| Basic Information | |
|---|---|
| Family ID | F072805 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LARMAQTIPADVASVRKGMLPKDVIEKLKQIEKLSKRLRTELNP |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.50 % |
| % of genes near scaffold ends (potentially truncated) | 85.12 % |
| % of genes from short scaffolds (< 2000 bps) | 81.82 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.430 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.876 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.314 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.372 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.89% β-sheet: 0.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 6.61 |
| PF07676 | PD40 | 4.96 |
| PF14559 | TPR_19 | 3.31 |
| PF00459 | Inositol_P | 1.65 |
| PF00092 | VWA | 0.83 |
| PF00884 | Sulfatase | 0.83 |
| PF02597 | ThiS | 0.83 |
| PF01053 | Cys_Met_Meta_PP | 0.83 |
| PF05362 | Lon_C | 0.83 |
| PF16472 | DUF5050 | 0.83 |
| PF13407 | Peripla_BP_4 | 0.83 |
| PF00694 | Aconitase_C | 0.83 |
| PF13683 | rve_3 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.83 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.83 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.83 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.83 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.83 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.83 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.83 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.83 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.83 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.83 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.83 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.83 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.43 % |
| Unclassified | root | N/A | 11.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000579|AP72_2010_repI_A01DRAFT_1057851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1000292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9087 | Open in IMG/M |
| 3300001471|JGI12712J15308_10039894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
| 3300001867|JGI12627J18819_10252273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100388527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1275 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10217094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300004152|Ga0062386_100139606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1885 | Open in IMG/M |
| 3300004479|Ga0062595_100043245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1990 | Open in IMG/M |
| 3300005332|Ga0066388_104228323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300005435|Ga0070714_100000828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 21874 | Open in IMG/M |
| 3300005542|Ga0070732_10528449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300005568|Ga0066703_10247592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1082 | Open in IMG/M |
| 3300005575|Ga0066702_10047179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2298 | Open in IMG/M |
| 3300005598|Ga0066706_10622118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300005602|Ga0070762_10171468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
| 3300005610|Ga0070763_10005984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4747 | Open in IMG/M |
| 3300005614|Ga0068856_101172156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300006059|Ga0075017_101195444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300006163|Ga0070715_10012379 | All Organisms → cellular organisms → Bacteria | 3104 | Open in IMG/M |
