NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072740

Metagenome / Metatranscriptome Family F072740

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072740
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 100 residues
Representative Sequence MRSMINNYALEEKTADGVPSGHFWMNESITRAAAREVLETHKGLSGNKLAEYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLSSDQYMSLQ
Number of Associated Samples 92
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 40.34 %
% of genes near scaffold ends (potentially truncated) 38.84 %
% of genes from short scaffolds (< 2000 bps) 98.35 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.76

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.347 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(33.058 % of family members)
Environment Ontology (ENVO) Unclassified
(63.636 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.256 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.98%    β-sheet: 12.40%    Coil/Unstructured: 44.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.76
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.39.1.11: p25-alphad1wlma11wlm0.5854
a.39.1.0: automated matchesd2n8za12n8z0.56745
a.39.1.2: S100 proteinsd1a4pa_1a4p0.56126
a.39.1.9: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)d1ij5a_1ij50.56029
b.2.5.5: STAT DNA-binding domaind1bg1a21bg10.55715


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.35 %
UnclassifiedrootN/A1.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001354|JGI20155J14468_10245430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300003554|Ga0008451J51688_114527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300005516|Ga0066831_10073457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium924Open in IMG/M
3300006165|Ga0075443_10340368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300006920|Ga0070748_1297462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300006920|Ga0070748_1343819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300007513|Ga0105019_1183848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1051Open in IMG/M
3300007513|Ga0105019_1240731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum842Open in IMG/M
3300007543|Ga0102853_1030010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium916Open in IMG/M
3300007718|Ga0102852_1074927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300008832|Ga0103951_10528077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300008929|Ga0103732_1067230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300008930|Ga0103733_1033793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum804Open in IMG/M
3300008993|Ga0104258_1069233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300009071|Ga0115566_10486702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300009077|Ga0115552_1170022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium906Open in IMG/M
3300009432|Ga0115005_11308947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300009436|Ga0115008_10278901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1187Open in IMG/M
3300009441|Ga0115007_10591149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300009441|Ga0115007_11157770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300009550|Ga0115013_10523427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum778Open in IMG/M
3300009592|Ga0115101_1193607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium835Open in IMG/M
3300009593|Ga0115011_11491090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300009593|Ga0115011_12049809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300009606|Ga0115102_10707243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300009679|Ga0115105_10441592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300009679|Ga0115105_10539192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300009679|Ga0115105_10760516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300009679|Ga0115105_10936891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300010368|Ga0129324_10331667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300010883|Ga0133547_12171142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1009Open in IMG/M
