Metagenome Family F072899

Overview

Basic Information

• Family ID: F072899
• Family Type: Metagenome
• Number of Sequences: 120
• Average Sequence Length: 40 residues
• Representative Sequence: MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
• Number of Associated Samples: 20
• Number of Associated Scaffolds: 120

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Eukaryota
• % of genes with valid RBS motifs: 0.00 %
• % of genes near scaffold ends (potentially truncated): 45.00 %
• % of genes from short scaffolds (< 2000 bps): 57.50 %
• Associated GOLD sequencing projects: 20
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Eukaryota (62.500 % of family members)
• NCBI Taxonomy ID: 2759
• Taxonomy: All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (80.833 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Unclassified (80.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 53.03%
  β-sheet: 0.00%
  Coil/Unstructured: 46.97%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF07727	RVT_2	2.50
PF13912	zf-C2H2_6	1.67
PF14291	DUF4371	1.67
PF13855	LRR_8	1.67
PF08615	RNase_H2_suC	0.83
PF14476	Chloroplast_duf	0.83
PF00125	Histone	0.83
PF14223	Retrotran_gag_2	0.83
PF00069	Pkinase	0.83
PF12643	MazG-like	0.83
PF04525	LOR	0.83
PF04450	BSP	0.83
PF02826	2-Hacid_dh_C	0.83
PF13952	DUF4216	0.83
PF00665	rve	0.83
PF00078	RVT_1	0.83
PF00385	Chromo	0.83
PF02892	zf-BED	0.83
PF04844	Ovate	0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.33
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.83
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.83
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.83
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.83
COG4894	Putative phospholipid scramblase YxjI, Tubby2 superfamily	Lipid transport and metabolism [I]	0.83

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	64.17 %
Unclassified	root	N/A	35.83 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	64.17 %
Unclassified	root	N/A	35.83 %

Level 3

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	62.50 %
Unclassified	root	N/A	35.83 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.67 %

Level 4

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	62.50 %
Unclassified	root	N/A	35.83 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.83 %

Level 5

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	62.50 %
Unclassified	root	N/A	35.83 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.83 %

Level 6

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	60.83 %
Unclassified	root	N/A	35.83 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.83 %

Level 7

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	60.83 %
Unclassified	root	N/A	35.83 %
Lactobacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales	0.83 %

Level 8

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	50.83 %
Unclassified	root	N/A	35.83 %
Lactobacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae	0.83 %

Level 9

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	50.83 %
Unclassified	root	N/A	35.83 %
Weissella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella	0.83 %

Level 10

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	50.83 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 11

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	50.83 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 12

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 13

Name	Rank	Taxonomy	Distribution
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 14

Name	Rank	Taxonomy	Distribution
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 15

Name	Rank	Taxonomy	Distribution
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 16

Name	Rank	Taxonomy	Distribution
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 17

Name	Rank	Taxonomy	Distribution
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 18

Name	Rank	Taxonomy	Distribution
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 19

Name	Rank	Taxonomy	Distribution
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	45.00 %
Unclassified	root	N/A	35.83 %
Euphorbiaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae	2.50 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 20

Name	Rank	Taxonomy	Distribution
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	43.33 %
Unclassified	root	N/A	35.83 %
Crotonoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Crotonoideae	0.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 21