| 3300006903|Ga0075426_10815294 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300007788|Ga0099795_10537400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300009088|Ga0099830_10327243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1228 | Open in IMG/M |
| 3300009525|Ga0116220_10225368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300009545|Ga0105237_12775825 | Not Available | 501 | Open in IMG/M |
| 3300009623|Ga0116133_1210831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300009640|Ga0116126_1093223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 3300010361|Ga0126378_10410081 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300010366|Ga0126379_12457638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300010401|Ga0134121_13127123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300010876|Ga0126361_10687007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
| 3300010937|Ga0137776_1283766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 960 | Open in IMG/M |
| 3300011120|Ga0150983_15611703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300011270|Ga0137391_11399661 | Not Available | 545 | Open in IMG/M |
| 3300011271|Ga0137393_11036058 | Not Available | 698 | Open in IMG/M |
| 3300012203|Ga0137399_11694022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300012206|Ga0137380_11587244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300012212|Ga0150985_104042336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1199 | Open in IMG/M |
| 3300012359|Ga0137385_10533514 | Not Available | 991 | Open in IMG/M |
| 3300012925|Ga0137419_10866486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300012948|Ga0126375_10325720 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300012987|Ga0164307_10836863 | Not Available | 735 | Open in IMG/M |
| 3300013297|Ga0157378_11937051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300014201|Ga0181537_10886006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 605 | Open in IMG/M |
| 3300014498|Ga0182019_10625203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 758 | Open in IMG/M |
| 3300014498|Ga0182019_11407668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300014654|Ga0181525_10103072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1578 | Open in IMG/M |
| 3300014657|Ga0181522_10726422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 607 | Open in IMG/M |
| 3300015265|Ga0182005_1207104 | Not Available | 592 | Open in IMG/M |
| 3300016294|Ga0182041_12088237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300016705|Ga0181507_1332971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1986 | Open in IMG/M |
| 3300017924|Ga0187820_1186508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 641 | Open in IMG/M |
| 3300017943|Ga0187819_10471501 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300017975|Ga0187782_10715854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 772 | Open in IMG/M |
| 3300017999|Ga0187767_10350212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300018006|Ga0187804_10079906 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300018006|Ga0187804_10515777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300018006|Ga0187804_10545652 | Not Available | 524 | Open in IMG/M |
| 3300018007|Ga0187805_10305509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300018033|Ga0187867_10564227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300018057|Ga0187858_10804149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300018085|Ga0187772_10180405 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300020582|Ga0210395_10361209 | Not Available | 1092 | Open in IMG/M |
