| Basic Information | |
|---|---|
| Family ID | F072907 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 40 residues |
| Representative Sequence | PFKDFNAIFEKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Number of Associated Samples | 42 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 82.50 % |
| Associated GOLD sequencing projects | 28 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (100.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (100.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02397 | Bac_transf | 15.00 |
| PF00589 | Phage_integrase | 7.50 |
| PF01370 | Epimerase | 6.67 |
| PF13727 | CoA_binding_3 | 5.00 |
| PF01041 | DegT_DnrJ_EryC1 | 3.33 |
| PF00535 | Glycos_transf_2 | 3.33 |
| PF03721 | UDPG_MGDP_dh_N | 3.33 |
| PF00534 | Glycos_transf_1 | 2.50 |
| PF02350 | Epimerase_2 | 1.67 |
| PF02899 | Phage_int_SAM_1 | 1.67 |
| PF11903 | ParD_like | 1.67 |
| PF13692 | Glyco_trans_1_4 | 1.67 |
| PF13579 | Glyco_trans_4_4 | 1.67 |
| PF13419 | HAD_2 | 0.83 |
| PF14667 | Polysacc_synt_C | 0.83 |
| PF02719 | Polysacc_synt_2 | 0.83 |
| PF02706 | Wzz | 0.83 |
| PF08241 | Methyltransf_11 | 0.83 |
| PF02780 | Transketolase_C | 0.83 |
| PF00676 | E1_dh | 0.83 |
| PF04443 | LuxE | 0.83 |
| PF16363 | GDP_Man_Dehyd | 0.83 |
| PF13439 | Glyco_transf_4 | 0.83 |
| PF01050 | MannoseP_isomer | 0.83 |
| PF13561 | adh_short_C2 | 0.83 |
| PF00456 | Transketolase_N | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 15.00 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 3.33 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 3.33 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 3.33 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 3.33 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 3.33 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 3.33 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 3.33 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 3.33 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 3.33 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 3.33 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 3.33 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 1.67 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 1.67 |
| COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.67 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 1.67 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.67 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.67 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.67 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.83 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.83 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.83 |
| COG3944 | Capsular polysaccharide biosynthesis protein YveK | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG3765 | LPS O-antigen chain length determinant protein, WzzB/FepE family | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG3524 | Capsule polysaccharide export protein KpsE/RkpR | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG3206 | Exopolysaccharide export protein/domain GumC/Wzc1 | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.83 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.50 % |