Name	Rank	Taxonomy	Distribution
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	40.83 %
Unclassified	root	N/A	35.83 %
Micrandreae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Crotonoideae → Micrandreae	0.83 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	0.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.83 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	35.00 %
Populus tomentosa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	1.67 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.83 %
Hevea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Crotonoideae → Micrandreae → Hevea	0.83 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.83 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	0.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.83 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	35.00 %
Populus tomentosa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	1.67 %
Hevea brasiliensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Crotonoideae → Micrandreae → Hevea → Hevea brasiliensis	0.83 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.83 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.83 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	0.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300028786|Ga0307517_10011778	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	12090
3300028786|Ga0307517_10012778	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	11483
3300028786|Ga0307517_10028782	Not Available	6601
3300028786|Ga0307517_10048907	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4339
3300028786|Ga0307517_10084502	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2670
3300028786|Ga0307517_10231765	Not Available	1107
3300028786|Ga0307517_10344657	Not Available	812
3300028786|Ga0307517_10459309	Not Available	657
3300028786|Ga0307517_10623432	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	528
3300028794|Ga0307515_10013568	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	15205
3300028794|Ga0307515_10027189	Not Available	9795
3300028794|Ga0307515_10045891	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	6696
3300028794|Ga0307515_10078803	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4325
3300028794|Ga0307515_10082230	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4169
3300028794|Ga0307515_10085092	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4051
3300028794|Ga0307515_10138823	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2621
3300028794|Ga0307515_10143802	Not Available	2540
3300028794|Ga0307515_10148087	Not Available	2472
3300028794|Ga0307515_10160747	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2292
3300028794|Ga0307515_10218365	Not Available	1731
3300028794|Ga0307515_10319118	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1221
3300028794|Ga0307515_10364062	Not Available	1085
3300028794|Ga0307515_10496415	Not Available	831
3300028794|Ga0307515_10532390	Not Available	784
3300030521|Ga0307511_10013971	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	7823
3300030521|Ga0307511_10056838	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3052
3300030521|Ga0307511_10074475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	2446
3300030521|Ga0307511_10116836	Not Available	1670
3300030521|Ga0307511_10128610	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1535
3300030521|Ga0307511_10149725	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1343
3300030521|Ga0307511_10152688	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1320
3300030521|Ga0307511_10171619	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1190
3300030521|Ga0307511_10269171	Not Available	799
3300030521|Ga0307511_10368292	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	607
3300030521|Ga0307511_10447211	Not Available	512
3300030522|Ga0307512_10273332	Not Available	816
3300030522|Ga0307512_10339002	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	671
3300030522|Ga0307512_10398123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	580
3300031456|Ga0307513_10025535	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6840
3300031456|Ga0307513_10087688	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	3184
3300031456|Ga0307513_10100986	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	2908
3300031456|Ga0307513_10121626	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2576
3300031456|Ga0307513_10179773	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1980
3300031456|Ga0307513_10197224	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1858
3300031456|Ga0307513_10211817	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1768
3300031456|Ga0307513_10220475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1718
3300031456|Ga0307513_10345035	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1238
3300031456|Ga0307513_10447196	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1017
3300031456|Ga0307513_10508342	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	921
3300031456|Ga0307513_10825230	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	633
3300031507|Ga0307509_10028943	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	6153
3300031507|Ga0307509_10150345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2245
3300031507|Ga0307509_10202402	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1820
3300031507|Ga0307509_10288410	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1397
3300031507|Ga0307509_10297530	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1364
3300031507|Ga0307509_10300006	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1355
3300031507|Ga0307509_10912828	Not Available	543
3300031507|Ga0307509_10945673	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	527
3300031616|Ga0307508_10066184	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3182
3300031616|Ga0307508_10119185	Not Available	2241
3300031616|Ga0307508_10245568	Not Available	1387
3300031616|Ga0307508_10260973	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1327
3300031616|Ga0307508_10279552	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	1262
3300031616|Ga0307508_10308573	Not Available	1174
3300031616|Ga0307508_10508851	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	799
3300031649|Ga0307514_10055872	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3032
3300031649|Ga0307514_10113553	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1911
3300031649|Ga0307514_10201197	Not Available	1251
3300031649|Ga0307514_10235826	Not Available	1102
3300031649|Ga0307514_10253304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1039
3300031649|Ga0307514_10253602	Not Available	1038
3300031649|Ga0307514_10282872	Not Available	947
3300031649|Ga0307514_10388161	Not Available	720
3300031649|Ga0307514_10429536	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	659
3300031649|Ga0307514_10443824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	641
3300031649|Ga0307514_10491897	Not Available	586
3300031649|Ga0307514_10523794	Not Available	555
3300031730|Ga0307516_10041489	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4573
3300031730|Ga0307516_10172342	Not Available	1903
3300031730|Ga0307516_10247740	Not Available	1477
3300031730|Ga0307516_10380286	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1073
3300031730|Ga0307516_10437089	Not Available	965
3300031730|Ga0307516_10556124	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	801
3300031730|Ga0307516_10681177	Not Available	684
3300031730|Ga0307516_10813537	Not Available	596
3300031730|Ga0307516_10928349	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	538
3300031838|Ga0307518_10046263	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3164
3300031838|Ga0307518_10324191	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	917
3300032354|Ga0325403_1000656	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	25792
3300032354|Ga0325403_1015719	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	7043
3300032354|Ga0325403_1023144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5517
3300032354|Ga0325403_1023530	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5454
3300032354|Ga0325403_1036669	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3892
3300032354|Ga0325403_1046853	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	3129
3300032354|Ga0325403_1048199	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Crotonoideae → Micrandreae → Hevea → Hevea brasiliensis	3041
3300032354|Ga0325403_1055117	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	2641
3300032354|Ga0325403_1061221	Not Available	2347
3300032355|Ga0325401_1064021	Not Available	2555
3300032374|Ga0325400_1276729	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	627
3300032389|Ga0325405_1000194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	57175
3300032389|Ga0325405_1001134	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	26785
3300032389|Ga0325405_1007080	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	11309
3300032389|Ga0325405_1020782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae	5717
3300032389|Ga0325405_1033973	Not Available	3789
3300032389|Ga0325405_1064006	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1817
3300032390|Ga0325404_1027486	Not Available	4614
3300032740|Ga0325411_1022165	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae	5713
3300032741|Ga0325414_1030617	Not Available	4581
3300033179|Ga0307507_10250351	Not Available	1145
3300033179|Ga0307507_10258364	Not Available	1115
3300033179|Ga0307507_10352154	Not Available	865
3300033179|Ga0307507_10471881	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	685
3300033179|Ga0307507_10633990	Not Available	545
3300033180|Ga0307510_10153834	Not Available	1911
3300033180|Ga0307510_10183025	Not Available	1655
3300033180|Ga0307510_10556092	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	594
3300034389|Ga0325419_000368	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	47486
3300034389|Ga0325419_009291	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10402
3300034389|Ga0325419_009474	All Organisms → cellular organisms → Bacteria	10269