| 3300020583|Ga0210401_10008902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9917 | Open in IMG/M |
| 3300020583|Ga0210401_10163521 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
| 3300021088|Ga0210404_10863895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300021170|Ga0210400_10223259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1535 | Open in IMG/M |
| 3300021180|Ga0210396_11026382 | Not Available | 697 | Open in IMG/M |
| 3300021181|Ga0210388_11265636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300021181|Ga0210388_11499613 | Not Available | 563 | Open in IMG/M |
| 3300021404|Ga0210389_10150146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1807 | Open in IMG/M |
| 3300021407|Ga0210383_10086258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2632 | Open in IMG/M |
| 3300021432|Ga0210384_11431325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300021474|Ga0210390_10424826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1123 | Open in IMG/M |
| 3300021477|Ga0210398_10017858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6105 | Open in IMG/M |
| 3300021559|Ga0210409_10047014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4070 | Open in IMG/M |
| 3300021861|Ga0213853_10944053 | Not Available | 1516 | Open in IMG/M |
| 3300022509|Ga0242649_1000108 | All Organisms → cellular organisms → Bacteria | 4210 | Open in IMG/M |
| 3300022522|Ga0242659_1021071 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300022722|Ga0242657_1000584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3864 | Open in IMG/M |
| 3300022726|Ga0242654_10007079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2288 | Open in IMG/M |
| 3300025494|Ga0207928_1024590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1170 | Open in IMG/M |
| 3300025905|Ga0207685_10031124 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300025906|Ga0207699_11017435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300025913|Ga0207695_10130580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2470 | Open in IMG/M |
| 3300025915|Ga0207693_10177178 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300026078|Ga0207702_10976767 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300026078|Ga0207702_11090430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300026215|Ga0209849_1074330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300026294|Ga0209839_10215057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300026305|Ga0209688_1068724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300026334|Ga0209377_1197085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300026552|Ga0209577_10179014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1645 | Open in IMG/M |
| 3300027117|Ga0209732_1021812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1088 | Open in IMG/M |
| 3300027502|Ga0209622_1101453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300027667|Ga0209009_1131676 | Not Available | 636 | Open in IMG/M |
| 3300027729|Ga0209248_10020888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2048 | Open in IMG/M |
| 3300027812|Ga0209656_10254953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| 3300027825|Ga0209039_10004378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10364 | Open in IMG/M |
| 3300027825|Ga0209039_10173841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 887 | Open in IMG/M |
