forest Soil | MGDXVPSGQGRLXRARGNVMAFKAVAAQTGGDFSLMERTVPPGART |
| Ga0070714_1023909942 | 3300005435 | Agricultural Soil | MTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTV |
| Ga0070713_1020309551 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGIVSPGQGHLLTARGNVMAFKAVADQTGGDFSLMERTVPP |
| Ga0070711_1008538051 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEPSIVSAGQGKVVTARGSVMAFKAVAAQTGGDFSLMERTVPPRGR |
| Ga0070733_102547242 | 3300005541 | Surface Soil | VSESSIVSAGKGKIVTARGSVMAFKAVGAQTGGDFSLMERTVPPR |
| Ga0070761_106054322 | 3300005591 | Soil | MDGIVSPGQGHLLTARGNVLAFKAVAAQTGGDFSLME |
| Ga0070764_106912142 | 3300005712 | Soil | MADIVRPGQGHLLTARGNVLAFKAVADQTGGDFSLMERTVP |
| Ga0075017_1011630652 | 3300006059 | Watersheds | MTSIVPSGQGHLLTARGNVMAFKAVADQTGGDFSLMERTVPPG |
| Ga0075030_1007132351 | 3300006162 | Watersheds | MISIVPSGQGHLLTARGNVMAFKAVADQTGGDFSLMERTV |
| Ga0116218_12217461 | 3300009522 | Peatlands Soil | MTQIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLMERTVPPGA |
| Ga0116216_103287041 | 3300009698 | Peatlands Soil | MTSIVPSGQGHLLTARGNVMAFKAVADQTGGDFSLMERTVPP |
| Ga0116216_108115411 | 3300009698 | Peatlands Soil | MTPIVPSGQGHLLTARGNVLAFKAVAAQTGGDFSLMERTVPPG |
| Ga0116217_100571521 | 3300009700 | Peatlands Soil | MTPIVPSGQGHRLTARGNVLAFKAVAAQTGGDFSLME |
| Ga0116219_101652611 | 3300009824 | Peatlands Soil | MTEIVPSGQGRMLTARGNVMAFKAVADQTGGDFSLMERTVPPGAR |
| Ga0126373_129567981 | 3300010048 | Tropical Forest Soil | VTESSIVPAGKGKIVSARGSVMAFKAIAAQTGGDF |
| Ga0134063_102384011 | 3300010335 | Grasslands Soil | MTGIVPPGQGHLLTARGNVMAFKAVADQTGGDFSLMERTVP |
| Ga0074044_108173722 | 3300010343 | Bog Forest Soil | MGRIGGMTSIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLMERTVPP |
| Ga0134125_115606171 | 3300010371 | Terrestrial Soil | VSESSIVSAGKGKVVSARGSVMAFKAIAAQTDGDFSLME |
| Ga0134125_124654662 | 3300010371 | Terrestrial Soil | MTGIVSPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVP |
| Ga0126381_1030305232 | 3300010376 | Tropical Forest Soil | VITIAIVPPGAGHVLTARGSVMAFKAVAAQTGGDFSLMERTLPSGG |
| Ga0134126_114606811 | 3300010396 | Terrestrial Soil | MTGIVSPGQGHLLTARGNVMAFKAVADQTGGDFSL |
| Ga0126361_109774132 | 3300010876 | Boreal Forest Soil | MSDIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTVPPGARTP |
| Ga0157369_100825735 | 3300013105 | Corn Rhizosphere | MSDSSVIPAGMGKIVTARGSVMAFKAVAAQTGGDFSLMER |
| Ga0163163_102808944 | 3300014325 | Switchgrass Rhizosphere | MTRIVSPGQGHLLTARGNVMAFKAVAEQTGGDFSLM |
| Ga0157376_117098071 | 3300014969 | Miscanthus Rhizosphere | MTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPPG |
| Ga0134073_104014492 | 3300015356 | Grasslands Soil | MTGIVPPGQGQLLTARGNVMAFKAVAEQTGGDFSLMERTVPPGAR |
| Ga0182041_102574503 | 3300016294 | Soil | MTDIVPSGQGHRLTARGNVMAFKAVADQTGGDFSLM |
| Ga0182040_116899042 | 3300016387 | Soil | MTGVVSSGQGHMLTARGNVMAFKAVAAQTGGDFSLME |
| Ga0187802_100876972 | 3300017822 | Freshwater Sediment | MTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTV |
| Ga0187818_100723753 | 3300017823 | Freshwater Sediment | MTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTVPPG |
| Ga0187818_103978702 | 3300017823 | Freshwater Sediment | MTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTVP |
| Ga0187814_102042571 | 3300017932 | Freshwater Sediment | MTGIVPSGQGRLLSARGNVMAFKAVAAQTGGDFSLMERTVPP |
| Ga0187809_101900811 | 3300017937 | Freshwater Sediment | MTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSL |
| Ga0187808_100832483 | 3300017942 | Freshwater Sediment | MTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMER |
| Ga0187808_102017672 | 3300017942 | Freshwater Sediment | MTGEGVIPAGKGSKIYSARGSVMAFKAVADQTSGDFSL |
| Ga0187779_103659892 | 3300017959 | Tropical Peatland | MTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTVPPGARGTG |
| Ga0187777_109659951 | 3300017974 | Tropical Peatland | MNEIVPSGIVSAGQGHLLTARGNVMAFKAVADQTGGDFS |
| Ga0187782_113113082 | 3300017975 | Tropical Peatland | MTGIVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVP |
| Ga0187822_102225622 | 3300017994 | Freshwater Sediment | MTDIVPAGRGQLLTARGNVMAFKAVAGQTGGGFSLMERTVPPG |
| Ga0187805_103917402 | 3300018007 | Freshwater Sediment | VTESGIIAAGKGTIVAARGSVMAFKAIAAQTGGDF |
| Ga0187884_102427682 | 3300018009 | Peatland | MNDVVPSGQGHLLTARGNVMAFKAVAAQTRGDFSL |
| Ga0066669_110156841 | 3300018482 | Grasslands Soil | MDVLRPGEGHLLTAQGSTMAFKAVAAQTGGDFVLVPRGV |
| Ga0210400_114459481 | 3300021170 | Soil | MTDPSVMPAGQGRILSARGSVMAFKAGAEQTGGDFSLMERILPPRG |
| Ga0210405_109325691 | 3300021171 | Soil | MTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERSRYGMEPAGQNPLL |
| Ga0210405_111953652 | 3300021171 | Soil | MANIVPSGQGRLLRARGNVMAFKAVAAQTGGDFSLM |
| Ga0210388_103329371 | 3300021181 | Soil | VSEPGIIAAGEGTIVAARGSVMAFKAIAAQTGGDFSLME |
| Ga0193699_102139542 | 3300021363 | Soil | MTGIVPPGQGHLLTARGNEMAFKAVAEQTGGDFSLMERTVPPGAR |
| Ga0213875_101883932 | 3300021388 | Plant Roots | MSEIVPSGQGHLLTARGNVMAFKAVAEQTGGDFSLMERSVPAGAPM |
| Ga0210397_101070131 | 3300021403 | Soil | VSESSIVSTGKGKVVTARGSVMAFKAIAAQTDGDFS |
| Ga0210383_100316164 | 3300021407 | Soil | VSEPGIIAAGEGTIVAARGSVMAFKAIAAQTGGDFSLMERTVPPR |
| Ga0210390_100605735 | 3300021474 | Soil | MGDIVPSGQGRLLRARGNVMAFKAVAAQTGGDFSLMERTVPPG |
| Ga0210392_102168521 | 3300021475 | Soil | MTDHSVIPAGLGRILKARGSVMAFKAGREQTGGDFSLMER |
| Ga0233357_10224122 | 3300023056 | Soil | VDGIVPPGAGHILTARGSVMAFKAVAAQTGGDFSLMERT |
| Ga0224557_12695212 | 3300023101 | Soil | VAGNGVIPPGAGHTLTARGSIMAFKAVAEQTGGDFSL |
| Ga0207642_105765882 | 3300025899 | Miscanthus Rhizosphere | MTDIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPPGAR |
| Ga0207705_105077011 | 3300025909 | Corn Rhizosphere | MTDIVPPGQGHLLTARGNVMAFKAVAEQTGGAGDFLLV |
| Ga0207684_103542952 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLME |
| Ga0207693_106949181 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMER |
| Ga0207646_100558253 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEPSIIAAGKGTIVTARGSVMAFKAIAAQTGGDFSLMERT |
| Ga0207700_105325911 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEPSIIAAGKGTIVTARGSVMAFKAIAAQTGGDFSLMERTVPPRGRR |
| Ga0207664_100570634 | 3300025929 | Agricultural Soil | MTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLME |
| Ga0207664_108014212 | 3300025929 | Agricultural Soil | VTESGIIGAGQGSIVAARGSVMAFKAIAAQTGGDFSLMERTVPPRGRR |
| Ga0207658_115884932 | 3300025986 | Switchgrass Rhizosphere | MTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERT |
| Ga0207676_117852012 | 3300026095 | Switchgrass Rhizosphere | MTGIVSPGQGHLLTARGNVMAFKAVADQTGGDFSLM |
| Ga0209648_100710973 | 3300026551 | Grasslands Soil | MTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERTVPLMSRYGMEPA |
| Ga0209648_103786142 | 3300026551 | Grasslands Soil | MTGIVPSGQGHMLTARGNVMAFKAVAGQTGRPNGS |
| Ga0209326_10048662 | 3300026899 | Forest Soil | MTDIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSL |
| Ga0208731_10118012 | 3300027029 | Forest Soil | MTGIVPSGQGHLLTARGNVMAFKAVADQTGGDFSLME |
| Ga0209622_10689662 | 3300027502 | Forest Soil | VSEPSIVSAGKGKIVTARGSVMAFKAIAAQTDGDFSLME |
| Ga0209074_101003171 | 3300027787 | Agricultural Soil | MTGIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPP |
| Ga0209656_100403464 | 3300027812 | Bog Forest Soil | MTEIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLMERTV |
| Ga0209656_102098371 | 3300027812 | Bog Forest Soil | MGRIGGMTSIVPSGEGHLLTARGNVMAFKAVADQTGGD |
| Ga0209040_100851174 | 3300027824 | Bog Forest Soil | MTEIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLM |
| Ga0209040_103838881 | 3300027824 | Bog Forest Soil | MGRIGGMTSIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLM |
| Ga0209039_102657442 | 3300027825 | Bog Forest Soil | MGRIGGMTSIVPSGEGHLLTARGNVMAFKAVADQTGGDFSLMERTVPPGA |
| Ga0209167_105458752 | 3300027867 | Surface Soil | VSESSIVSAGKGKIVTARGSVMAFKAVAAQTGGDFSLMERTVPPRG |
| Ga0302225_103935622 | 3300028780 | Palsa | MTDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPP |
| Ga0302235_104597651 | 3300028877 | Palsa | VTESSIIAAGKGNIVTARGSVMAFKAIAAQTDGDFSLMERT |
| Ga0302142_11918311 | 3300029920 | Bog | VAGPGVVPPGEGHLLTARGSVMAFKAVAAQTGGDFSL |
| Ga0311340_101079554 | 3300029943 | Palsa | MTDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMER |
| Ga0311339_100871075 | 3300029999 | Palsa | MSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPPGA |
| Ga0302182_103967071 | 3300030054 | Palsa | MSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPS |
| Ga0302176_100994731 | 3300030057 | Palsa | MTDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPPG |
| Ga0311372_123204422 | 3300030520 | Palsa | VTETSIISAGNGKIVTARGSVMAFKAIAAQTDGDFSLMERTVPPH |
| Ga0311355_100246581 | 3300030580 | Palsa | MSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPPG |
| Ga0307482_12597151 | 3300030730 | Hardwood Forest Soil | MTDDGRRIVPAGEGHLLTARGNLLAFKAVAAETGGDFSLMERTV |