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	80.83%
Wood	Host-Associated → Plants → Wood	15.83%
Phylloplane	Host-Associated → Plants → Phylloplane	3.33%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	80.83%
Unclassified	Host-Associated → Plants → Wood → Unclassified	15.83%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	3.33%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	80.83%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	15.83%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	3.33%

Habitat

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	80.83%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	15.83%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	3.33%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated
3300032740	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4	Host-Associated
3300032741	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3	Host-Associated
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_100117781	3300028786	Ectomycorrhiza	MTFQSVGDFVCKEHQLTVQLGSEQFQSSLENTNGIFRW
Ga0307517_100127784	3300028786	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307517_100287825	3300028786	Ectomycorrhiza	MTFQSVTDFVRKEQQLTMQLESEQFWSSLENTDGKFRR
Ga0307517_100489071	3300028786	Ectomycorrhiza	MTFQSVGDFIRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307517_100845021	3300028786	Ectomycorrhiza	MIFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRW
Ga0307517_102317651	3300028786	Ectomycorrhiza	MTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFCDDEQCS
Ga0307517_103446571	3300028786	Ectomycorrhiza	APTTFQSVSDFIHKEQQLTVQLEGEQFWSSLENTDGKFCW
Ga0307517_104593091	3300028786	Ectomycorrhiza	LNFSENRQITPTTFQSVGDFVRKEQQLTAQLEGEQFWSSLENTDGKFRR
Ga0307517_106234321	3300028786	Ectomycorrhiza	NRQITPTTFQSVGDFVRKEQKLTVQLKSEQFWSSLENTDGNFRL
Ga0307515_100135684	3300028794	Ectomycorrhiza	MTFQSVGDFVRKEQQLTMQLESEQFWCSLENTDGKFRR
Ga0307515_1002718914	3300028794	Ectomycorrhiza	MTFQSVTDFVRKEQQLTMQLESEQFWSSLENTDGKFRQ
Ga0307515_100458913	3300028794	Ectomycorrhiza	MTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFRR
Ga0307515_100788034	3300028794	Ectomycorrhiza	GDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307515_100822301	3300028794	Ectomycorrhiza	DFSIRGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307515_100850921	3300028794	Ectomycorrhiza	TTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDRNFRR
Ga0307515_101388232	3300028794	Ectomycorrhiza	MHFQSVGDFIRKEQQLTVQLESEQFWSSLKNTDGKFRR
Ga0307515_101438021	3300028794	Ectomycorrhiza	MTSQSVGDFVRKEQQLTVQLKSEQFWSSLENTNGFFRQ
Ga0307515_101480871	3300028794	Ectomycorrhiza	MTFQSVTDFVRKEQQLTMQLESEQFWSSLKNTDGKFRR
Ga0307515_101607471	3300028794	Ectomycorrhiza	MTFQSVGDFVRKEQKLTVQLEGEQFWSSLENTDRKFRS
Ga0307515_102183651	3300028794	Ectomycorrhiza	MTFQSVGDFVHKEQQLTVQLESEEFWSSLEKTDRKFFR
Ga0307515_103191181	3300028794	Ectomycorrhiza	ENRQITPTTFQSVSDFVRKEQQLTVQLESEQFWSSLENTDGIFHRLFLL
Ga0307515_103640621	3300028794	Ectomycorrhiza	MNFQSVGDFVSKEQQLTVQLEGEQFWSSLENTDEKFRR