| Unclassified | root | N/A | 42.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300016741|Ga0182079_1102991 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300016746|Ga0182055_1472618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Alcanivoracaceae → Alcanivorax → unclassified Alcanivorax → Alcanivorax sp. CY1518 | 1196 | Open in IMG/M |
| 3300016771|Ga0182082_1593371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 698 | Open in IMG/M |
| 3300016781|Ga0182063_1306287 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300017818|Ga0181565_10079166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas cavernicola | 2344 | Open in IMG/M |
| 3300017818|Ga0181565_10142688 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300017818|Ga0181565_10179209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 1466 | Open in IMG/M |
| 3300017818|Ga0181565_10231959 | Not Available | 1258 | Open in IMG/M |
| 3300017818|Ga0181565_10261364 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300017818|Ga0181565_10268976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1152 | Open in IMG/M |
| 3300017818|Ga0181565_10568662 | Not Available | 730 | Open in IMG/M |
| 3300017818|Ga0181565_10707058 | Not Available | 639 | Open in IMG/M |
| 3300017818|Ga0181565_11026581 | Not Available | 510 | Open in IMG/M |
| 3300017949|Ga0181584_10513454 | Not Available | 735 | Open in IMG/M |
| 3300017949|Ga0181584_10584241 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300017949|Ga0181584_10696747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 607 | Open in IMG/M |
| 3300017949|Ga0181584_10843096 | Not Available | 540 | Open in IMG/M |
| 3300017949|Ga0181584_10888021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella livida | 523 | Open in IMG/M |
| 3300017949|Ga0181584_10894339 | Not Available | 521 | Open in IMG/M |
| 3300017951|Ga0181577_10065376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2563 | Open in IMG/M |
| 3300017951|Ga0181577_10291312 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → Bathymodiolus heckerae thiotrophic gill symbiont | 1062 | Open in IMG/M |
| 3300017951|Ga0181577_10676762 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → Bathymodiolus heckerae thiotrophic gill symbiont | 630 | Open in IMG/M |
| 3300017952|Ga0181583_10318994 | Not Available | 984 | Open in IMG/M |
| 3300017952|Ga0181583_10655574 | Not Available | 627 | Open in IMG/M |
| 3300017956|Ga0181580_10659739 | Not Available | 669 | Open in IMG/M |
| 3300017957|Ga0181571_10009787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 7104 | Open in IMG/M |
| 3300017957|Ga0181571_10013497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6013 | Open in IMG/M |
| 3300017957|Ga0181571_10021188 | All Organisms → cellular organisms → Bacteria | 4707 | Open in IMG/M |
| 3300017957|Ga0181571_10353961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 917 | Open in IMG/M |
| 3300017957|Ga0181571_10802804 | Not Available | 558 | Open in IMG/M |
| 3300017958|Ga0181582_10235548 | Not Available | 1227 | Open in IMG/M |
| 3300017962|Ga0181581_10019612 | All Organisms → cellular organisms → Bacteria | 5024 | Open in IMG/M |
| 3300017962|Ga0181581_10176522 | Not Available | 1426 | Open in IMG/M |
| 3300017962|Ga0181581_10867689 | Not Available | 534 | Open in IMG/M |
| 3300017964|Ga0181589_10041214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3497 | Open in IMG/M |
| 3300017964|Ga0181589_10218768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 1317 | Open in IMG/M |