3300010985|Ga0138326_11004416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300010987|Ga0138324_10325454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum740Open in IMG/M
3300010987|Ga0138324_10395760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300012522|Ga0129326_1080926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300012953|Ga0163179_11783664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300013010|Ga0129327_10914365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300016735|Ga0182074_1190990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium817Open in IMG/M
3300017735|Ga0181431_1074103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium764Open in IMG/M
3300018415|Ga0181559_10615373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300018423|Ga0181593_11098498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300018424|Ga0181591_10879264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300018622|Ga0188862_1025771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300018625|Ga0192842_1022902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300018628|Ga0193355_1010876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum812Open in IMG/M
3300018674|Ga0193166_1026935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300018684|Ga0192983_1035646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300018684|Ga0192983_1051470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300018725|Ga0193517_1052309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300018725|Ga0193517_1066549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018725|Ga0193517_1081533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300018765|Ga0193031_1039754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum764Open in IMG/M
3300018765|Ga0193031_1092698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300018779|Ga0193149_1039827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300018846|Ga0193253_1080665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum782Open in IMG/M
3300018855|Ga0193475_1038908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum761Open in IMG/M
3300018855|Ga0193475_1038932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium761Open in IMG/M
3300018874|Ga0192977_1059265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium778Open in IMG/M
3300018968|Ga0192894_10320974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300018977|Ga0193353_10148322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300018983|Ga0193017_10196884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300018989|Ga0193030_10137636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum782Open in IMG/M
3300018989|Ga0193030_10184808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum684Open in IMG/M
3300018989|Ga0193030_10221879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300018989|Ga0193030_10223784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300019001|Ga0193034_10189219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300019031|Ga0193516_10175915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum716Open in IMG/M
3300019031|Ga0193516_10254711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300019031|Ga0193516_10279865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300019033|Ga0193037_10273601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300019048|Ga0192981_10231024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300019048|Ga0192981_10246551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum685Open in IMG/M
