NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F072873

Metagenome Family F072873

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072873
Family Type Metagenome
Number of Sequences 121
Average Sequence Length 45 residues
Representative Sequence MISTFLFMATMVVTGIPTAILFIPWCWLTGNVLPLYKGTRFMLSSSC
Number of Associated Samples 101
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 77.69 %
% of genes near scaffold ends (potentially truncated) 99.17 %
% of genes from short scaffolds (< 2000 bps) 80.17 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.347 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(22.314 % of family members)
Environment Ontology (ENVO) Unclassified
(52.893 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.364 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.33%    β-sheet: 0.00%    Coil/Unstructured: 46.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF02875Mur_ligase_C 30.58
PF08245Mur_ligase_M 23.97
PF01678DAP_epimerase 17.36
PF02016Peptidase_S66 4.96
PF00294PfkB 1.65
PF02308MgtC 1.65
PF01048PNP_UDP_1 1.65
PF01161PBP 0.83
PF13231PMT_2 0.83
PF05598DUF772 0.83
PF13469Sulfotransfer_3 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG0253Diaminopimelate epimeraseAmino acid transport and metabolism [E] 17.36
COG1619Muramoyltetrapeptide carboxypeptidase LdcA (peptidoglycan recycling)Cell wall/membrane/envelope biogenesis [M] 4.96
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 1.65
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 1.65
COG1285Magnesium uptake protein YhiD/SapB, involved in acid resistanceInorganic ion transport and metabolism [P] 1.65
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 1.65
COG3174Membrane component of predicted Mg2+ transport system, contains DUF4010 domainInorganic ion transport and metabolism [P] 1.65
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.35 %
UnclassifiedrootN/A1.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001401|JGI20189J14885_1004252All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2722Open in IMG/M
3300005591|Ga0070761_10575539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae699Open in IMG/M
3300009518|Ga0116128_1164807All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300009615|Ga0116103_1049489All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300009632|Ga0116102_1063174All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300009645|Ga0116106_1257633All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300009646|Ga0116132_1059211All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300009665|Ga0116135_1006519All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis4442Open in IMG/M
3300014152|Ga0181533_1291165All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300014153|Ga0181527_1147033All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300014153|Ga0181527_1377488All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300014155|Ga0181524_10028278All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus3929Open in IMG/M
3300014155|Ga0181524_10061077All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus2308Open in IMG/M
3300014158|Ga0181521_10578714All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300014159|Ga0181530_10395769All Organisms → cellular organisms → Bacteria → Acidobacteria704Open in IMG/M
3300014160|Ga0181517_10582966All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300014161|Ga0181529_10135340All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus1519Open in IMG/M