Ga0307515_104964151	3300028794	Ectomycorrhiza	CQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSMENTDGQFRR
Ga0307515_105323901	3300028794	Ectomycorrhiza	LNFLENRQITPTTFQSVGDFVRKEQQLTAQLEGEQFWSSLENTDGKFRR
Ga0307511_100139711	3300030521	Ectomycorrhiza	MNFQSVGDFVCKEQQLTVQLESEQFWSSLENIDGKFRR
Ga0307511_100568384	3300030521	Ectomycorrhiza	TPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307511_100744753	3300030521	Ectomycorrhiza	MTFQSVGDFVRKEQKLTVQLESEQFWSSLENTDGNFRR
Ga0307511_101168361	3300030521	Ectomycorrhiza	MHFQSVCDFVRKEQQLTVQLESKQFWSSLKNIDGKFRR
Ga0307511_101286101	3300030521	Ectomycorrhiza	TPTTFQSVGDFIRKEQQLTVQLESEQFWSSLENTDGKFCR
Ga0307511_101497251	3300030521	Ectomycorrhiza	MNFQSVSDFVRKEQQLTVQLEGEQFWSSLENTDGKFRR
Ga0307511_101526882	3300030521	Ectomycorrhiza	CQITPTTFQSVSDFVRKEQQLTVQLESEQFWSFLENTDGKFRQ
Ga0307511_101716193	3300030521	Ectomycorrhiza	WIFSENCQITPTTFQSVGDFIRKEQQLTVQLESEQFWSSLENADGIVRR
Ga0307511_102691711	3300030521	Ectomycorrhiza	SENRQITPMTFQSVGDFVRKEQQLTVQLESEQFWSSLDNTDGKFRW
Ga0307511_103682921	3300030521	Ectomycorrhiza	FQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307511_104141742	3300030521	Ectomycorrhiza	SENIQITPTTFQSLGDFVRKEQQLTVQLESEQFWSPLENTDRNSVGDSLCN
Ga0307511_104472112	3300030521	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307512_102733322	3300030522	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENSIGNY
Ga0307512_103390021	3300030522	Ectomycorrhiza	MTFQSVGNFVRKEQQLTVQLESKQFWSSLENTDGKFRR
Ga0307512_103981231	3300030522	Ectomycorrhiza	TPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFCR
Ga0307513_100255351	3300031456	Ectomycorrhiza	IFSENRQITPTTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307513_100876881	3300031456	Ectomycorrhiza	IFSENHQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307513_101009861	3300031456	Ectomycorrhiza	MTFQSVGDFVCKEKQLIVQLESEQFWSSLGNTDGQFRR
Ga0307513_101216262	3300031456	Ectomycorrhiza	MTFQSVGDFVCKEQQLTVQLESEQFWSSLKNTDGNFRR
Ga0307513_101797731	3300031456	Ectomycorrhiza	MIFQSVGDFVRKEQQLIVQLESEQFWSSLENTNRKFRR
Ga0307513_101972242	3300031456	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEHFWSSLENTDRKFRR
Ga0307513_102118171	3300031456	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFCR
Ga0307513_102204752	3300031456	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGIFRR
Ga0307513_103450351	3300031456	Ectomycorrhiza	TTFQSVGDFVCKEQQLTVQLESEQFWSSLENTDGNFRR
Ga0307513_104471961	3300031456	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDEKFRR
Ga0307513_105083421	3300031456	Ectomycorrhiza	MTFQSVGDFVRKEQKLTVQFESEQFWSSLENTDGNFRR
Ga0307513_108252301	3300031456	Ectomycorrhiza	NRQITPTTFQSVRDFVRKEQQFIVQLESEQFWSSLENTDGIFLR
Ga0307509_100289433	3300031507	Ectomycorrhiza	HQITPTTFQSVGDFIRKEQQLTVQLKSEQFWSSLENTDGKFPL
Ga0307509_101503451	3300031507	Ectomycorrhiza	QSVGDFVRKEQQLTVQLESEQFWSSLENTDRNFRR
Ga0307509_102024021	3300031507	Ectomycorrhiza	TPTTFQSVSDFVRKEQQLTVQLESEQFWSSLENTDGIFHRLFLL