3300019048|Ga0192981_10369716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300019274|Ga0182073_1285039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium825Open in IMG/M
3300020014|Ga0182044_1369972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300021342|Ga0206691_1539135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium818Open in IMG/M
3300021342|Ga0206691_1590479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300021342|Ga0206691_1805336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum698Open in IMG/M
3300021345|Ga0206688_10517057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300021345|Ga0206688_10766277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300021345|Ga0206688_10803242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300021355|Ga0206690_10113465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300021355|Ga0206690_10816184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300021359|Ga0206689_10046287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300021898|Ga0063097_1053329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium738Open in IMG/M
3300021899|Ga0063144_1040556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300021902|Ga0063086_1016336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300021902|Ga0063086_1020081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300021904|Ga0063131_1070169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300021927|Ga0063103_1131249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300021957|Ga0222717_10379723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum786Open in IMG/M
3300021959|Ga0222716_10220271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1189Open in IMG/M
3300021962|Ga0222713_10486755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium740Open in IMG/M
3300021964|Ga0222719_10541612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300022928|Ga0255758_10406458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300023180|Ga0255768_10618418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
(restricted) 3300024252|Ga0233435_1199649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300024301|Ga0233451_10270380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300025695|Ga0209653_1202832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300025890|Ga0209631_10394297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300026136|Ga0208763_1038641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300026182|Ga0208275_1042133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium924Open in IMG/M
3300026471|Ga0247602_1128016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300026495|Ga0247571_1173369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300027159|Ga0208020_1077285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300027906|Ga0209404_10717934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
(restricted) 3300027996|Ga0233413_10247868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium757Open in IMG/M
3300028137|Ga0256412_1382698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300031062|Ga0073989_13371761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300031556|Ga0308142_1064919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300031569|Ga0307489_10375498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium940Open in IMG/M
3300031580|Ga0308132_1067855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium736Open in IMG/M