| 3300017964|Ga0181589_10230741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Thioglobus → environmental samples → uncultured Candidatus Thioglobus sp. | 1275 | Open in IMG/M |
| 3300017964|Ga0181589_10531298 | Not Available | 756 | Open in IMG/M |
| 3300017964|Ga0181589_10800630 | Not Available | 584 | Open in IMG/M |
| 3300017964|Ga0181589_10901080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Thioglobus → environmental samples → uncultured Candidatus Thioglobus sp. | 543 | Open in IMG/M |
| 3300017968|Ga0181587_10401278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 906 | Open in IMG/M |
| 3300017969|Ga0181585_10193281 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300017985|Ga0181576_10029817 | All Organisms → cellular organisms → Bacteria | 3762 | Open in IMG/M |
| 3300017985|Ga0181576_10533530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300017985|Ga0181576_10764184 | Not Available | 573 | Open in IMG/M |
| 3300017985|Ga0181576_10826198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300017986|Ga0181569_10011708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6498 | Open in IMG/M |
| 3300017986|Ga0181569_10014372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5810 | Open in IMG/M |
| 3300017986|Ga0181569_10051327 | All Organisms → cellular organisms → Bacteria | 2957 | Open in IMG/M |
| 3300017986|Ga0181569_10063901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 2630 | Open in IMG/M |
| 3300017986|Ga0181569_10140100 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300017986|Ga0181569_10286552 | Not Available | 1143 | Open in IMG/M |
| 3300017986|Ga0181569_10731515 | Not Available | 653 | Open in IMG/M |
| 3300018049|Ga0181572_10068267 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300018049|Ga0181572_10444611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → unclassified Piscirickettsiaceae → Piscirickettsiaceae bacterium | 805 | Open in IMG/M |
| 3300018049|Ga0181572_10730454 | Not Available | 594 | Open in IMG/M |
| 3300018049|Ga0181572_10784929 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → Bathymodiolus heckerae thiotrophic gill symbiont | 568 | Open in IMG/M |
| 3300018418|Ga0181567_10639564 | Not Available | 684 | Open in IMG/M |
| 3300018421|Ga0181592_10200471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Thiomicrorhabdus → Thiomicrorhabdus chilensis | 1492 | Open in IMG/M |
| 3300018421|Ga0181592_10456735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 891 | Open in IMG/M |
| 3300018421|Ga0181592_10469529 | Not Available | 875 | Open in IMG/M |
| 3300018421|Ga0181592_10517932 | Not Available | 821 | Open in IMG/M |
| 3300018421|Ga0181592_10581227 | Not Available | 763 | Open in IMG/M |
| 3300018424|Ga0181591_10298956 | Not Available | 1228 | Open in IMG/M |
| 3300018424|Ga0181591_10556560 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300018424|Ga0181591_10991963 | Not Available | 571 | Open in IMG/M |
| 3300018426|Ga0181566_10039817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3661 | Open in IMG/M |
| 3300018426|Ga0181566_10216164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1413 | Open in IMG/M |
| 3300018426|Ga0181566_10414484 | Not Available | 956 | Open in IMG/M |
| 3300018426|Ga0181566_10427092 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300018426|Ga0181566_10880759 | Not Available | 607 | Open in IMG/M |