| 3300027842|Ga0209580_10363217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300027867|Ga0209167_10731899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300027898|Ga0209067_10631948 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300027915|Ga0209069_10828478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300028800|Ga0265338_10023229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6383 | Open in IMG/M |
| 3300028800|Ga0265338_10986087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 571 | Open in IMG/M |
| 3300030617|Ga0311356_11934840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300030763|Ga0265763_1010186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300031057|Ga0170834_101380219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1393 | Open in IMG/M |
| 3300031234|Ga0302325_10067083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6974 | Open in IMG/M |
| 3300031446|Ga0170820_10846880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 3300031525|Ga0302326_12572912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 636 | Open in IMG/M |
| 3300031715|Ga0307476_10145869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1697 | Open in IMG/M |
| 3300031754|Ga0307475_10524694 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300031868|Ga0316038_100035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4169 | Open in IMG/M |
| 3300031962|Ga0307479_10364988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1428 | Open in IMG/M |
| 3300032160|Ga0311301_10842295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1249 | Open in IMG/M |
| 3300032174|Ga0307470_10076264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1831 | Open in IMG/M |
| 3300032261|Ga0306920_100465613 | Not Available | 1878 | Open in IMG/M |
| 3300033158|Ga0335077_10145864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2722 | Open in IMG/M |
| 3300033983|Ga0371488_0059569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 2301 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.13% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.48% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.48% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.48% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.65% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.65% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.83% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031868 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A01DRAFT_10578511 | 3300000579 | Forest Soil | IPSDVASIRRGTLPKDTIQKLKQIEKLSKRLRDELNP* |
| AP72_2010_repI_A100DRAFT_10002926 | 3300000837 | Forest Soil | LARAAQTIPSDVASIRRGTLPKDTIQKLKQIEKLSKRLRDELNP* |
| JGI12712J15308_100398942 | 3300001471 | Forest Soil | TIPTDVESIRKGMLPKDVLLKLKQIERLSKRLRSELNP* |
| JGI12627J18819_102522732 | 3300001867 | Forest Soil | DDLARMAQTIPTDVASVRKGMLPKDVIEKLKQIEKLSKRLRTELNP* |
| JGIcombinedJ26739_1003885271 | 3300002245 | Forest Soil | QTIPTDVESIRKGMLPKDVLLKLKQIERLSKRLRSELNP* |
| JGIcombinedJ51221_102170941 | 3300003505 | Forest Soil | MAQTIPNDVASVRKGMLPKNVIEKLKQIEKLSKRLRTQLNL* |
| Ga0062386_1001396061 | 3300004152 | Bog Forest Soil | TAQTIPGDVANVRKGMLPKDVIEKLKQIEKLSKRLRTELNP* |
| Ga0062595_1000432451 | 3300004479 | Soil | QAQREADELARMAQTVPADVTKVREGMLPKDAIEKLKQIERLSKHLRAQLNP* |
| Ga0066388_1042283232 | 3300005332 | Tropical Forest Soil | ADDLARVAQTIPVDVASVRKGMLPKDVIEKLKQIEKLSKRLRTELNP* |
| Ga0070714_1000008282 | 3300005435 | Agricultural Soil | MQRDADDLARTAQSIPTDVASVRKGMLPKDIIQKLKQIEKLSKHLRTQLNP* |
| Ga0070732_105284491 | 3300005542 | Surface Soil | IPSDIANIRAGTLPKDTIQKLKEIEKLSKRLRSELNH* |
| Ga0070732_109191332 | 3300005542 | Surface Soil | PSDVANVRKGMLPKDVIEKLKQIEKLSKHLRSELNP* |
| Ga0066703_102475922 | 3300005568 | Soil | TDLEQAQREADELARMAQTVPADVTKVREGMLPKDAIEKLKQIERLSKHLRTELTQ* |