3300031581|Ga0308125_1086102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300031725|Ga0307381_10246630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300031725|Ga0307381_10289193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300031738|Ga0307384_10513261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300031738|Ga0307384_10636695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300032708|Ga0314669_10624971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300032820|Ga0310342_102306112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine33.06%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine23.97%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater9.09%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.44%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.31%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.48%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.48%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.48%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.65%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.65%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.65%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.65%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.65%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.65%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.83%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.83%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.83%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.83%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300003554Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_04_M0_20 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016735Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018625Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018983Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021904Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022928Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaGEnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300024252 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_135_MGEnvironmentalOpen in IMG/M
3300024301Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly)EnvironmentalOpen in IMG/M
3300025695Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031556Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_538_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031581Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1286_33.1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI20155J14468_1024543013300001354Pelagic MarineFMRSMVQQYALEQKTKEGAPSGKFWMNEAATRAASVEVLTNNVHMKSADVGKYLDTYFAKAWGHFDVNRVGQVEVAKMPSFMRFLASDQYLSLQHY*
Ga0008451J51688_11452713300003554SeawaterMVDGSGYTRVTTARFAADSDDIFMRSMIEAYAVEGKTFGGEPSGQFYMNKSTSRAASEEVLATHKGLAGGALSSYMDTYFEKTFNHFDVNRTGEIEVIKMPQFMRFLCSDQYMQLGESGQK*
Ga0066831_1007345723300005516MarineMISNYALEGKEKDTGVPLGDFWMSEATTRAAASEVLATHKGMTGDVLQKYLDTYFSKAWGHFDVNRTGMVEVIKMPQFMRFLASDQYMPLQP*
Ga0075443_1034036813300006165MarineDEMLGDSIIGEYKRVTPIRFADDTDDIFMRSMIEQYSLEQKTKKGFPSGNFWMNEATTRAAAAEVLETHKGLKASELGEYMGKYFGKAWNHFDVNRTGFVEVIKMPQFMRFLASDQYMSLQP*
Ga0070748_129746213300006920AqueousGGEYKRVPTAHFAADDDDIFMRSMITNYADEGKNKDGSPNGKFWLTESATRAAAAEVLATNAHMAAAAIPGYLNTYFAKAWGHFDVNRTGKVEVIKMPQLMRFLASDQQMYLW*
Ga0070748_134381913300006920AqueousGGEYKRVPTAHFAADDDDIFMRSMITNYADEGKNKDGSPNGSFNMDEAATRAAAAEVLHTNAHIPTADISAYLDTYFAKAWGHFDVNRTGRVEVIKMPQFMRFLASDQQMYLW*
Ga0105019_118384813300007513MarineMIENYALEEKTEDGLPTAKFWMNEAITKAASREVLNTHKGLSGKKLDEYLDTYFMKSWGHFDVNRTGLVEVIKMPMFMRFLCSDQYMSLQ*
Ga0105019_124073123300007513MarineMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAASEVLATHKGLSGSALQSYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE*
Ga0102853_103001023300007543EstuarineMLGGGGYERSTPSRFAADSDDIFMRSMIEQYALEQKTKEGYPSGKFWMDEAATRAAATEVLETNCGMKADKAKYIDTYFAKAWGHFDVNRSGKVEVIKMPQFMRFLCSDQQMYLW*
Ga0102852_107492723300007718EstuarineMIEQYALEQKTKVGYPSGKFWMDEAATRAAATEVLETNCGMKADKAKYIDTYFAKAWGHFDVNRSGKVEVIKMPQFMRFLCSDQYMSLGESG*
Ga0103951_1052807723300008832MarineMKSMIENYALEQKTKKGDPSGKFRMDWGNAHAAAAEVLETHKGLKDKMLSDYLKTYFQKTWDHFDVNQTGYIEVAKMPQFMRFLASD*