3300014164|Ga0181532_10070154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus2248Open in IMG/M
3300014168|Ga0181534_10460258All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300014199|Ga0181535_10092352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1962Open in IMG/M
3300014199|Ga0181535_10135017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1560Open in IMG/M
3300014200|Ga0181526_10840268All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300014201|Ga0181537_11181057All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300014489|Ga0182018_10516446All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300014491|Ga0182014_10508161All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300014491|Ga0182014_10655201All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300014493|Ga0182016_10324416All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300014495|Ga0182015_10400951All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300014496|Ga0182011_10648321All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300014499|Ga0182012_10043343All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus3695Open in IMG/M
3300014838|Ga0182030_11688671All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300014839|Ga0182027_10959070All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300014839|Ga0182027_11336355All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300014839|Ga0182027_11673093All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300014839|Ga0182027_12062264All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300017935|Ga0187848_10391612All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300017988|Ga0181520_10029865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00685763Open in IMG/M
3300017988|Ga0181520_11124817All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300017988|Ga0181520_11151256All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300018004|Ga0187865_1138811All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300018014|Ga0187860_1353758All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300018023|Ga0187889_10525882All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300018024|Ga0187881_10219585All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300018026|Ga0187857_10449013All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300018043|Ga0187887_10033526All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00683220Open in IMG/M
3300018044|Ga0187890_10263619All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300018044|Ga0187890_10657782All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300018057|Ga0187858_10331182All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300018057|Ga0187858_10404630All Organisms → cellular organisms → Bacteria → Acidobacteria847Open in IMG/M
3300018085|Ga0187772_10309484All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300019787|Ga0182031_1314085All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1989Open in IMG/M
3300021405|Ga0210387_11087654All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300022872|Ga0224526_1066533All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300022872|Ga0224526_1066739All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300023075|Ga0224520_1067028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica813Open in IMG/M
3300023090|Ga0224558_1102981All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300023091|Ga0224559_1082149All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300023254|Ga0224524_1074101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S190605Open in IMG/M