| Ga0066702_100471792 | 3300005575 | Soil | RTAQTIPTDVAGVRQGTLPKDMIEKLRRIEKLSKRLRSELNP* |
| Ga0066706_106221181 | 3300005598 | Soil | DLARTAQTIPADVASVRKGMLPKDVIEKLKQIERLSKHLRTELNP* |
| Ga0070762_101714682 | 3300005602 | Soil | PREADELSRMSQTIPSDVASVRKGMLPRDVIEKLKQIEKLSKRLRTELNP* |
| Ga0070763_100059843 | 3300005610 | Soil | MSQTIPSDVASVRKGMLPRDVIEKLKQIEKLSKRLRTELNP* |
| Ga0068856_1011721561 | 3300005614 | Corn Rhizosphere | RTAQTIPSDVASIRRGTLPKDTIQKLKEIEKLSKKLRSELNP* |
| Ga0075017_1011954441 | 3300006059 | Watersheds | EADDLARLAQTIPTDVASVRKGMLPKDVIEKLRQIEKLSKRLRTELNP* |
| Ga0070715_100123793 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EADDLARTAQTIPADVASVRKGMLPKDVIEKLKQIEKLSKHLRGELAP* |
| Ga0075426_108152941 | 3300006903 | Populus Rhizosphere | ARTAQTIPSDVASIRRGTLPKDTIQKLKEIEKLSKKLRSELNP* |
| Ga0099795_105374001 | 3300007788 | Vadose Zone Soil | RLAQTIPTDVANVRQGMLPKDVIQKLKQIEKLSKHLRNELIK* |
| Ga0099830_103272432 | 3300009088 | Vadose Zone Soil | VKKLTSDVESVRKGMLPKDVLQKLKQIENLSKRLRSELNPKGTP* |
| Ga0116220_102253681 | 3300009525 | Peatlands Soil | LLGLQKEAEDLARTAQTIPADMATVRKGTLPKDIIQKLKQIEKLSKHLRTQIAQ* |
| Ga0105237_127758252 | 3300009545 | Corn Rhizosphere | QAQREADELARVAQTVPADVTKVREGMLPKDAIEKLKQIEKLSKRLRTELTQ* |
| Ga0116133_12108311 | 3300009623 | Peatland | RTAQTIPLDVASVRKGMLPKDVIEKLKQIEKLSKRLRSELNP* |
| Ga0116126_10932233 | 3300009640 | Peatland | KLHRDADELARVAQTIPPDVATIQKGLLPKDIIEKLKLIEKLSKQLRRQLSR* |
| Ga0126378_104100812 | 3300010361 | Tropical Forest Soil | RIDSEKLQRDADDLARTAQTIPSDIANIHRGTLPKDTIQKLKEIEKLSKRLRTELNP* |
| Ga0126379_124576381 | 3300010366 | Tropical Forest Soil | KDADDLARAAQTIPSDVADIRRGTLPKDTIQKLKEIEKLSKRLRSELNP* |
| Ga0134121_131271231 | 3300010401 | Terrestrial Soil | QKEADDLARTAQTIPADVASVRKGMLPKDVIEKLKQIEKLSKRLRGELAP* |
| Ga0126361_106870072 | 3300010876 | Boreal Forest Soil | DELSRMSQTIPSDVASVRKGMLPRDVIEKLKQIEKLSKRLRTELNP* |
| Ga0137776_12837662 | 3300010937 | Sediment | RDAEELARTAQSIPTDVARVRKGMLPKDVIDKLKQIEKLSKRLRTELNP* |
| Ga0150983_156117032 | 3300011120 | Forest Soil | DDLARTAQTIPSDVASLRKGMLPKDVIEKLKQIEKLSKHLRTELNP* |
| Ga0137391_113996611 | 3300011270 | Vadose Zone Soil | READDLAKTAQSIPSDVESVRKGMLPKDVLQKLRQIEKLSKRLRSELNP* |
| Ga0137393_110360582 | 3300011271 | Vadose Zone Soil | VIQLQREADDLAKTAQSIPSDVESVRKGMLPKDVLQKLKQIENLSKRLRSELNPKGTP* |
| Ga0137399_116940221 | 3300012203 | Vadose Zone Soil | ADELAKAAQSVPADIQNIEKGVFPKDVIQKLKQIEKLSKHLRTELAP* |
| Ga0137380_115872441 | 3300012206 | Vadose Zone Soil | PSDVASVRKGMLPKDVIEKLKQIEKLSKRLRTELNP* |
| Ga0150985_1040423361 | 3300012212 | Avena Fatua Rhizosphere | AQREADTLARMAQTIPADMTKIREGMLPKDVIEKLKQIEKMSKHLRGEITR* |
| Ga0137385_105335142 | 3300012359 | Vadose Zone Soil | QTIPSDLANIRRGTLPKDTIQKLKEIEKLSKRLRSELNP* |
| Ga0137419_108664862 | 3300012925 | Vadose Zone Soil | MRWTVRFSDADDLARTAQTIPSDVASVRKGMLPKDVIEKLKQIEKLSKHLRTELNP* |
| Ga0126375_103257201 | 3300012948 | Tropical Forest Soil | TIPSDVANVRRGTLPKVTIQKLKEIEKLSKRLRSELNP* |
| Ga0164307_108368632 | 3300012987 | Soil | VAQTVPADVTKVREGMLPKDAIEKLKQIEKLSKHLRSELTQ* |
| Ga0157378_119370512 | 3300013297 | Miscanthus Rhizosphere | EADDLARTAQTIPADVASVRKGMLPKDVIEKLKQIEKLSKRLRGELAP* |
| Ga0181537_108860062 | 3300014201 | Bog | DELARIAQTIPADLAATQKGLLAKDLQAKLKQIEKLSKRLRSQLAP* |
| Ga0182019_106252031 | 3300014498 | Fen | EADELARIAQTIPPDVASIQEGKLPKDMIGKLKQIEKLSKRLRSQINP* |
| Ga0182019_114076681 | 3300014498 | Fen | RTAQTIPTDVASVRKGMLPKDVIQKLKQIEKLSKHLRGELTP* |
| Ga0181525_101030722 | 3300014654 | Bog | READALARTAQTIPSDVASIRKGMLPKDAIEKLKQIEKLSKHLRAELNP* |
| Ga0181522_107264222 | 3300014657 | Bog | DDLARTAQSIPSDVASVRKGLMPKDVIQKLKQIEKLSKQLRTKLNP* |