| Ga0265760_100353281 | 3300031090 | Soil | MTPIVPAGAGHVLTARGSVMAFKAVARQTGGDFSL |
| Ga0302325_100965291 | 3300031234 | Palsa | MSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVPP |
| Ga0302325_102140341 | 3300031234 | Palsa | MSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLMERTVP |
| Ga0302326_101048941 | 3300031525 | Palsa | VSESSIVSAGKGKIVAARGSVMAFKAVAATTDGDFSLMERTVPAHGR |
| Ga0302326_120307412 | 3300031525 | Palsa | MSDVVPSGQGHLLTARGNVMAFKAVAAQTGGDFSLME |
| Ga0302326_122089681 | 3300031525 | Palsa | MTGIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLM |
| Ga0318516_101373121 | 3300031543 | Soil | MTDIVPPGQGHLLTARGNVMAFKAVAEQTSGDFSLMERTVP |
| Ga0318560_103551291 | 3300031682 | Soil | MTGIVPSGQGRRLTARGNVMAFKAVAAQTGGDFSLMERTVPP |
| Ga0310686_1096387603 | 3300031708 | Soil | VGGVTESSIIPAGAGQLVTARGSVMAFKAVAASTGGDFSLMERTVPPHGRR |
| Ga0310686_1177417992 | 3300031708 | Soil | VPAGRGQLFTARGNVMAFKAVAAQTGGDFSLMERTVP |
| Ga0318493_106349052 | 3300031723 | Soil | MTDIVPAGRGLLLTARGNVMAFKAVAAQTDGDFSVMER |
| Ga0318492_103325381 | 3300031748 | Soil | MTEIVPPGQGHLLTARGNVMAFKAVAEQTSGDFSLME |
| Ga0318492_105567232 | 3300031748 | Soil | MTGVVSLGQGHMLTARGNVMAFKAVAAQTGGDFSLMERTVPPGA |
| Ga0307477_107437582 | 3300031753 | Hardwood Forest Soil | MTGIVPSGQGRVLTARGNVMAFKAVAAQTGGDFSLMERTRAALPV |
| Ga0307475_107911302 | 3300031754 | Hardwood Forest Soil | VTESGIIGAGQGAIVAARGSVMAFKAIAAQTGGDFSLMERTVPPR |
| Ga0318546_105201502 | 3300031771 | Soil | MTDIVPAGRGRLLTARGNVMAFKAVAAQTGGDFSVM |
| Ga0318552_101553312 | 3300031782 | Soil | MTDIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMERT |
| Ga0318529_103935232 | 3300031792 | Soil | MTGVVSSGQGHMLTARGNVMAFKAVAAQTGGDFSLMERTVQP |
| Ga0318565_103271332 | 3300031799 | Soil | MTGIVPPGQGRQLTARGNVMAFKAVADQTGGDFSLMER |
| Ga0318497_102493321 | 3300031805 | Soil | MTDIVPSGQGRLLTARGNVMAFKAVAAQTGGDFSLMER |
| Ga0306923_105513351 | 3300031910 | Soil | MTDIVPSGQGRLLTARGNVMAFKAVAAQTDGDFSLMER |
| Ga0306923_112513771 | 3300031910 | Soil | MTDIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPP |
| Ga0310916_109005492 | 3300031942 | Soil | MTDIVPAGRGRLLTARGNVMAFKAVAAQTGGDFSVMERTVP |
| Ga0306922_110104982 | 3300032001 | Soil | MTEIVPPGQGHLLTARGNVMAFKAVAEQTSGDFSL |
| Ga0306922_120905571 | 3300032001 | Soil | MTTIVPSGEGHLLTARGSVMAFKAVAAQTGGDFSL |
| Ga0318562_106530192 | 3300032008 | Soil | MTGIVPPGEGHLLTARGNVMAFKAVADQTGGTMPVM |
| Ga0318505_105418771 | 3300032060 | Soil | MTEIVPPGQGHLLTARGNVMAFKAVAEQTSGDFSLMERTVP |
| Ga0335078_100552837 | 3300032805 | Soil | MTDIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPPGART |
| Ga0335080_115806082 | 3300032828 | Soil | MTDIVPPGQGHLLTARGNVMAFKAVAEQTGGDFSLMERTVPPG |
| Ga0335069_105532852 | 3300032893 | Soil | MTGIIGPGEGHLFTARGSTMAFKALAAQTGGDFSLMERT |
| Ga0335072_105784432 | 3300032898 | Soil | MVSMTEHSIIPAGKGRIVGARGSVMAFKAVAEQTDGGFSLMER |
| Ga0314866_075301_475_582 | 3300033807 | Peatland | MTGIVPSGQGHLLTARGNVMAFKAVTEQTSGDFSLM |
| ⦗Top⦘ |