3300023258|Ga0224535_1011102All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2197Open in IMG/M
3300024233|Ga0224521_1032219All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica1197Open in IMG/M
3300024295|Ga0224556_1178865All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300025406|Ga0208035_1033646All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300025506|Ga0208937_1073936All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300025612|Ga0208691_1106102All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica633Open in IMG/M
3300026041|Ga0207639_11284273All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300026456|Ga0255351_1056942All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300027019|Ga0207857_1017614All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300028068|Ga0255355_1039034All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300028090|Ga0255349_1000804All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae13257Open in IMG/M
3300028562|Ga0302151_10110345All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300028574|Ga0302153_10256247All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300028745|Ga0302267_10479855All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300028779|Ga0302266_10019080All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3641Open in IMG/M
3300028813|Ga0302157_10450078All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300028868|Ga0302163_10171987All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300028873|Ga0302197_10030820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3305Open in IMG/M
3300028874|Ga0302155_10503467All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300029907|Ga0311329_10677689All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300029911|Ga0311361_11097894All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300029915|Ga0311358_10126179All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2524Open in IMG/M
3300029916|Ga0302148_1121823All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300029917|Ga0311326_10051129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2398Open in IMG/M
3300029917|Ga0311326_10635229All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300029918|Ga0302143_1051448All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300029919|Ga0302141_1155941All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300029920|Ga0302142_1118134All Organisms → cellular organisms → Bacteria → Acidobacteria818Open in IMG/M
3300029922|Ga0311363_10042158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00687296Open in IMG/M
3300029945|Ga0311330_10713540All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300029952|Ga0311346_10410569All Organisms → cellular organisms → Bacteria1308Open in IMG/M
3300029953|Ga0311343_10945801All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300029955|Ga0311342_10250713All Organisms → cellular organisms → Bacteria1654Open in IMG/M
3300030014|Ga0302175_10062670All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300030020|Ga0311344_10118844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2940Open in IMG/M
3300030020|Ga0311344_11443136All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300030044|Ga0302281_10263476All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300030507|Ga0302192_10212454All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300030518|Ga0302275_10584708All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300030519|Ga0302193_10204516Not Available1100Open in IMG/M