| Ga0182005_12071042 | 3300015265 | Rhizosphere | EADELARMAQTVPADVTKVREGMLPKDAIEKLKQIERLSKHLRAQLNP* |
| Ga0182041_120882371 | 3300016294 | Soil | AQLQKEADELARIAQTIPADVASVKKGMLPKDVIEKLKQIERLSKRLRSELTP |
| Ga0181507_13329712 | 3300016705 | Peatland | QDADDLARIAQTIPNDAASIQKGMLPKDMIEKLKQIERLSKHLRGQISQ |
| Ga0187820_11865082 | 3300017924 | Freshwater Sediment | QQEADDLARSAQPIPADMAAIRQGTLPKDIIEKLKRIEKLSKRLRSELNP |
| Ga0187819_104715011 | 3300017943 | Freshwater Sediment | LVKLQQEADDLARSAQTIPADMAAIRQGTLPKDIIEKLKRIEKLSKRLRSELNP |
| Ga0187782_107158542 | 3300017975 | Tropical Peatland | QREADDLAREAQTIPIDLASVRKGALPKDTIRKLKQIEKLSKHLRNELTP |
| Ga0187767_103502121 | 3300017999 | Tropical Peatland | IPTDIAKVNQGMLPKDVIEKLKQIEKLSKRLRSEVTP |
| Ga0187804_100799061 | 3300018006 | Freshwater Sediment | READDLARTAQTIPSDVADVRRGTLPKDIIQKLKQIEKLSKRLRSELNP |
| Ga0187804_105157772 | 3300018006 | Freshwater Sediment | QTIPDDMTALRKGTLPKDLIEKLKRIEKLSKRLRSQVAP |
| Ga0187804_105456521 | 3300018006 | Freshwater Sediment | RTAQTIPSGVANVSKGTLPKDVIEKLKQIERLSKHLRSELNP |
| Ga0187805_103055091 | 3300018007 | Freshwater Sediment | QTIPADIISVRKGMLPKDVIEKLKQIEKLSKRLRGELNP |
| Ga0187867_105642272 | 3300018033 | Peatland | IDMVQLQRDADDLSRTAQTIPADVANIRKGMLPKDVIEKLKQIEKLSKRLRTELNP |
| Ga0187858_108041491 | 3300018057 | Peatland | ADDLARAAQTIPSDVANVRKGMLPKDVIEKLKQIEKLSKRLRAELNP |
| Ga0187772_101804051 | 3300018085 | Tropical Peatland | ADDLARTAQTIPSDMANIDRGTLPKDTIQKLKEIEKLSKRLRSELNP |
| Ga0210395_103612093 | 3300020582 | Soil | AKLRQDADELAKIAQTIPPDVSSIQKGLLPKDVIEKLKQIEKLSKQLRKQLSP |
| Ga0210401_100089027 | 3300020583 | Soil | MAQTIPNDVASVRKGMLPKNVIEKLKQIEKLSKRLRTQLNL |
| Ga0210401_101635212 | 3300020583 | Soil | MSQTIPSDVASVRKGMLPRDVIEKLKQIEKLSKRLRTELNP |
| Ga0210404_108638951 | 3300021088 | Soil | TAQTIPSDVASVRKGMLPKDVIEKLKQIEKLSKHLRSELAP |
| Ga0210400_102232592 | 3300021170 | Soil | SRLAQSIPVDVQSIEKGMFPKDVVQKLKQIEKLSKHLRGELTP |
| Ga0210396_110263821 | 3300021180 | Soil | ARTAESIPADVVSVRKGVLPKDTMEKLKQIEKLSKRLRSQLNP |
| Ga0210388_112656362 | 3300021181 | Soil | QTIPSDVASVRKGILPKDVIEKLKQIEKLSKRLRSELTP |
| Ga0210388_114996131 | 3300021181 | Soil | DELAKIAQTIPPDVSSIQKGLLPKDVIEKLKQIEKLSKQLRKQLSP |
| Ga0210389_101501461 | 3300021404 | Soil | QIQKEADELARMAQTIPADVASVRKGMLPKDVIEKLKQIEKLSKRLRTELNP |
| Ga0210383_100862582 | 3300021407 | Soil | VQLQKDADDPARMAQTIPSDMADLRPGTLPKDVIRKLKQIEKLSKRLRSVISQ |
| Ga0210384_114313252 | 3300021432 | Soil | QRDADDLARTAQTIPVDVASVRKGMLPKDVILKLKQIEKLSKHLRGELAP |
| Ga0210390_104248262 | 3300021474 | Soil | QLQKEADELARTAQTIPSDVASIRKGILPKDVIEKLKQVEKLSRRLRTELNP |
| Ga0210398_100178582 | 3300021477 | Soil | MSQTIPSDVASARKGMLPRDVIEKLKQIEKLSKRLRTELNP |
| Ga0210409_100470142 | 3300021559 | Soil | LQHDADDLARTAQSIPTDVASVRQGMLPKDVIQKLKQIEKLSKRLRGELTP |
| Ga0213853_109440531 | 3300021861 | Watersheds | LARTAQTIPADMASVRTGTLPKDIIQKLKQIEKLSKHLRTQIAH |
| Ga0242649_10001082 | 3300022509 | Soil | DDLARTAQAIPGDVAGVRQGTLPKDIIEKLRRIEKLSKRLRSELNP |
| Ga0242659_10210711 | 3300022522 | Soil | LQQEADDLARTAQAIPGDVAGVRQGTLPKDIIEKLRRIEKLSKRLRSELNP |
| Ga0242657_10005841 | 3300022722 | Soil | KLSRLAQSIPVDVQSIEKGMFPKDVVQKLKQIEKLSKHLRGELTP |
| Ga0242654_100070792 | 3300022726 | Soil | QREADDLARTAQTIPSDVASVRKGMLPKDVIEKLKQIEKLSKHLRTELNP |
| Ga0207928_10245901 | 3300025494 | Arctic Peat Soil | SDVASVRKGMLPKDVIEKLKQIEKLSKRLRTELNPR |
| Ga0207685_100311241 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | EADDLARTAQTIPADVASVRKGMLPKDVIEKLKQIEKLSKHLRGELAP |
| Ga0207699_110174352 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LARTAQTIPADVASVRKGMLPKDVIEKLKQIEKLSKRLRAELNP |
| Ga0207695_101305801 | 3300025913 | Corn Rhizosphere | MAQTVPADVTKVREGMLPKDALEKLKQIEKLSKHLRAQLNP |