Ga0103732_106723013300008929Ice Edge, Mcmurdo Sound, AntarcticaGDSIIGEYKRVIPARFAEDTDDIFMRSMIENYALEQKTKKGFPSGNFWMNEATTRAAAAEVLETHKAMKGAELTSYLDKYFGKAWNHFDVNRTGFVEVIKMPQFMRFIASDQYMSIQP*
Ga0103733_103379323300008930Ice Edge, Mcmurdo Sound, AntarcticaLLSKIPLKFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAKAAAAEVLETHKGLTGGAKAAYLDTYFPKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP*
Ga0104258_106923323300008993Ocean WaterMLGGGGYERQTPKRFAADSDDIFMRSMIEQYALEQKTKEGYPSGKFWMDEAATRAAASEVLETNCNMKGSSKGEWLKTYFGKAWGHFDVNRSGKVEVIKMPQFMRFLCSDQQMYLW*
Ga0115566_1048670213300009071Pelagic MarineFAEDTDDVFMRSMIENYALEQKTKKGFPSGNFWMNEATTRAAASEVLATHKGMVGGELASYMEKYFPKAWNHFDVNRTGFVEVIKMPQFMRFLSSDQYMTLQP*
Ga0115552_117002233300009077Pelagic MarineMLGDSIMGEYKRVTPPRFADDTDDIFMRSMIEQYALEQKTKKGFPSGNFWMNEATTRAAASEVLATHKGMVGGELASYMEKYFPKAWNHFDVNRTGFVEVIKMPQFMRFLSSDQYMTLQP
Ga0115005_1130894713300009432MarineMINNYALEEKSEDGVPSGHFWMNESITRAAAREVLETHKGLSGTKLAEYLDTYFAKAWGHFDVNRTGLIEVIKMPQFMRFLSSDQYMSLQ*
Ga0115008_1027890113300009436MarineMINNYALEEKTADGVPSGHFWMNESITRAAAREVLETHKGLSGNKLAEYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLSSDQYMSLQ*
Ga0115007_1059114913300009441MarineDGVPSAHFWMNESITRAAAREVLETHKNLHGDKLNTYLDTYFGKAWGHFDVNRTGMIEVIKMPQFMRFLASDQYMSLQ*
Ga0115007_1115777013300009441MarineMIENYALEEKTEDGLPTGKFWINEAICRAACSEVLATHKGLTGKKLTEYLDTYFTKTWGHFDVNRTGLIEVIKMP*
Ga0115013_1052342713300009550MarineIFMRSMISNYAMEEKTEDGVPSGRFWMNESITRAAAREVLETHKGLSGAKLNEYLETYFQKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQ*
Ga0115101_119360723300009592MarineMLGDSIIGEYKRVTPPRFADDTDDIFMRSMIEQYALEQKTKKGFPSGNFWMNEATTRAAAAEVLETHKGMKGGELASYLEKYFPKAWRHFDVNMTGFVEVIKMPQFMRFLASDQYMTLQP
Ga0115011_1149109013300009593MarineMIQQYALEAKGAKDAPNEGEPTGHFWMNEATTRAAASEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLAADQYMSLGE*
Ga0115011_1204980913300009593MarineAMEEKTEDGVPSGRFWMNESITRAAAREVLETHKGLTGDKLNTYLDTYFGKAWGHFDVNRTGLIEVIKMPQFMRFLASDQYMSLQ*
Ga0115102_1070724323300009606MarineMLGDSIIGEYKRVTPPRFADDTDDIFMRSMIEQYALEQKTKKGFPSGNFWMNEATTRAAAAEVLETHKGMKGGELASYLEKYFPKAWRHFDVNMTGFVEVIKMP
Ga0115105_1044159213300009679MarineDIFMRSMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRGGFVEVIKMPMLMRFLASDQYMSLGE*
Ga0115105_1053919223300009679MarineMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASD
Ga0115105_1076051613300009679MarineMLGNLGPMEGGYERVTPARFAADSDDIFMRSMIEQYALEQKTKEGYPSGKFWMDESGARAAANEIIETNCKKTGAAKQKWMDTYFSKAWGHFDVNRTGKIEVIKMPQFARFLCSDQQMYLW*
Ga0115105_1093689123300009679MarineMIEHYALEEKTKDGLPSGKFWMNEATSRAASAEVLETHKGLAGEALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQP*
Ga0129324_1033166723300010368Freshwater To Marine Saline GradientYALEQKTKAGAPSGKFWMNEAGTRAAATEVLTNNVHMKAADVGKYLDTYFAKAWGHFDVNRVGQVEVAKMPLFMRFLASDQYLSLQHY*
Ga0133547_1217114223300010883MarineMIEQYALEAKGAKDAPNEGEPTGHFWMNEATTRAAASEVLATHKGLSGGALQAYLDTYFARTWAHFDVNRTGSVEVIKMPQLMRFLASD*
Ga0138326_1100441623300010985MarineMIQNYALEEKTEDGVPSGRFWMNKPSTILAAKEVLGTHKGLKGAELDAYMKTYFDRVWSHFDVNGAGFIEVLKAPQFMRFLASD
Ga0138324_1032545413300010987MarineMIQQYALEAKGAKDAPNEGEPTGHFWMNEATTRAAASEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE*
Ga0138324_1039576013300010987MarineMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAASEVLATHKGLSGGALQSYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE*
Ga0129326_108092613300012522AqueousSNEYFLPTHDGALGLNGEGYERVVPANYAADNDDIFMRSMVENYALEQKTKAGAPSGKFWMNEAGTRAAATEVLTSNVHMKAADVPKYLETYFAKAWGHFDVNRVGKVEVIKMPQFMRFLASDQYLSLQHY*
Ga0163179_1178366413300012953SeawaterIFMRSMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGAVEVIKMPQLMRFLASD*
Ga0129327_1091436523300013010Freshwater To Marine Saline GradientLETKNKDGSPTGTFQMSEATTKAAATEVLGTHKGLKGAELEAYLNTYFAKAWAHFDVNKTGAVEVIKMPQFMRFLASDQNLSLGESA*
Ga0182074_119099023300016735Salt MarshMLGSGGYDRVVPANFAADEDDIFMRSMIKTYALEQKTKEGFPSGKFWMDEAGTRSAASEVLATNAKMAAADIPKYLDTYFAKAWGHFDVNRTGKVEVIKMPQFMRFLASNQQMYLW
Ga0181431_107410323300017735SeawaterMITNYAMEEKSDEGVPTGKFWMNESITRAAAREVLETHKGLTGSKLNEYLETYFQKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQ
Ga0181559_1061537313300018415Salt MarshMLGGGAYNRVTPANFAADDDDIFMRSMINQYADEGKNKDGSPNGKFWLTESATRAAAAEVLATNAHMAAAAIPGYLNTYFAKAWGHFDVNRTGKVEVIKMPQLMRFLASDQQMYLW
Ga0181593_1109849813300018423Salt MarshIFMRSMIEQYALEQKNKDGTPSGKFWMDEAATRAAAREVLETNCKVTGAARDNWLNTYFAKAWNHFDVNRTGKVEVIKMPQFMRFLCSDQQMYLW
Ga0181591_1087926413300018424Salt MarshDDIFMRSMIEQYALEQKNKDGTPSGKFWMDEAATRAAAREVLETNCRVSGKARDDWLNTYFSKAWGHFDVNRTGKVEVIKMPQFMRFLCSDQQMYLW
Ga0188862_102577113300018622Freshwater LakeMIQNYALEEKTEDGVPSGRFWMNESITRAAAREVLETHKGLSGSKLNEYLDTYFAKTWGHFDVNRTGLVEVIKMPQLMRFLASDQYMSLQ
Ga0192842_102290213300018625MarineTPRFSADSDDIFMRSMIENYALEQKTKDGFPSGQFWMNDAATRAAAEEVLESHMGLSGEDLQSYLDKYFGKAWGHFDVNQTGYIEVIKMPQFMRFLASDQYMSLGEDPVRKIR
Ga0193355_101087613300018628MarineMIQQYALEAKGAKDAPNEGEPTGHFWMNEATTRAAASEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0193166_102693513300018674MarineRVTPSRFSADSDDIFMRSMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAASEVLATHKGLSGAALASYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0192983_103564623300018684MarineMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLETHKGLTGGARDAYMQTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLSSDQYMTLQP
Ga0192983_105147013300018684MarineMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGSRAAAMEVLGTHKGLDGAALASYMESYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMTLQP
Ga0193517_105230923300018725MarineMIQQYALEAKGEKDAPNEGQPTGVFVMNEATSRAAAAEVLHTHKGLSGAALQSYLDTYFPRTWAHFDVNRTGTVEVIKMPQLMRFLASD
Ga0193517_106654913300018725MarineMRSMIENYALEEKTEDGVPSGKFWMNEAITKAASREVLETHKGLSGKKLNEYLDTYFAKAWGHFDVNRTGLVEVIKMPMFMRFLCSDQYMSLQ
Ga0193517_106799013300018725MarineMRSVLNNYAIEGATKEGVPTGHFYMTEATTRALASEVLCTHKALCGAALSTYLDTYFAKAWGHFDVNKGGSVEAIRMPQLMRFLASDQYMSLQ
Ga0193517_108153313300018725MarineAARFAADSDDIFMRSMIANYALEEKTEDGLPSGHFWMNESITRAAAREVLATHKKLSGDKLNKYMDTYFGKAWGHFDVNRTGFVEVIKMPQFMRFLCSDQYMPLQ
Ga0193031_103975413300018765MarineMIQQYALEAKGAKDAPNEGEPTGHFVMNEATTRAAAAEVLNTHKGLSGAALQSYLDTYFPRTWAHFDVNRTGTVEVIKMPMLMRFLASDQYMSLGE
Ga0193031_109269813300018765MarineYALEAKGAKDAPNEGEPTGHFWMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0193149_103982723300018779MarineMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAASEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGHVEVIKMPQLMRFLASDQYMSLGE
Ga0193253_108066523300018846MarineMLGDSIVGEYKRVIPARFEEDTGDIFMRSMLENYALEQKTKKGFPSGNFWMNESTTRAAAAEVLETHKGMKGEELTSYLDKYFVKAWNHFDVNRTGYVEVIKMPQFMRFIASDQYMSLQP
Ga0193475_103890813300018855MarineMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0193475_103893213300018855MarineMRSMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAASEVLATHKGLSGAALGSYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0192977_105926513300018874MarineMLGDSIIGEYKRVTPIRFADDTDDIFMRSMIEQYSLEQKTKKGFPSGNFWMNEATTRAAAAEVLETHKGLKASELGEYMGKYFGKAWNHFDVNRTGFVEVIKMPQFMRFLASDQYMSLQP
Ga0192894_1032097413300018968MarineMRSMIQQYALEAKSKAKATEGEPTGHFWMNEATARAAASEVLATHKGLAGGALQKYLDTYFPRSWAHFDVNRTGFIEVIKMPQFMRFLASDQYMSLGESG
Ga0193353_1014832213300018977MarineMRSMYNTYALEAKSKDEKTEGDPTGVFLMNEATARAAATEVLGTHKGLKGAAAQKYLDTYFPRSWAHFDVNRTGMIEIIKMPQFMRFLCSDQYMSLGE
Ga0193017_1019688423300018983MarineMRSMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAASEVLATHKGLSGSALQSYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0193030_1013763623300018989MarineMRSMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAASEVLATHKGLSGAALQSYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0193030_1018480813300018989MarineMEEKSKDKENGTEGEPTGHFWMNEATARAAASEVLGTHKGLKGEALSKYLDTYFPRTWAHFDVNRTGFVEVIKMPMFMRFLASDQYMSLGE
Ga0193030_1022187913300018989MarineKAYERVVPPRFAADSDDIFMRSMIENYALELKTKEDELPSGKFFMNETTTRAASREVLNTHKGLSGKKLDKYMETYFAKAWGHFDVNRSGVVEADKMPQFMRFLCSDQYMSLQ