3300030519|Ga0302193_10446670All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300030838|Ga0311335_10017210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis4359Open in IMG/M
3300031232|Ga0302323_100454035All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300031232|Ga0302323_101095970All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300031235|Ga0265330_10175890All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300031241|Ga0265325_10091199Not Available1502Open in IMG/M
3300031259|Ga0302187_10438455All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300032665|Ga0316221_1031886All Organisms → cellular organisms → Bacteria2322Open in IMG/M
3300032722|Ga0316231_1019162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00684365Open in IMG/M
3300032753|Ga0316224_1216287All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300032805|Ga0335078_10077898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis4834Open in IMG/M
3300032805|Ga0335078_12123841All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300032828|Ga0335080_11550835All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300033402|Ga0326728_10131560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium2813Open in IMG/M
3300033405|Ga0326727_10655112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae855Open in IMG/M
3300033755|Ga0371489_0069405All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis2210Open in IMG/M
3300033755|Ga0371489_0444073All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300033818|Ga0334804_007037All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00684846Open in IMG/M
3300033818|Ga0334804_050593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1209Open in IMG/M
3300033818|Ga0334804_084807All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300033982|Ga0371487_0019558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis4713Open in IMG/M
3300033983|Ga0371488_0392331All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300034091|Ga0326724_0338980All Organisms → cellular organisms → Bacteria820Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog22.31%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog14.88%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil12.40%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.09%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland7.44%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.79%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil5.79%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog4.96%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen4.13%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater2.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.48%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.65%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001401Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300022872Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25EnvironmentalOpen in IMG/M
3300023075Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023254Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T75EnvironmentalOpen in IMG/M
3300023258Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34EnvironmentalOpen in IMG/M
3300024233Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025406Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026456Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2EnvironmentalOpen in IMG/M
3300027019Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 22 (SPAdes)EnvironmentalOpen in IMG/M