| 3300018426|Ga0181566_11068161 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → Bathymodiolus heckerae thiotrophic gill symbiont | 542 | Open in IMG/M |
| 3300018428|Ga0181568_10603671 | Not Available | 865 | Open in IMG/M |
| 3300018428|Ga0181568_10972739 | Not Available | 647 | Open in IMG/M |
| 3300018428|Ga0181568_11397987 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → Bathymodiolus heckerae thiotrophic gill symbiont | 520 | Open in IMG/M |
| 3300019266|Ga0182061_1348412 | Not Available | 621 | Open in IMG/M |
| 3300019277|Ga0182081_1655072 | Not Available | 515 | Open in IMG/M |
| 3300020168|Ga0181588_10121721 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300020207|Ga0181570_10019101 | All Organisms → cellular organisms → Bacteria | 4338 | Open in IMG/M |
| 3300020207|Ga0181570_10258337 | Not Available | 892 | Open in IMG/M |
| 3300020207|Ga0181570_10270638 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300020207|Ga0181570_10327830 | Not Available | 758 | Open in IMG/M |
| 3300020207|Ga0181570_10395851 | Not Available | 663 | Open in IMG/M |
| 3300020207|Ga0181570_10519677 | Not Available | 543 | Open in IMG/M |
| 3300022935|Ga0255780_10397523 | Not Available | 614 | Open in IMG/M |
| 3300022939|Ga0255754_10120628 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300022939|Ga0255754_10324077 | Not Available | 718 | Open in IMG/M |
| 3300022939|Ga0255754_10457909 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300023081|Ga0255764_10103295 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300023081|Ga0255764_10190062 | Not Available | 1025 | Open in IMG/M |
| 3300023081|Ga0255764_10371210 | Not Available | 629 | Open in IMG/M |
| 3300023081|Ga0255764_10497992 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300023084|Ga0255778_10123238 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300023084|Ga0255778_10397324 | Not Available | 596 | Open in IMG/M |
| 3300023084|Ga0255778_10431269 | Not Available | 559 | Open in IMG/M |
| 3300023087|Ga0255774_10003515 | All Organisms → cellular organisms → Bacteria | 11495 | Open in IMG/M |
| 3300023087|Ga0255774_10016830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4747 | Open in IMG/M |
| 3300023087|Ga0255774_10118370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1487 | Open in IMG/M |
| 3300023087|Ga0255774_10143506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1306 | Open in IMG/M |
| 3300023087|Ga0255774_10380872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 642 | Open in IMG/M |
| 3300023087|Ga0255774_10423753 | Not Available | 591 | Open in IMG/M |
| 3300023105|Ga0255782_10176556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Hahellaceae → Sansalvadorimonas → unclassified Sansalvadorimonas → Sansalvadorimonas sp. 2012CJ34-2 | 1075 | Open in IMG/M |
| 3300023110|Ga0255743_10278561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 875 | Open in IMG/M |
| 3300023115|Ga0255760_10092658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1843 | Open in IMG/M |
| 3300023115|Ga0255760_10113441 | Not Available | 1602 | Open in IMG/M |
| 3300023115|Ga0255760_10175595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1174 | Open in IMG/M |
| 3300023115|Ga0255760_10306332 | Not Available | 780 | Open in IMG/M |
| 3300023116|Ga0255751_10249308 | Not Available | 957 | Open in IMG/M |