| Ga0207693_101771781 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AAQTIPSDVAKIRRGTLPKDTIQKLKEIEKLSKRLRSELNP |
| Ga0207702_109767672 | 3300026078 | Corn Rhizosphere | RTAQTIPSDVASIRRGTLPKDTIQKLKEIEKLSKKLRSELNP |
| Ga0207702_110904302 | 3300026078 | Corn Rhizosphere | ADTLARMAQTIPADMTKIREGMLPKDVIEKLKQIEKMSKHLRGELTY |
| Ga0209849_10743302 | 3300026215 | Soil | LAQTIPTDVASIRQGKLPIDTIQKLKQIEKLSKRLRGELTP |
| Ga0209839_102150572 | 3300026294 | Soil | RLQREADDLARTAQTIPSDVASVRKGMLPKDVIEKLKQIEKLSKRLRTELNP |
| Ga0209688_10687241 | 3300026305 | Soil | AQREADELARMAQTVPADVTKVREGMLPKDAIEKLKQIERLSKHLRAQLNP |
| Ga0209377_11970852 | 3300026334 | Soil | QKEADDLARMAQTIPADVASVRKGMLPKDVIEKLKQIEKLSKRLRTELNP |
| Ga0209577_101790141 | 3300026552 | Soil | LEQAQREADELARMAQTVPADVTKVREGMLPKDAIEKLKQIERLSKHLRAQLNP |
| Ga0209732_10218121 | 3300027117 | Forest Soil | QLQKEADDLARTAQTIPTDLANVRKGMLPKDIVQKLKQIEKLSKHLRTELNP |
| Ga0209622_11014532 | 3300027502 | Forest Soil | LARMAQTIPADVASVRKGMLPKDVIEKLKQIEKLSKRLRTELNP |
| Ga0209009_11316761 | 3300027667 | Forest Soil | LANAANSIPSDIESVRKGMLPKDVVRKLKQIEKLLKQLRNELNP |
| Ga0209248_100208883 | 3300027729 | Bog Forest Soil | MRGDGVASVADEAEDLAATAQTIPTDVASVRKGMMPKDVLQKLKQIEKLSKHLRGELTP |
| Ga0209656_102549532 | 3300027812 | Bog Forest Soil | LSRTAQTIPGDVANVRKGMLPKDVIEKLKQIEKLSKRLRTELNP |
| Ga0209039_100043781 | 3300027825 | Bog Forest Soil | ARIAQTIPPDVASIQKGKLPKDMIEKLKQIEKLSKQLRTQINP |
| Ga0209039_101738412 | 3300027825 | Bog Forest Soil | ARIAQTIPPDVASIQKGKLPKDMIEKLKQIEKLSKQLRSQINP |
| Ga0209580_103632172 | 3300027842 | Surface Soil | QTIPSDIANIRAGTLPKDTIQKLKEIEKLSKRLRSELNH |
| Ga0209167_107318992 | 3300027867 | Surface Soil | DDLARTAQTIPSDMAGIRQGTLPKDMIDKLKRIEKLSKRLRSELNP |
| Ga0209067_106319482 | 3300027898 | Watersheds | AQTIPSDVADVRRGTLPKDTIQKLKQIEKLSKRLRSELNP |
| Ga0209069_108284781 | 3300027915 | Watersheds | VQLQRDADDLSRTAQTIPGDVANVRKGMLPKDVIEKLKQIEKLSKRLRTELNP |
| Ga0265338_100232293 | 3300028800 | Rhizosphere | LTQLQKEADELARTAETIPSDITSIRKGMLPKDMIQKLKQIEKMSKHLRTELTP |
| Ga0265338_109860872 | 3300028800 | Rhizosphere | LQKEADDLARTAQTIPSDLASVRKGMLPKDIVQKLKQIEKLSKHLRTELNP |
| Ga0311356_119348402 | 3300030617 | Palsa | RQDADDLARIAQTIPLDVMSIQRGLLPKDMIDKLRQIEKLSKHLRDQIKP |
| Ga0265763_10101861 | 3300030763 | Soil | SQTIPSDVASVRKGMLPRDVIEKLKQIEKLSKRLRTELNP |
| Ga0170834_1013802191 | 3300031057 | Forest Soil | MARTAQTITSDVAGVRKGMLPKDVIEKLKQVEKLSKRLRTELTP |
| Ga0302325_100670831 | 3300031234 | Palsa | DLARTAQTIPSDVASVRKGMLPKDVIDKLKQIEKLSKRLRTELNP |
| Ga0170820_108468802 | 3300031446 | Forest Soil | EADDLARMAQTIPTDVASIRKGMLPKDVIEKLKQIEKLSKHLRTELNP |
| Ga0302326_125729121 | 3300031525 | Palsa | DQLARIAQTIPPDVASIQEGKLPKDIIEKLKQIEKLSKRLRSQIQP |
| Ga0307476_101458692 | 3300031715 | Hardwood Forest Soil | DELSKLAQTIPPDVADIRMGMLPKDVTQKLKQIEKLSKQLRGQLNP |
| Ga0307475_105246942 | 3300031754 | Hardwood Forest Soil | AQLQKEADDLARTAESIPADVVSVRKGVLPKDTMEKLKQIEKLSKRLRSQLNP |
| Ga0316038_1000351 | 3300031868 | Soil | RQDADELARIAQTIPPDVASIQRGLLPKDMSEKLKQIEKLSKRLRSQINP |
| Ga0307479_103649881 | 3300031962 | Hardwood Forest Soil | DDLARTAQTIPSDVASVRKGMLPKDVIEKLKQIEKLSKRLRNELTP |
| Ga0311301_108422951 | 3300032160 | Peatlands Soil | LLGLQKEAEDLARTAQTIPADMATVRKGTLPKDIIQKLKQIEKLSKHLRTQIAQ |
| Ga0307470_100762641 | 3300032174 | Hardwood Forest Soil | QTIPSDVANVRKGVLPKDVIEKLKQIEKLSKRLRTELNP |
| Ga0306920_1004656131 | 3300032261 | Soil | YSGRSMRKGVRPKDVIDKLKQIEKLSKRLRTELKP |
| Ga0335077_101458642 | 3300033158 | Soil | MLAQTVPADIAKIRQGMLPKDVVQKLKQIEKLSKRLRSQLNP |
| Ga0371488_0059569_3_140 | 3300033983 | Peat Soil | ELARIAQTIPPDVASIQQGKLPKDVIEKLKRIEKLCKRLRSQINP |
| ⦗Top⦘ |