Ga0307509_102884101	3300031507	Ectomycorrhiza	TFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307509_102975301	3300031507	Ectomycorrhiza	IFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDKNFHR
Ga0307509_103000062	3300031507	Ectomycorrhiza	MKILNQLNFFRNRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307509_109128281	3300031507	Ectomycorrhiza	ENRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDRKFRR
Ga0307509_109456731	3300031507	Ectomycorrhiza	LNFLENRQITPTTFQSVGDFVRKEQQLTAQLEGEQFWSSLENTDRKFRR
Ga0307508_100661843	3300031616	Ectomycorrhiza	ITPMTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307508_101191851	3300031616	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESKQFWSSLENTDGKFRW
Ga0307508_102455682	3300031616	Ectomycorrhiza	MNFQSVGGFVHKEQQLTVQLKSEQFWSSLENTDGIFRW
Ga0307508_102609731	3300031616	Ectomycorrhiza	KTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDRKFRR
Ga0307508_102795523	3300031616	Ectomycorrhiza	SENRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307508_103085731	3300031616	Ectomycorrhiza	ITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGF
Ga0307508_105088511	3300031616	Ectomycorrhiza	MIFQSVGDFVRKEQQLIVQLESEQFWSSLENTDGKFRW
Ga0307514_100558724	3300031649	Ectomycorrhiza	RQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKLRR
Ga0307514_101135532	3300031649	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESKQLWSSLENTDGKFRR
Ga0307514_102011971	3300031649	Ectomycorrhiza	ENRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307514_102358261	3300031649	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGIFRR
Ga0307514_102533041	3300031649	Ectomycorrhiza	RQITPTTFQSVGDFIRKEQQLTVQLESEQFWSSLENADGIVRR
Ga0307514_102536021	3300031649	Ectomycorrhiza	MTFQSVGDFVRKEQKLTVQLEGEQFWSSLENTDRKFRR
Ga0307514_102828722	3300031649	Ectomycorrhiza	TFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307514_103881611	3300031649	Ectomycorrhiza	MKILNQLNFFRNCQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSMENTDGQFR
Ga0307514_104295361	3300031649	Ectomycorrhiza	TFQSVGDFVRKEQQLIVQLESEQFWSSLENTDKKFRR
Ga0307514_104438241	3300031649	Ectomycorrhiza	TFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGNFRR
Ga0307514_104918971	3300031649	Ectomycorrhiza	TFQPVGDFVRKGQQLTMQLKSEQFLSSLKNTDGIFRR
Ga0307514_105237941	3300031649	Ectomycorrhiza	LNEKFKLIDFFSENRQITPMTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFRR
Ga0307516_100414892	3300031730	Ectomycorrhiza	MTFQSVGDFVRKEQKLTVQLEGEQFWSSLENTDRKFHR
Ga0307516_101723422	3300031730	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLKSEQFLSSLENTDGIFCR
Ga0307516_102477401	3300031730	Ectomycorrhiza	MTFQSVGDFFRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307516_103802861	3300031730	Ectomycorrhiza	SENRQITPTTFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGNFRR
Ga0307516_104370891	3300031730	Ectomycorrhiza	MSFQSVSDFVRKEKQLTVQLESEQFWSSLENTDGIFRR
Ga0307516_105561241	3300031730	Ectomycorrhiza	FKNRQQLPTIFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDKNFHR
Ga0307516_106811771	3300031730	Ectomycorrhiza	TFQSVGDFVRKEQKLTVQLKSEQFWSSLENTDGNFCL