| 3300023116|Ga0255751_10434708 | Not Available | 639 | Open in IMG/M |
| 3300023117|Ga0255757_10292110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300023119|Ga0255762_10101421 | Not Available | 1722 | Open in IMG/M |
| 3300023119|Ga0255762_10330376 | Not Available | 779 | Open in IMG/M |
| 3300023119|Ga0255762_10500467 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → Bathymodiolus heckerae thiotrophic gill symbiont | 570 | Open in IMG/M |
| 3300023175|Ga0255777_10063225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2466 | Open in IMG/M |
| 3300023175|Ga0255777_10262639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 997 | Open in IMG/M |
| 3300023175|Ga0255777_10523842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300023176|Ga0255772_10039730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3393 | Open in IMG/M |
| 3300023176|Ga0255772_10077877 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
| 3300023180|Ga0255768_10575555 | Not Available | 551 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 100.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300016741 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016746 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016781 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019266 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019277 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020168 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
| 3300022939 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023117 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0182079_11029913 | 3300016741 | Salt Marsh | GPFKDFNAIFEKYDEDKSAIVLINFLRYQQRVKIQSEMIA |
| Ga0182055_14726181 | 3300016746 | Salt Marsh | PFKGFNAIFEKYDKDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0182082_15933711 | 3300016771 | Salt Marsh | FNAIFEKYDEDKSAIVLINFLRHQQMMKIQLEMIA |
| Ga0182063_13062871 | 3300016781 | Salt Marsh | PFKDFNAIFEKYDEDKSAIVLINFLRHQQMMKIQLEMIA |
| Ga0181565_100791661 | 3300017818 | Salt Marsh | KGFNAIFEKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181565_101426881 | 3300017818 | Salt Marsh | SGPFKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIV |
| Ga0181565_101792091 | 3300017818 | Salt Marsh | IKSGPFKDFNGIFERYDADQSAIILINFLRHQQKVKLKAEMIA |
| Ga0181565_102319591 | 3300017818 | Salt Marsh | DFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIA |
| Ga0181565_102613641 | 3300017818 | Salt Marsh | VLIKSGPFKDFNAIVEKYEADQSVIVLINFLRHQQRVKIQSEMIA |
| Ga0181565_102689763 | 3300017818 | Salt Marsh | GFNAIFEKYDEDKSAIVLINFLRHQQPVKIQSEMIA |
| Ga0181565_105686622 | 3300017818 | Salt Marsh | FIKSGPFKDFNAIFEKYDEDKSAIVLINFLRHQQMMKIQLEMIA |
| Ga0181565_107070582 | 3300017818 | Salt Marsh | QEVLIKSGPLKDFNGIFEKYEADQSAIVLINFLRHHQQVKVKLEAIS |
| Ga0181565_110265811 | 3300017818 | Salt Marsh | FIKSGPFKDFNGIFEKYDADQSAIVLINFLRHQQRVKIQSEMIT |
| Ga0181584_105134541 | 3300017949 | Salt Marsh | FKGFNGVFEKYEADQSVIVLINFLRHQQRVKIQSKMIA |
| Ga0181584_105842411 | 3300017949 | Salt Marsh | SGPFKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIA |
| Ga0181584_106967471 | 3300017949 | Salt Marsh | DEVFIKSGPFKDFNAIFEKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181584_108430961 | 3300017949 | Salt Marsh | EVFIKSGPFKDFNAIFEKYDEDKSAIVIINFLRYQQRVKIQSEMIA |
| Ga0181584_108880211 | 3300017949 | Salt Marsh | GFNAIFEKYDKDKSAIVLINFVRHQQRVKIQSEMIA |