3300028068Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T75EnvironmentalOpen in IMG/M
3300028090Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v15EnvironmentalOpen in IMG/M
3300028562Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029916Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1EnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300029919Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2EnvironmentalOpen in IMG/M
3300029920Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030014Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300032665Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007EnvironmentalOpen in IMG/M
3300032722Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027EnvironmentalOpen in IMG/M
3300032753Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20189J14885_100425253300001401Arctic Peat SoilMIRTIIFVTNMVVLGIPSALLFIPWCWITGNVLPLYKATRFMLFSSCRLAG
Ga0070761_1057553913300005591SoilMIRSLLFLANMIIWGIPSALLFIPWCWLTGNVLPLYKATRFILSS
Ga0116128_116480713300009518PeatlandMIFYLIFMTTMVVTGIPTAILFIPWCWLTGNVLPLYKGTRFMLHSSCWM
Ga0116103_104948923300009615PeatlandMIWSLIFITSMVLTGIPTALLFIPWCWLTGNVLPLYKATRFMLSSSCRL
Ga0116102_106317423300009632PeatlandMIRSLLFLANMVIWGIPSAILFIPWCWLTGDVLPLY
Ga0116106_125763313300009645PeatlandMLRSLLFLANMVILSIPSAILFIPWCWLTGNVLPLYKATR
Ga0116132_105921113300009646PeatlandMIASFIFIATMVVTGIPTAILFIPWCWLTGNVLPLYKGTRF
Ga0116135_100651953300009665PeatlandMIRSLLFLANMVFWGIPSALLFIPWCWVTGDVLPLYK
Ga0181533_129116513300014152BogMIWSLIFIANMVLLGIPSALLFIPWCWMTGNVLPLYK
Ga0181527_114703313300014153BogMIWSLIFLANMVVLGIPSACLFIPWCWMTGNVLPLYKATRF
Ga0181527_137748813300014153BogMFFYLIFMATMVITGIPTAMLFIPWCWLTGNVLPLYKGTR
Ga0181524_1002827863300014155BogMIWSLIFLANMVVLGIPSACLFIPWCWMTGNVLPLY
Ga0181524_1006107713300014155BogVISSFIFMATMVITGIPTAMLFIPWCWLTGNVLPLYKGTRFML
Ga0181521_1057871413300014158BogMIWSLLFLANMIVTGIPTALLFIPWCWLTGDVLPLYKGTRFMLSSSC
Ga0181530_1039576913300014159BogMIFYLIFMATMVVTGIPTAILFIPWCAFTGNVLPLYKGTRFMLHSSCWMA
Ga0181517_1058296623300014160BogMISSFIFMATMVITGIPTALLFIPWCWLTGNVLPLYKGTRFMLH
Ga0181529_1013534013300014161BogMISTFLFMATMVVTGIPTAILFIPWCWLTGNVLPL
Ga0181532_1007015433300014164BogMVVLGIPSAILFIPWCWITGNVMPLYKATRFMLYSSCRFAGVRFQVAGRDRIP
Ga0181534_1046025813300014168BogMLSSLIFVATMVVTGIPTALLFIPWCWLTGNVLPLYRGTRFMLSSGCW
Ga0181535_1009235213300014199BogMISTFLFMATMVVTGIPTAILFIPWCWLTGNVLPLYKGTRFMLSSSC
Ga0181535_1013501713300014199BogMISTFLFMATMVVTGIPTAILFIPWCWLTGDVLPLYKGTRFMLSSSCWMAGV
Ga0181526_1084026813300014200BogLIHSLIFIVNMFVLGIPTALFFIPWCWLTGDVGPLYRGTRFMLWSS
Ga0181537_1118105723300014201BogMIRSLLFLANMVFWGIPSGLLFIPWCWLTGNVRPLYK
Ga0182018_1051644623300014489PalsaMISTFLFMATMVITGIPTAMLFIPWCCLTGNVLPL
Ga0182014_1050816123300014491BogMIFYLIFMATMVVTGIPTAILFIPWCALTGNVLPLYKGTRFMLSSSCWMAGVRFHVEGR
Ga0182014_1065520123300014491BogMISTFVFMTTMVILGIPSAILFIPWCAITGNVLPLYKATRFMLSS
Ga0182016_1032441613300014493BogMLSSLIFIATMIVTGIPTALLFIPWCWMTGNVMPLY
Ga0182015_1040095123300014495PalsaMIRTFLFLANMVFWGIPSGLLFIPWCWITGNVLPL
Ga0182011_1064832123300014496FenMIYSLLFMATMVITGIPTAILFIPWCALTGNVLPLYKGTRFMLSSSCWMAGVRF
Ga0182012_1004334313300014499BogMMASFLFIVTMVVTGIPTAVLFIPWCWLTGNVLPLYKSTRFM
Ga0182030_1168867123300014838BogMIFYLIFMATMVVTGIPTAILFIPWCALTGNVLPLYKGTR
Ga0182027_1095907023300014839FenMLSSLIFIATMIVTGIPTALLFIPWCWMTGNVMPLYRGTRF
Ga0182027_1133635523300014839FenMFFYLIFMATMVVTGIPTAILFIPWCAITGNVLPLYKGTRFMLSSSCWMAGVRFHVTGKENI
Ga0182027_1167309323300014839FenMIFFLIFMATMVVTGIPTAILFIPWCALTGDVLPLYKGTRFMLSSSCWMAGVRF
Ga0182027_1206226413300014839FenMIFFLIFMATMVVTGIPTALLFIPWCALTGDVLPLYKGTRFMLATS*
Ga0187848_1039161213300017935PeatlandVISSFIFMATMVITGIPTAMLFIPWCWLTGNVLPLYKGTRFMLSSSCWMAGVRFHVTGLE
Ga0181520_1002986513300017988BogMIYSLIFMATMVITGIPTALLFIPWCWLTGNVMPLYKGTRFMLSSSCWM
Ga0181520_1112481713300017988BogMLSSLIFIATMIVTGIPTALLFIPWCWMTGNVMPLYRGTRFMLS
Ga0181520_1115125613300017988BogMLSSLIFITTMVVLGIPTAILFIPWCWMSGNVLPLYKGTRFMLASSC
Ga0187865_113881123300018004PeatlandMISSPIYMATMVITGNPTATLFIPWCWLTSNVRPLYKGTRFMLSSSFWMAGVRFHV
Ga0187860_135375813300018014PeatlandMIWSLIFITDMVVLGIPSALLFIPWCWITGNVLPLYKATRFMLSSSCR
Ga0187889_1052588223300018023PeatlandMIFYLIFMTTMVVTGIPTAILFIPWCWLTGNVLPLYK
Ga0187881_1021958523300018024PeatlandMIWSLIFIANMFVLGIPSALLFIPWCWITGNVMPLYKATRFMLYS
Ga0187857_1044901323300018026PeatlandMFFYLIFMATMVITGIPTAILFIPWCALTGNVLPLYKGTRFMLSSSCWMAGVRF
Ga0187887_1003352613300018043PeatlandMISTFLFMATMVVTGIPTAILFIPWCWLTGDVLPLYKGTRFMLSSSCWMA
Ga0187890_1026361923300018044PeatlandMIPFFIFMATMVVTGIPTAILFIPWCWLTGNVLPLYKGTRFMLSSSCWMAGVRFHV
Ga0187890_1065778223300018044PeatlandMISSFIFMATMVITGIPTAILFIPWCWLTGNVLPLYKGTRFMLSSSCWMSGVRFHT
Ga0187858_1033118223300018057PeatlandVISSFIFMATMVITGIPTAMLFIPWCWLTGNVLPLYKGTR
Ga0187858_1040463023300018057PeatlandMIFYLIFMTTMVVTGIPTAILFIPWCWLTGNVLPLY
Ga0187772_1030948413300018085Tropical PeatlandMIWTLIFIANMVILGIPSALLFIPWCWMTGNVLPLYK
Ga0182031_131408513300019787BogMIASLLFMATMIVTGIPTAVLFIPWCWLTGNVLPLYKGTRFMLSSSCWM
Ga0210387_1108765413300021405SoilMIRTIIFVANMVVLGIPSALLFIPWCWLTGNVLPLYKATR
Ga0224526_106653323300022872SoilMLFSLIFVATMVVTGIPTALLFIPWCWLTGNVLPLQRP
Ga0224526_106673923300022872SoilMISSLIFITTMVLTGIPTAILFIPWCWLTGNVLPLYKGTRFMLSS
Ga0224520_106702823300023075SoilMIYTFIFMATMVITGIPTAVLFIPWCWLTGNVLPLYKGTRFMLFS
Ga0224558_110298123300023090SoilMIWSLIFITNMIVLGIPSALLFIPWCWITGDVLPLYRATRFML
Ga0224559_108214923300023091SoilMIFFLIFMATMVVTGIPTALLFIPWCALTGNVLPLYKGTRFMLATSCW
Ga0224524_107410123300023254SoilMIYTFIFMATMVITGIPTAVLFIPWCWLTGNVLPLYKGTRFMLFSSCWMSGVRFHVT
Ga0224535_101110213300023258SoilMFFYFLFMATMVVTGIPTAILFIPWCWLTGNVLPLY
Ga0224521_103221933300024233SoilMIYTFIFMATMVITGIPTAVLFIPWCWLTGNVLPLYK
Ga0224556_117886523300024295SoilMIRSLLFLANMVFWGIPSALLFIPWCWLTGNVLPLYKAT
Ga0208035_103364613300025406PeatlandMIWSLIFITNMVVLGIPSALLFIPWCWITGNVLPLY
Ga0208937_107393623300025506PeatlandMIASFIFIATMVVTGIPTAILFIPWCWLTGNVLPLYKGTRFMLSSSCWMAGVRFRTV
Ga0208691_110610213300025612PeatlandMIPFFIFMATMVITGIPTAVLFIPWCWLTGNVLPLYKGTRFMLSSSCRL
Ga0207639_1128427313300026041Corn RhizosphereMLASLIFISTMIVLGIPTAVLFIPWCWLTGDVMPLY
Ga0255351_105694213300026456SoilMISSLIFIATMIVTGIPTALLFIPWCWLTGNVLPLYKGTRFMLSSSCRL
Ga0207857_101761413300027019Tropical Forest SoilMLASLIFITNMIVTGIPTAVLFIPWCWMTGNVLPLYKGTRFMLSSSCRL
Ga0255355_103903413300028068SoilMIRSLLFLANMIVTGIPSALLFIPWCWITGNVLPLYKATRFMLSSSCRVAL
Ga0255349_1000804143300028090SoilMIPFLIFMATMVVTGIPTAILFIPWCALTGNVLPLYKGTRFMLSSS
Ga0302151_1011034513300028562BogMFSAFLFMATMVVTGIPTALLFIPWAWLTGNAWPLYRGTRFMLAS
Ga0302153_1025624723300028574BogMLHTLIFLATMVVTGVPTALLFIPWCWMTGNVLPLYKGTRF
Ga0302267_1047985523300028745BogMISSFIFIATMIVTGIPTATLFIPWCWITGNVLPLYKGTRFMLA
Ga0302266_1001908053300028779BogMLHSLIFLATMVATGIPTAVLFIPWCWMTGNVLPLY
Ga0302157_1045007823300028813BogMIASLIFLATMVVTGIPTAVLFIPWAWVTGNANPLYK
Ga0302163_1017198723300028868FenMLSSLIFMATMVVTGIPTALLFIPWCWLSGNVLPLYKGTRFMLSSSC
Ga0302197_1003082043300028873BogMLFSLIFVATMVVTGIPTALLFIPWCWLTGNVLPLYK
Ga0302155_1050346713300028874BogMLSSLVFIATMVVTGIPTALLFIPWCWLTGNVLPLYKGTRFML
Ga0311329_1067768923300029907BogMLFSLIFVATMVVTGIPTALLFIPWCWLTGNVLPLYKGTRF
Ga0311361_1109789413300029911BogMLSSFLFIATMVVTGIPTAILFIPWCWLTGNVMPLYRGTRFMLASSCWMAG
Ga0311358_1012617913300029915BogMISTFVFMTTMVILGIPSAILFIPWCAITGNVLPLYKATRFMLS
Ga0302148_112182313300029916BogMIFFLLFMATMVVTGIPTALLFIPWCALTGNVLPLYKGTRFMLSSSCW
Ga0311326_1005112913300029917BogMIASLIFLATMAVTGIPTAVLFIPWAWVTGNANPL
Ga0311326_1063522923300029917BogMISTFVFMTTMVILGIPSAILFIPWCAVTGNVLPLYKATRFMLSSSCWMAGV
Ga0302143_105144813300029918BogMIFFLLFMATMVVTGIPTALLFIPWCALTGNVLPLYKGTRFMLSSSCWMAGVRFH
Ga0302141_115594113300029919BogMIFYLIFMATMVVTGIPTAILFIPWCALTGNVLPLYKG
Ga0302142_111813423300029920BogMIFYLIFMATMVVTGIPTAILFIPWCALTGNVLPLYKGTRFMLSSSCWM
Ga0311363_1004215813300029922FenMIPFLIFMATMVVTGIPTAILFIPWCALTGNVLPLYKGTRFMLSSSCWMAGVRFHVEG
Ga0311330_1071354013300029945BogMISYLIFMATMVITGIPTAILFIPWCWMTGNVLPLYKGTRFMLSSSCWMAGVRFHT
Ga0311346_1041056923300029952BogMLHTLIFLATMVATGIPTAVLFIPWCWMTGNVLPLYKGTRFM
Ga0311343_1094580113300029953BogMVVLGIPTAVLFIPWCWITGNVLPLYKGTRFMLSSSCRMAG
Ga0311342_1025071313300029955BogMLSSLIFLATMVVTGIPTAVLFIPWCWITGNVLPLYKGTRFMLASSCRLAGV
Ga0302175_1006267023300030014FenMATMVVTGIPTALLFIPWCWLTGNVLPLYKGTRFMLS
Ga0311344_1011884443300030020BogMIYTFIFMANMVITGIPTAVLFIPWCWLTGNVMPLY
Ga0311344_1144313623300030020BogMISSFIFIATMIVTGIPTATLFIPWCWITGNVLPLYKGTRFMLASSCRLAGVR
Ga0302281_1026347623300030044FenMISSLIFMVTMIVTGIPTALLFIPWCWLTGNVLPLYKG
Ga0302192_1021245413300030507BogMLFSLIFVATMVVTGIPTALLFIPWCWLTGNVLPLYKGTRFMLSSSCRLA
Ga0302275_1058470823300030518BogMISSLIFIATMIVTGIPTALLFIPWCWLTGNVLPLYKGTRFMLSSSCR
Ga0302193_1020451623300030519BogMISSLLFMATMIVTGIPTAGLFIPWCWLTGNVLPLYKGTR
Ga0302193_1044667023300030519BogMLHTLIFLATMVATGIPTAVLFIPWCWMTGNVLPLYKGTRFMLASSCRLAGVGF
Ga0311335_1001721053300030838FenMIFTFLFMATMVITGIPTAVLFIPWCWLTGNVLPLYKGTRFMLASSCRMAGVRF
Ga0302323_10045403513300031232FenMLASFIFFTTMIVTGIPTAGLLIPWCWLTGNVMPLYKGTRFMLASSCRLAGVRF
Ga0302323_10109597023300031232FenMAMMVVTGIPTALLFISWCWLTGNVLPLYKGTRFMLSSSCRMAGVRFHTTGLENVPS
Ga0265330_1017589013300031235RhizosphereMIVTGIPTALLFIPWCWLTGNVLPLYKSTRFMLSSS
Ga0265325_1009119923300031241RhizosphereMIWSLIFITNMVVLGIPSALLFIPRCWITGNVLPLYKATRFM
Ga0302187_1043845513300031259BogMLSSLVFIATMVVTGIPTALLFIPWCWLTGNVLPLYKGTRFMLSSSCW
Ga0316221_103188613300032665FreshwaterMFFTFIFMANMVITGIPTAILFIPWCWLTGNVGPLYKGTRFMLSSSC
Ga0316231_101916263300032722FreshwaterMISYLIFMATMVITGIPTAILFIPWCWMTGNVLPLYK
Ga0316224_121628713300032753FreshwaterMISYLIFMATMVITGIPTAILFIPWCWMTGNVLPLYKGTRFMLSSS
Ga0335078_1007789813300032805SoilMFCSLLFLANMVLLGIPSALLFIPWCWLTGDVLPLYKATRFMLSSSC
Ga0335078_1212384113300032805SoilMISSLIFIFNMIVLGIPSAIVFIPWCWLTGDVLPLYKATRFM
Ga0335080_1155083523300032828SoilMVASLIFIANMVVLGIPSALLFIPWCWLTGNVSPLYKATRFMLSSS
Ga0326728_1013156013300033402Peat SoilMIRSLLFLANMIILGIPSALVFIPWCWLTGNVLPLYKATRFMLCSSCRV
Ga0326727_1065511233300033405Peat SoilMIWSLIFIANMVVLGIPSAFLFIPWCWMTGNVLPLYKATRFML
Ga0371489_0069405_1_1413300033755Peat SoilMIWSLLFLANMIVTGIPTALLFIPWCWLTGNVLPLYKATRFMLSSSC
Ga0371489_0444073_448_5853300033755Peat SoilMIYTFIFMANMVITGIPTAILFIPWCWLTGNVMPLYRGTRFMLSSS
Ga0334804_007037_1_1623300033818SoilMISTFLFMATMVVTGIPTAILFIPWCWLTGDVLPLYKGTRFMLSSSCWMAGVRF
Ga0334804_050593_1105_12093300033818SoilMLSSLIFVTTMVILGIPSAVLFIPWTWITGNVAPL
Ga0334804_084807_1_1143300033818SoilMIWSLIFITNMVVLGIPSALLFIPWCWITGNVLPLYKA
Ga0371487_0019558_4558_47133300033982Peat SoilMIYSFIFMATMVVTGIPTAVLFIPWCWLTGNVLPLYKGTRFMLASSCWMSGV
Ga0371488_0392331_497_6433300033983Peat SoilMIFYLIFLATMVVTGIPTAILFIPWCALTGNVLPLYKGTRFMLHSSCWM
Ga0326724_0338980_1_1233300034091Peat SoilMIWSLIFITNMVVLGIPSAILFIPWCWITGNVLPLYKATRF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.