Ga0193030_1022378413300018989MarineMRSMIENYALEEKTEDGVPSGKFWMNEAITKAASREVLETHKGLTGKKLNEYLDTYFAKAWGHFDVNRTGLVEVIKMPMFMRFLCSDQYMSLQ
Ga0193034_1018921913300019001MarineMIENYALEEKTEDGVPSGKFWMNEAITKAASREVLETHKGLTGKKLNEYLDTYFAKAWGHFDVNRTGLVEVIKMPMFMRFLCSDQYMSLQ
Ga0192951_1017746723300019022MarineMRSMIEQYALEQKNKDGTPSGKFWMDEAATRAAAREALETNCKVTGKARDNWLNTYFAKAWNHFDVNRTGKIEVIKMPQLMRFLCSDQQMYLW
Ga0193516_1017591523300019031MarineMRSMIQQYALEAKGEKDAPNEGQPTGVFVMNEATSRAAAAEVLHTHKGLSGAALQSYLDTYFPRTWAHFDVNRSGTIEVIKMPQFMRFLASDQYMSLGE
Ga0193516_1025471113300019031MarineMIANYALEEKTEDGLPSGHFWMNESITRAAAREVLATHKKLSGDKLNKYMDTYFGKAWGHFDVNRTGFVEVIKMPQFMRFLCSDQYMALQ
Ga0193516_1027986513300019031MarineMRSMISTYALEEKEKDTGVPLGKFWMNEATTRAAASEVLATHKGLKGAALEKYLATYFAKAWGHFDVNKTGTVEVIKMPQFMRFLASDQTMSLGS
Ga0193037_1027360123300019033MarineLKQNKDKATEGEPTGHFWMNEATARAAASEVLATHKGLHGAALQKYLDTYFPRSWAHFDVNRTGFIEVIKMPQFMRFLASDQYMSLGE
Ga0192981_1023102413300019048MarineMLGGGGYERATTTRFAADSDDIFMRSMIEQYALEQKTKEGYPSGKFWMDEAGTRAASSEVLETNCNMKGAARDQWLKTYFGKAWGHFDVNRTGKVEVIKMPQFMRFLCSDQRMYLW
Ga0192981_1024655113300019048MarineMRSMIENYALEEKSCNEDGEACVPSAHFWMSESASRSAASEVLNTHKGLSGEALSSYLDTYFGKAWGHFDVNRVGYVEVIKMPQFMRFLCSDQYMSLGESG
Ga0192981_1036971613300019048MarineGAGEYERVVPARFSADSDDIFMRSMIKNYAMEEKTGDGTPSGHFWMNESITRAAAREVLESHKGLSGPKLDAYLDTYFGKAWGHFDVNRTGLVEVIKMPQLMRFLSSDQYMALQ
Ga0182073_128503923300019274Salt MarshMLGSGGYDRVVPANFAADEDDIFMRSMIKTYALEQKTKEGFPSGKFWMDEAGTRAAASEVLATNAKMAAADIPKYLDTYFAKAWGHFDVNRTGKVEVIKMPQFMRFLASNQQMYLW
Ga0182044_136997213300020014Salt MarshHSGEYFIPTLDGADGVNDGYSRVIPSRFAADSDDIFMRSMIKTYALEQKTKEGNPSGKFWMNEAGARAAAAEVLANNVHMKAADIPKYLDTYFAKAWGHFDVNRTGMVEVIKMPLFMRFLASDQYLSLQHY
Ga0206691_153913523300021342SeawaterMRSMIENYALEEKSCDEDGEHCVPSAHFWMSESASRSAASEVLNTHKGLSGEALSSYLDTYFGKAWGHFDVNRVGYVEVINMPQFMRFLCSDQYMSLGESG
Ga0206691_159047913300021342SeawaterMISNYALEEKTKEGVPTGAFWMNEATSRAAASEVLATHKGMSGAGLQKYLDTYFSKAWGHFDVNRTGTIEVIKMPQFMRFLAS
Ga0206691_180533623300021342SeawaterMAGGGEYKRVVTSRFAADSDDIFMRSMIGNYALEEKTKDGEPTGKFWMNEATTRAAASEVLGTHKSLKGDALGKYLDTYFAKAWGHFDVNRTGTIEVIKMPQFMRFLASDQYMSLQ
Ga0206688_1051705723300021345SeawaterMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYM
Ga0206688_1076627723300021345SeawaterMRSMIEHYAMEEKTEDDLPSAKFWMNESITRAAAREVLETHKGLSGPKLDKYMDTYFQKAWGHFDVNRTGLVEVIKMP
Ga0206688_1080324213300021345SeawaterMRSMIENYALEEKTKEDELPSGKFWMNEQTTRAAAREVLSTHKGLEGAKLNTYMDTYFSKSWGHFDVNRTGMVEVIKMPQFMRFLCSDQYMSLQ
Ga0206690_1011346513300021355SeawaterMITNYALEAKYNNADDKTDPRNGEPTGAFWMNEATTRAAAAEVLATHKGLAGAELQKYLDTYFSKAWGHFDVNRTGFVEVIKMP
Ga0206690_1081618413300021355SeawaterMVDGSGYTRVTTARFAADSDDIFMRSMIEAYAVEGKTFGGEPSGQFYMNKSTSRAASEEVLATHKGLAGGALSSYMDTYFEKTFNHFDVNRTGEIEVIKMPQFMRFLCSDQYMQLGESGQ
Ga0206689_1004628713300021359SeawaterMRSMIKNYAMEEKTEDCVPAGKFWMNESITRAAAREVLETHKGLSGDKLNKYMDTYFAKAWGHFDVNRTGLVEVIKMPQLMRFLASDQYMSLQ
Ga0063097_105332913300021898MarineMGEYKRVTPPRFADDTDDIFMRSMIEQYALEQKTKKGFPSGNFWMNEATTRAAASEVLATHKGMVGGELASYMEKYFPKAWNHFDVNRTGFVEVIKMPQFMRFLSSDQYMTLQP
Ga0063144_104055623300021899MarineMIQQYALEAKGAKDAPNEGEPTGHFWMNEATTRAAASEVLATHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0063086_101633623300021902MarineMRSMINNYALEEKTEDGVPSGRFWMNEQITRAAAREVLETHKGLSGAKLNDYMNTYFSKAWGHFDVNRTGLVEVIKMPQFMRFICSDQYMSLQ
Ga0063086_102008113300021902MarineMRSMINNYALEEKTADGVPSGHFWMNESITRAAAREVLETHKGLSGNKLAEYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLSSDQYMSLQ
Ga0063131_107016923300021904MarineMRSMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAASEVLATHKGLSGAALGSYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSL
Ga0063103_113124923300021927MarineMRSMINNYALEEKSEDGVPSGHFWMNESITRAAAREVLETHKGLSGTKLAEYLDTYFAKAWGHFDVNRTGLIEVIKMPQFMRFLSSDQYMSLQ
Ga0222717_1037972313300021957Estuarine WaterDIFMRSMIQNYALEEKTEDGVPSGRFWMNESITRAAAREVLETHKGLSGQKLNEYLDTYFAKTWGHFDVNRTGLVEVIKMPQLMRFLASDQYMSLQ
Ga0222716_1022027113300021959Estuarine WaterMIQNYALEEKTEDGVPSGRFWMNESITRAAAREVLETHKGLSGQKLNEYLDTYFAKTWGHFDVNRTGLVEVIKMPQLMRFLASDQYMSLQ
Ga0222713_1048675513300021962Estuarine WaterMLGGGEYKRVIPARFAADDDDIFMRSMIKNYADEGKNKDGSPNGSFTLTEAAARAAASEVLATNAKMNPKDIPGYLNTYFAKAWGHFDVNRTGRVEVIKMPQFMRFLASD
Ga0222719_1054161213300021964Estuarine WaterPDGALGLNGEGYERVIPARFAADSDDIFMRSMIKTYALEQKTKEGAPSGKFWMNEAATRAAAAEVLENNVHMKSADVQSYLNTYFAKAWGHFDVNRTGMVEVIKMPLFMRFLASDQYLSLQHY
Ga0255758_1040645813300022928Salt MarshQHDMLGGGAYNRVTPARFAADDDDIFMRSMINQYADEGKNKDGSPNGNFWLTESSTRAAAAEVLATNAKMPAAAIPGYLNQYFAKAWGHFDVNRTGKVDVIKMPQFMRFLASDQQLYLW
Ga0255768_1061841813300023180Salt MarshFMRSMIKTYALEQKTKEGFPSGKFWMDEAGTRAAASEVLATNAKMAAADIPKYLDTYFAKAWGHFDVNRTGKVEVIKMPQFMRFLASNQQMYLW
(restricted) Ga0233435_119964913300024252SeawaterSCYEDGEHCVPSAHFWMSESASRSAASEVLNTHKGLSGEALSSYLDTYFGKAWGHFDVNRVGYVEVIKMPQFMRFLCSDQYMSLGESG
Ga0233451_1027038013300024301Salt MarshIPSRFAADSDDIFMRSMIKTYALEQKTKEGNPSGKFWMNEAGARAAAAEVLANNVHMKAADIPKYLDTYFAKAWGHFDVNRTGMVEVIKMPLFMRFLASDQYLSLQHY
Ga0209653_120283213300025695MarineDSDDIFMRSMIEQYALEQKTKEGNPSGKFWMNEATTRAAAREVLETHKGLKGAALDKYLNTYFAKAWGHFDVNRSGLVEVIKMPQFMRFLASDQYMSLQP
Ga0209631_1039429713300025890Pelagic MarineSDDIFMRSMVQQYALEQKTKEGAPSGKFWMNEAATRAASVEVLTNNVHMKSADVGKYLDTYFAKAWGHFDVNRVGQVEVAKMPSFMRFLASDQYLSLQHY
Ga0208763_103864113300026136MarineFMRSMIQQYALEAKGAKDAPNEGEPTGHFWMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0208275_104213323300026182MarineMISNYALEGKEKDTGVPLGDFWMSEATTRAAASEVLATHKGMTGDVLQKYLDTYFSKAWGHFDVNRTGMVEVIKMPQFMRFLASDQYMPLQP
Ga0247602_112801613300026471SeawaterMRSMISNYAMEEKTEDGVPSGRFWMNESITRAAAREVLETHKGLSGNRLNEYLETYFQKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQ
Ga0247571_117336913300026495SeawaterDDIFMRSMIENYALEQKTKKGFPSGNFWMNEATTRAAAAEVLETHKGMKGGELTSYLDKYFGKAWNHFDVNRTGFVEVIKMPQFMRFIASDQYMSLQP
Ga0208020_107728513300027159EstuarineMLGGGGYERSTPSRFAADSDDIFMRSMIEQYALEQKTKEGYPSGKFWMDEAATRAAATEVLETNCGMKADKAKYIDTYFAKAWGHFDVNRSGKVEVIKMPQFMRFLCSDQQMYLW
Ga0209404_1071793413300027906MarinePRFAADSDDIFMRSMIEHYAMEEKTDDDLPSGKFWMNESITRYAAKEVLETYKGLTGAKFDKYMDTYFQKAWGHFDVNRTGLVEVIKMP
(restricted) Ga0233413_1024786813300027996SeawaterMLGGGGYERQTPKRFAADSDDIFMRSMIEQYALEQKTKEGYPSGKFWMDEAATRAAASEVLETNCNMKGSSKGEWLKTYFGKAWGHFDVNRSGKVEVIKMPQFMRFLCSDQQMYLW
Ga0256412_138269813300028137SeawaterMRSMITNYALEAKNKDGSPSGKFWMDKEGARAAAAEVLETHKGIKGDELHEYLETYFPKTWAHFDVNVSGTIEVAKMPSFMRFIASD
Ga0073989_1337176113300031062MarineMIENYALEEKTEDGVPSGKFWMNEAITKAAAREVLETHKGLTGKKLNEYLDTYFAKAWGHFDVNRTGLVEVIKMPMFMRFLCSDQYMSLQ
Ga0308142_106491913300031556MarineMIEQYALEAKGAKDAPNEGEPTGHFWMNEATTRAAASEVLATHKGLSGGALQAYLDTYFARTWAHFDVNRTGSVEVIKMPQLMRFLASD
Ga0307489_1037549813300031569Sackhole BrineMLGGGGYERQTPARFAADNDDIFMRSMIEQYALEQKTKEGYPSGKFWMDEASTRAAAAEVLESNCDMKGTAKGEWLKTYFGKAWGHFDVNRSGKVEVIKMPQFMRFLCSDQQVYLW
Ga0308132_106785523300031580MarineMRSMIENYALEEKSCDEDGEHCVPSAHFWMSESASRSAASEVLNTHKGLSGEALSSYLDTYFGKAWGHFDVNRVGYVEVIKMPQFMRFLCSDQYMSLGESG
Ga0308125_108610213300031581MarineMIENYALEEKSCDEDGEHCVPSAHFWMSESASRSAASEVLNTHKGLSGDTLASYVDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLCSDQYMSL
Ga0307381_1024663023300031725MarineMEEKSEDGLPTGHFWMNESITRAAAREVLETHKGLGGEGLNKYLDTYYAKAWGHFDVNRTGLVEVIKMP
Ga0307381_1028919313300031725MarineMRSMIKNYAMEEKTEDCVPAGKFWMNESITRAAAREVLETHKGLSGDKLNKYMDTYFGKAWGHFDVNRTGLVEVIKMPQLMRFLASDQYMSLQ
Ga0307384_1051326123300031738MarineMINNYAMEEKTDDGVPSGRFWMNESITRAAAREVLETHKGLSGSKLNEYLDTYFQKSWGHFDVNRTGLIEVIKMPQFMRFLSSDQYMSLQ
Ga0307384_1063669513300031738MarineDDIFMRSMIQQYALEAKGAKDAPNEGEPTGHFVMNEATTRAAAAEVLNTHKGLSGAALQSYLDTYFPRTWAHFDVNRAGAVEVIKMPMLMRFLASDQYMSLGE
Ga0314669_1062497123300032708SeawaterMGEYKRVTPPRFADDTDDIFMRSMIEQYALEQKTKKGFPSGNFWMNEATTRAAASEVLATHKGMVGGELASYMEKYFPKAWNHFDVNRTGFVEVIKMPQFMRFLSSDQYMTP
Ga0310342_10230611213300032820SeawaterMRSMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAAAEVLATHKGLSGDALGKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.