| Ga0181584_108943392 | 3300017949 | Salt Marsh | SGPFKDFNAIFEKYDEDKSAIVLINFLRRQQRVKIQSEMIA |
| Ga0181577_100653767 | 3300017951 | Salt Marsh | VLIKSGPFKDFNAIFEKYDKDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181577_102913122 | 3300017951 | Salt Marsh | KSGPFKGFNAIFEKYDKDKSAIVLINFLRHQQWVKIQWEMIA |
| Ga0181577_106767622 | 3300017951 | Salt Marsh | EEVFIKSGPFKDFNAIVEKYEADQSVIVLINFLRHQQQVKIQSEMIA |
| Ga0181583_103189943 | 3300017952 | Salt Marsh | IKSGPFKDFNAIFEKYEADQSVIVLINFLRHQQRMKIQLEMIA |
| Ga0181583_106555742 | 3300017952 | Salt Marsh | KDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIS |
| Ga0181580_106597392 | 3300017956 | Salt Marsh | IKSGPFKDYNGIFEKYDADQSAIVLINFLRYQQRVKIQSEMIA |
| Ga0181571_100097879 | 3300017957 | Salt Marsh | FKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSKVIA |
| Ga0181571_100134979 | 3300017957 | Salt Marsh | PFKGFNAIFVKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181571_100211881 | 3300017957 | Salt Marsh | IKSGPFKDFNAIFEKYEADQSVIVLINFLRYQQRVKIQSEMIA |
| Ga0181571_103539611 | 3300017957 | Salt Marsh | KGFNAIFEKYDKDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181571_108028041 | 3300017957 | Salt Marsh | FKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIV |
| Ga0181582_102355483 | 3300017958 | Salt Marsh | FNAIFEKYEADQSVIVLINFLRYQQRVKIQSEMIV |
| Ga0181581_100196127 | 3300017962 | Salt Marsh | FKDFKGVFDKYDEDNSAIVLINFLRHQQQVKIQSEMIA |
| Ga0181581_101765222 | 3300017962 | Salt Marsh | FNGVFDKYDADQSAIVLINFLRHQQRVKIKAEMIA |
| Ga0181581_108676891 | 3300017962 | Salt Marsh | DEVVIKSGPFKDFNAIFEKYDANQSATVLINFLRSQQKVNIKLDAIS |
| Ga0181589_100412146 | 3300017964 | Salt Marsh | PFKDFNAIVEKYEADQSVIVLINFLRHQQRVKIQSEMIV |
| Ga0181589_102187681 | 3300017964 | Salt Marsh | PFKGFNAIFEKYDVDKSAIVLINFLRHQQRVKIQSEVIA |
| Ga0181589_102307411 | 3300017964 | Salt Marsh | VFIKSGPFKGFNGVFEKYDKDKSAIILINFLRHQQRVKIQSQMIA |
| Ga0181589_105312981 | 3300017964 | Salt Marsh | KGEEVFIKSGPFKDFNAIFENYDEDKSAIILINFLRHQQRVKIQLEMIA |
| Ga0181589_108006302 | 3300017964 | Salt Marsh | LHQKGEEVLIKSGPFKDFNGIFEKYDANKSAIVLINFFRHQQQIKIKAEMIS |
| Ga0181589_109010801 | 3300017964 | Salt Marsh | KSGPFKDFNAIFEKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181590_103349111 | 3300017967 | Salt Marsh | KGEEVFIKSGPFMDFNVIFEKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181587_104012783 | 3300017968 | Salt Marsh | FKGFNAIFEKYNEDKSAIVLINFLRHQQRVKIQSEMIV |
| Ga0181585_101932811 | 3300017969 | Salt Marsh | SGPFKDFNAIFEKYDKDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181576_100298171 | 3300017985 | Salt Marsh | HQKGEEVFIKSGPFKDFNGVFEKYDVDNSAIVLINFLRNRQQVKIKADMIA |
| Ga0181576_105335301 | 3300017985 | Salt Marsh | SGPFKDFNGIFENYDADQSAIVLINFLRHQQRVKIKAEMIA |
| Ga0181576_107641842 | 3300017985 | Salt Marsh | LIKSGPLKDFNGIFEKYEADQSAIVLINFLRHHQQVKVKLEAIS |
| Ga0181576_108261982 | 3300017985 | Salt Marsh | FKGFNAIFEKYDKDKSAIVLINFLRHQQRVKIQSKMIA |
| Ga0181569_100117089 | 3300017986 | Salt Marsh | EEVLIKSGPFKDFNAIVEKYEADQSVIVLINFLRCQQRVKIQSEMIA |
| Ga0181569_100143728 | 3300017986 | Salt Marsh | FKDFNAIFEKYDEDKSAIVLINFLRHQQWVKIQSEMIA |
| Ga0181569_100513271 | 3300017986 | Salt Marsh | SGPFKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIS |
| Ga0181569_100639011 | 3300017986 | Salt Marsh | FNAIFEKYDKDKSAIVLINFLRHQQQVKIQSEMIA |
| Ga0181569_101401001 | 3300017986 | Salt Marsh | FKDFNAIFEKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181569_102865521 | 3300017986 | Salt Marsh | KDFNGIFEKYDAEKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181569_107315153 | 3300017986 | Salt Marsh | GEEVFIKSGPFKDFNGIFEKYEADQSAIVLINFLRHQKRLKIKAEMIA |
| Ga0181572_100682674 | 3300018049 | Salt Marsh | SGPFKDFNAIVEKYEADQSVIVLINFLRHQQRVKIQSEMIA |
| Ga0181572_104446111 | 3300018049 | Salt Marsh | FKGFNAIFEKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181572_107304541 | 3300018049 | Salt Marsh | DFNAIVEKYDKDKSVIVLINFLRYQQRVKIQSEMIA |
| Ga0181572_107849291 | 3300018049 | Salt Marsh | FKDFNAIVEKYEADQSVIVLINFLRHQQQVKIQSEMIA |
| Ga0181567_106395642 | 3300018418 | Salt Marsh | PFKDFNAIVEKYEADQSVIVLINFLRYQQRVKIHSEMIA |
| Ga0181592_102004711 | 3300018421 | Salt Marsh | IKSGPFKDFNAIVEKYESDQSVIVLINFLRYQQRVKIQSEMIA |
| Ga0181592_104567353 | 3300018421 | Salt Marsh | PFKGFNAIFEKYDKDKSAIVLINFLRHQQRVKIRSEMIV |
| Ga0181592_104695292 | 3300018421 | Salt Marsh | PFKDFNAIFEKYDEDKSAIVLINFLRHQQWVKIQSEMIA |
| Ga0181592_105179322 | 3300018421 | Salt Marsh | FKGFNGVFDKYDADQSAIVLINFLRHQQRVKIKAEMIA |
| Ga0181592_105812271 | 3300018421 | Salt Marsh | FKGFNAIFEKYDKEKSAIVLINFIRHQQRVKIQSNMIA |
| Ga0181591_102989561 | 3300018424 | Salt Marsh | KDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIA |
| Ga0181591_105565601 | 3300018424 | Salt Marsh | FSGVFDSYDANQSANVLINFLRHEQLVKIKADMIA |
| Ga0181591_109919631 | 3300018424 | Salt Marsh | FKDFNAIFEKYEGDQSVIVLINFLRYRQRVKIQSEMIA |
| Ga0181566_100398171 | 3300018426 | Salt Marsh | IKSGPFKGFYGIFDKYDTDQSVIVLINFIRHQQRVKIQSEMIT |
| Ga0181566_102161643 | 3300018426 | Salt Marsh | FNAIFEKYEADQSVVVLINFLRYQQRVKIQSEMIA |
| Ga0181566_104144841 | 3300018426 | Salt Marsh | PFKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSKVIA |
| Ga0181566_104270921 | 3300018426 | Salt Marsh | GPFKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIV |
| Ga0181566_108807592 | 3300018426 | Salt Marsh | GEEVFIKSVPFKDFNGIFEKYDTNQSAIVLINFLRNQQRVKIQSDMIA |
| Ga0181566_110681611 | 3300018426 | Salt Marsh | KDFNAIVEKYEADQSVIVLINFLRHQQQVKIQSEMIA |
| Ga0181568_106036711 | 3300018428 | Salt Marsh | SGPFKDFNAIFEKYNEDKSAIVLINFLRHQQLVKIQSEMIA |
| Ga0181568_109727391 | 3300018428 | Salt Marsh | FKSFNAIFEKYDKDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181568_113979871 | 3300018428 | Salt Marsh | KDFNAIFEKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0182061_13484121 | 3300019266 | Salt Marsh | KSGPFKDFNAIVEKYEADQSVIVLINFLRYQQRVQIQSEMIT |
| Ga0182081_16550721 | 3300019277 | Salt Marsh | FKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSKMIA |
| Ga0181588_101217211 | 3300020168 | Salt Marsh | GPFKSFNAIFEKYDKDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181570_100191015 | 3300020207 | Salt Marsh | KSGPFKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIS |
| Ga0181570_102583371 | 3300020207 | Salt Marsh | PFKDFNAIFEKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0181570_102706381 | 3300020207 | Salt Marsh | PFKGFNAIFEKYEADQSVIVLINFLRHQQRVKIQSEMIA |
| Ga0181570_103278302 | 3300020207 | Salt Marsh | FNAIVEKYDADQSVIVLINFLRHQQRVKIQSEMIA |
| Ga0181570_103958512 | 3300020207 | Salt Marsh | VFIKSGPFKGFNAIFEKYNEDKSVIVLINFLRHQQQVKIQSEMIA |
| Ga0181570_105196772 | 3300020207 | Salt Marsh | PFKGFNGIFEKYGADQSAIILINFLRHRQRVKIKAEMIA |
| Ga0255780_103975231 | 3300022935 | Salt Marsh | EEVFIKSGPFKDFNGVFEKYEADQSAIVLINFLRHQQRVKIQSEMIA |
| Ga0255754_101206284 | 3300022939 | Salt Marsh | IKSGPFKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIV |
| Ga0255754_103240773 | 3300022939 | Salt Marsh | GPFKDFNAIFEKYNEDKSAIVLINFLRHQQLVKIQSEMIA |
| Ga0255754_104579092 | 3300022939 | Salt Marsh | FKGFNAIFEKYDKDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0255764_101032952 | 3300023081 | Salt Marsh | QKGEEVFIKSGPFKDFKGIFEKYEADNAVIVLINFLRHQQRLKIKPDMII |
| Ga0255764_101900622 | 3300023081 | Salt Marsh | FIKSGPFKDFNGVFDKYDADQSAIVLINFLRHQQRVKIKAEMIA |
| Ga0255764_103712101 | 3300023081 | Salt Marsh | FNAIFEKYDGDKSAIVLINFLRHQQRVKIQTGMIA |
| Ga0255764_104979921 | 3300023081 | Salt Marsh | EEVLIKSGPFKDFNAIFEKYNKDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0255778_101232381 | 3300023084 | Salt Marsh | ILIKSGPFKDFNAIFRNYDADQSAIVLINFLRNKLQVRVKLDAIS |
| Ga0255778_103973242 | 3300023084 | Salt Marsh | FNAIFEKYDKDKSAIVLINFLRHQQMVKIQSEMVA |
| Ga0255778_104312692 | 3300023084 | Salt Marsh | SGPCKGFNGVFDKYDADQSAIVLINFLRHQQRVKIKAEMIA |
| Ga0255774_100035151 | 3300023087 | Salt Marsh | IKSGPFKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIS |
| Ga0255774_100168307 | 3300023087 | Salt Marsh | FKDFNAIFEKYNEDKSAIVLINFLRHQQLVKIQSEMIA |
| Ga0255774_101183703 | 3300023087 | Salt Marsh | IKSGPFKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSEMIA |
| Ga0255774_101435061 | 3300023087 | Salt Marsh | FIKSGPLKGFNAIFEKYDKDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0255774_103808721 | 3300023087 | Salt Marsh | FNAIFEKYDKDKSAIVLINFVRHQQRVKIQSEMIA |
| Ga0255774_104237531 | 3300023087 | Salt Marsh | GFNAIFEKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0255782_101765561 | 3300023105 | Salt Marsh | IKSGPFKDFNGIFEKYDADKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0255743_102785613 | 3300023110 | Salt Marsh | VLIKSGPFKDFNAIFEKYDEDKSAIVLINFLRYQQRVKIQSEMIA |
| Ga0255760_100926581 | 3300023115 | Salt Marsh | GPFKGFNAIFEKYDKGKSAIVLINFLRHQQRVKVQSEMIA |
| Ga0255760_101134413 | 3300023115 | Salt Marsh | FNAIFEKYDEDKSAIVLINFLRHQQQVKIQPEMIA |
| Ga0255760_101755951 | 3300023115 | Salt Marsh | LIKSGPFKNFNAIFEKYDVDQSVIVLINFLRHQQRVKIQSEMIA |
| Ga0255760_103063321 | 3300023115 | Salt Marsh | FKDFNAIFEKYDKDKSAIVLINFLRHQQMVKIQSEMVA |
| Ga0255751_102493081 | 3300023116 | Salt Marsh | FIKSGPFKGFNGVFEKYDKDKSAIILINFLRHQQRVKIQSQMIA |
| Ga0255751_104347082 | 3300023116 | Salt Marsh | FKDFNGVFEKYDEDKSVIVLINFLRHQQRVKIQSEMIA |
| Ga0255757_102921101 | 3300023117 | Salt Marsh | FNGIFENYDADQSAIVLINFLRHQQRVKIQSEMIA |
| Ga0255762_101014211 | 3300023119 | Salt Marsh | DFNGIFEKYDVDKSAIVLINFLRHHQQVKVKLEAIS |
| Ga0255762_103303763 | 3300023119 | Salt Marsh | DFNAIVEKYEADQSVIVLINFLRYQQRVKIQSKVIA |
| Ga0255762_105004672 | 3300023119 | Salt Marsh | FKSFNGIFENYDADQSAIVLVNFLRHQQRVKIKAEMIG |
| Ga0255777_100632251 | 3300023175 | Salt Marsh | FNAIFEKYDEDKSAIVLINFLRHQQRVKIQSEMIA |
| Ga0255777_102626391 | 3300023175 | Salt Marsh | FKDFNAIFEKYDEDNSAIVLINFLRHLQRVKIQSEMIA |
| Ga0255777_105238423 | 3300023175 | Salt Marsh | KSGPFKDFNAIVEKYEADQSVIVLVNFLRYQQRVKIQSEMIA |
| Ga0255772_100397305 | 3300023176 | Salt Marsh | IKSGPFKDFNAIVEKYEADQSVIVLINFLRYQQRVKIQSKMIA |
| Ga0255772_100778773 | 3300023176 | Salt Marsh | KSGPFKDFNAIFRNYDADQSAIVLINFLRNKLQVRVKLDAIS |
| Ga0255768_105755551 | 3300023180 | Salt Marsh | EVFIKSGPFKDFNAIFEKYDADKSVIVLINFLRHQQRVKIQSEMIA |
| ⦗Top⦘ |