Ga0307516_108135371	3300031730	Ectomycorrhiza	ITPTTFQSVSDFVRKEQQLTVQLESEQFWSSLENTDRQFRR
Ga0307516_109283491	3300031730	Ectomycorrhiza	FFSENRQITPMTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFRR
Ga0307518_100462633	3300031838	Ectomycorrhiza	MTFQSVGDFVCKEQQLIVQLESEQFWSSLENTDRNFRR
Ga0307518_103241911	3300031838	Ectomycorrhiza	MIFQSVGDFVRKEQQLIVQLESELFWSSLENTDGKFRW
Ga0325403_10006568	3300032354	Xylem	MTFQSVSIFIRKEQQLTMQLESEQFWSSLENTGGKFRW
Ga0325403_10157194	3300032354	Xylem	MTFQPIGDFIRKEQQLIVQLESEQFWSSLENTDGIFRR
Ga0325403_10231445	3300032354	Xylem	MTFQSVGDFFRKEQQLTVQLESEQFWSSLENIDGKFRR
Ga0325403_10235304	3300032354	Xylem	MTFQSVGDFVCKEQQLTVQLKSEQFWSSLENTDGKFRR
Ga0325403_10366694	3300032354	Xylem	MTFQSVGDFVRKEQQLTVQLESKQFWSSLENTDRKFRR
Ga0325403_10468531	3300032354	Xylem	MTFQSVGDFVRKEQQLTLQLESEQFWSSLKNTDEKFHR
Ga0325403_10481993	3300032354	Xylem	MTFQSVGDFVRKEQQLTVQLEGEQFWSSLENTDGKFRR
Ga0325403_10551171	3300032354	Xylem	MNFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGF
Ga0325403_10612213	3300032354	Xylem	MTFQFVGDFVHKEQQLTVQLKSKQFWSSLEKTDGIFHR
Ga0325401_10640211	3300032355	Xylem	MTFQSVGDFVRKEQQLTMQLESEQFWSSLENIDGKFCR
Ga0325400_12767291	3300032374	Xylem	MTFQSVDDFVRQEQQLTVQLENEQFWSSLENTDGKFRR
Ga0325405_100019446	3300032389	Xylem	MAFQSVGDFFRKEQQLIVQLESEQFWSSLENIDGKFRR
Ga0325405_100113421	3300032389	Xylem	MTFQSVGDFVRKEQQLTLQLESEQFWSSLKNTDGKFHR
Ga0325405_10070806	3300032389	Xylem	MIFQSVGDFVRKEQQLTVQLESEQFWSSLENIERKFRQ
Ga0325405_10207824	3300032389	Xylem	MTFQSVGDFVCKEQQLIVQLKSKQFWSSLENTDGKFRR
Ga0325405_10339733	3300032389	Xylem	MTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDGKFRK
Ga0325405_10640062	3300032389	Xylem	MTFQSVSDFIRKEQQLTLQVESEQFWSSLENTDRKFRRCFPL
Ga0325404_10274861	3300032390	Xylem	MTFQSVGDFVRKEQQLTMQLESEQFWSSLENIDGKFCL
Ga0325411_10221654	3300032740	Xylem	MTFQSVGDFVRKEQQLTVQLKSKQFWSSLENTDGKFRR
Ga0325414_10306174	3300032741	Leaf	MTFQSVDDFVHQEQQLTVQLENEQFWSSLENTDGKFRR
Ga0307507_102503511	3300033179	Ectomycorrhiza	RRLFNPSIFFRKEQQLTVQLESEQFWISLENTSGKFRR
Ga0307507_102583642	3300033179	Ectomycorrhiza	MTPTAFQSVGDFVRKEQQLTVQLEGEQFWSSLENTDGNFRR
Ga0307507_103521541	3300033179	Ectomycorrhiza	TTFQSVGDFVRKEQQLTVQLESEQFWSSLKNSDGKFRQIYRRTLPTE
Ga0307507_104718811	3300033179	Ectomycorrhiza	ITPTTVKSVGDFVHKEQQLIVQLESERFWSSLKNTDGKFRR
Ga0307507_106339901	3300033179	Ectomycorrhiza	MFSENRQITPTTFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGQFRR
Ga0307510_101538342	3300033180	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQLWSSMENIYGKFRR
Ga0307510_101830252	3300033180	Ectomycorrhiza	MTFQSVGDFVCKEQKLTVQLESEQFWSSLENTDGNF
Ga0307510_105560921	3300033180	Ectomycorrhiza	SENRQITSTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDRNFHR
Ga0325419_000368_23004_23120	3300034389	Leaf	MTFQSVSDFVRKEQELTVQLKSEQFWSSLENTDGKFRR
Ga0325419_009291_1267_1383	3300034389	Leaf	MTFQSIGDFVRKEQQLTVQLESEQFWSSLENTNGIFHR
Ga0325419_009474_8312_8428	3300034389	Leaf	MTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDGKFHQ