| Basic Information | |
|---|---|
| Family ID | F072721 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VSAVFVVVSLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 39.67 % |
| % of genes near scaffold ends (potentially truncated) | 20.66 % |
| % of genes from short scaffolds (< 2000 bps) | 90.08 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.69 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.595 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (20.661 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.099 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.934 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.41% β-sheet: 0.00% Coil/Unstructured: 44.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF13466 | STAS_2 | 42.15 |
| PF11706 | zf-CGNR | 33.06 |
| PF13302 | Acetyltransf_3 | 3.31 |
| PF00072 | Response_reg | 2.48 |
| PF13090 | PP_kinase_C | 2.48 |
| PF08281 | Sigma70_r4_2 | 1.65 |
| PF01471 | PG_binding_1 | 1.65 |
| PF00005 | ABC_tran | 1.65 |
| PF02504 | FA_synthesis | 0.83 |
| PF01195 | Pept_tRNA_hydro | 0.83 |
| PF00207 | A2M | 0.83 |
| PF00353 | HemolysinCabind | 0.83 |
| PF01850 | PIN | 0.83 |
| PF16576 | HlyD_D23 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0193 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.60 % |
| Unclassified | root | N/A | 31.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_117977947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300002568|C688J35102_119209283 | Not Available | 655 | Open in IMG/M |
| 3300002568|C688J35102_119864330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
| 3300002568|C688J35102_120524414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1144 | Open in IMG/M |
| 3300002568|C688J35102_120535846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1155 | Open in IMG/M |
| 3300004081|Ga0063454_101807829 | Not Available | 535 | Open in IMG/M |
| 3300004081|Ga0063454_102074344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300004114|Ga0062593_101281330 | Not Available | 775 | Open in IMG/M |
| 3300005093|Ga0062594_101668614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 664 | Open in IMG/M |
| 3300005327|Ga0070658_10254890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1489 | Open in IMG/M |
| 3300005338|Ga0068868_100838060 | Not Available | 832 | Open in IMG/M |
| 3300005344|Ga0070661_101078143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300005355|Ga0070671_101602514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 577 | Open in IMG/M |
| 3300005366|Ga0070659_100121061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2119 | Open in IMG/M |
| 3300005440|Ga0070705_100510932 | Not Available | 914 | Open in IMG/M |
| 3300005564|Ga0070664_100338249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1367 | Open in IMG/M |
| 3300005614|Ga0068856_102441988 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006031|Ga0066651_10462876 | Not Available | 672 | Open in IMG/M |
| 3300006169|Ga0082029_1741812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 784 | Open in IMG/M |
| 3300006196|Ga0075422_10275642 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300006755|Ga0079222_10437043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
| 3300006844|Ga0075428_100630666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1144 | Open in IMG/M |
| 3300006853|Ga0075420_101235259 | Not Available | 642 | Open in IMG/M |
| 3300006918|Ga0079216_10361017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 892 | Open in IMG/M |
| 3300006918|Ga0079216_10487366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 809 | Open in IMG/M |
| 3300007004|Ga0079218_12985340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 569 | Open in IMG/M |
| 3300009094|Ga0111539_10563138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 1327 | Open in IMG/M |
| 3300009094|Ga0111539_12771379 | Not Available | 568 | Open in IMG/M |
| 3300009098|Ga0105245_12403242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 580 | Open in IMG/M |
| 3300009100|Ga0075418_11063869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 876 | Open in IMG/M |
| 3300009147|Ga0114129_11396837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 864 | Open in IMG/M |
| 3300009147|Ga0114129_12611212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300009156|Ga0111538_10258417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2204 | Open in IMG/M |
| 3300009156|Ga0111538_11600469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
| 3300009162|Ga0075423_10702452 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300009789|Ga0126307_10062378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2924 | Open in IMG/M |
| 3300009789|Ga0126307_10139680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1936 | Open in IMG/M |
| 3300009789|Ga0126307_10197667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1613 | Open in IMG/M |
| 3300009789|Ga0126307_10236051 | Not Available | 1469 | Open in IMG/M |
| 3300009789|Ga0126307_10480223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1003 | Open in IMG/M |
| 3300009789|Ga0126307_11017242 | Not Available | 670 | Open in IMG/M |
| 3300009789|Ga0126307_11094307 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300009840|Ga0126313_10009792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 5993 | Open in IMG/M |
| 3300009840|Ga0126313_10025651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3983 | Open in IMG/M |
| 3300009840|Ga0126313_10483820 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300009840|Ga0126313_10994960 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium | 687 | Open in IMG/M |
| 3300009840|Ga0126313_11169745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 633 | Open in IMG/M |
| 3300010036|Ga0126305_10325682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
| 3300010037|Ga0126304_10932138 | Not Available | 591 | Open in IMG/M |
| 3300010037|Ga0126304_11204580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 519 | Open in IMG/M |
| 3300010038|Ga0126315_10087940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1761 | Open in IMG/M |
| 3300010038|Ga0126315_10951687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
| 3300010039|Ga0126309_10009225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3995 | Open in IMG/M |
| 3300010039|Ga0126309_10628184 | Not Available | 680 | Open in IMG/M |
| 3300010040|Ga0126308_10006952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5443 | Open in IMG/M |
| 3300010040|Ga0126308_10240425 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300010042|Ga0126314_10125791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1767 | Open in IMG/M |
| 3300010044|Ga0126310_10746324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 747 | Open in IMG/M |
| 3300010166|Ga0126306_10036848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 3336 | Open in IMG/M |
| 3300010166|Ga0126306_10218481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 1445 | Open in IMG/M |
| 3300012043|Ga0136631_10112615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1039 | Open in IMG/M |
| 3300012093|Ga0136632_10309226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 711 | Open in IMG/M |
| 3300012184|Ga0136610_1300653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
| 3300012684|Ga0136614_10252098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1319 | Open in IMG/M |
| 3300013104|Ga0157370_10905013 | Not Available | 801 | Open in IMG/M |
| 3300014488|Ga0182001_10352324 | Not Available | 620 | Open in IMG/M |
| 3300015373|Ga0132257_102176129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
| 3300017654|Ga0134069_1177734 | Not Available | 720 | Open in IMG/M |
| 3300017787|Ga0183260_10012828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 6454 | Open in IMG/M |
| 3300017965|Ga0190266_10213987 | Not Available | 934 | Open in IMG/M |
| 3300018422|Ga0190265_10107443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2633 | Open in IMG/M |
| 3300018422|Ga0190265_10148779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2287 | Open in IMG/M |
| 3300018422|Ga0190265_11877218 | Not Available | 706 | Open in IMG/M |
| 3300018422|Ga0190265_11972002 | Not Available | 690 | Open in IMG/M |
| 3300018422|Ga0190265_12712746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 592 | Open in IMG/M |
| 3300018429|Ga0190272_10285682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1267 | Open in IMG/M |
| 3300018432|Ga0190275_13009783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 545 | Open in IMG/M |
| 3300018432|Ga0190275_13308158 | Not Available | 522 | Open in IMG/M |
| 3300018466|Ga0190268_10917446 | Not Available | 684 | Open in IMG/M |
| 3300018466|Ga0190268_11289471 | Not Available | 615 | Open in IMG/M |
| 3300018476|Ga0190274_12664191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 597 | Open in IMG/M |
| 3300019377|Ga0190264_10856815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 702 | Open in IMG/M |
| 3300019767|Ga0190267_11084237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300020181|Ga0196958_10042324 | Not Available | 1384 | Open in IMG/M |
| 3300022756|Ga0222622_10371826 | Not Available | 1001 | Open in IMG/M |
| 3300022883|Ga0247786_1101626 | Not Available | 622 | Open in IMG/M |
| 3300025920|Ga0207649_11145407 | Not Available | 614 | Open in IMG/M |
| 3300025925|Ga0207650_10600262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 926 | Open in IMG/M |
| 3300025932|Ga0207690_11652304 | Not Available | 535 | Open in IMG/M |
| 3300025945|Ga0207679_10566607 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300026023|Ga0207677_11015469 | Not Available | 753 | Open in IMG/M |
| 3300026023|Ga0207677_11902178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300026116|Ga0207674_10540473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1126 | Open in IMG/M |
| 3300026121|Ga0207683_11984268 | Not Available | 530 | Open in IMG/M |
| 3300027638|Ga0208612_1107245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 718 | Open in IMG/M |
| 3300027691|Ga0209485_1216418 | Not Available | 603 | Open in IMG/M |
| 3300027880|Ga0209481_10243392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 905 | Open in IMG/M |
| 3300028596|Ga0247821_10667156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 676 | Open in IMG/M |
| 3300028596|Ga0247821_10795550 | Not Available | 623 | Open in IMG/M |
| 3300028721|Ga0307315_10174878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 659 | Open in IMG/M |
| 3300028744|Ga0307318_10200173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 691 | Open in IMG/M |
| 3300028771|Ga0307320_10183953 | Not Available | 815 | Open in IMG/M |
| 3300028811|Ga0307292_10395629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
| 3300028875|Ga0307289_10157557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
| 3300028881|Ga0307277_10010295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3600 | Open in IMG/M |
| 3300030336|Ga0247826_11092876 | Not Available | 636 | Open in IMG/M |
| 3300030336|Ga0247826_11254381 | Not Available | 596 | Open in IMG/M |
| 3300030336|Ga0247826_11376382 | Not Available | 570 | Open in IMG/M |
| 3300031548|Ga0307408_101444205 | Not Available | 649 | Open in IMG/M |
| 3300031731|Ga0307405_10425143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1047 | Open in IMG/M |
| 3300031903|Ga0307407_11045803 | Not Available | 633 | Open in IMG/M |
| 3300031938|Ga0308175_101421008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 774 | Open in IMG/M |
| 3300031995|Ga0307409_101059574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 831 | Open in IMG/M |
| 3300031995|Ga0307409_101902695 | Not Available | 624 | Open in IMG/M |
| 3300032004|Ga0307414_10617689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 974 | Open in IMG/M |
| 3300032005|Ga0307411_10841814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 811 | Open in IMG/M |
| 3300032080|Ga0326721_10081232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 1501 | Open in IMG/M |
| 3300032080|Ga0326721_10101247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 1378 | Open in IMG/M |
| 3300032080|Ga0326721_10308448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 885 | Open in IMG/M |
| 3300033550|Ga0247829_11494214 | Not Available | 558 | Open in IMG/M |
| 3300034268|Ga0372943_0979964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 20.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.01% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 5.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.79% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 4.13% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012184 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027638 | Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1179779471 | 3300002568 | Soil | TPVLVVLSIALYVAGLVLLAWEGRRDAAIVLAAVGGVGLSIFTLP* |
| C688J35102_1192092832 | 3300002568 | Soil | MPVLVVASILVYVAGLVLLAWEGRRDVAILLAAVGGVALSIVTLP* |
| C688J35102_1198643302 | 3300002568 | Soil | MTPVLVVLSIALYVAGLVLLAWEGRRDAAIALAAIGGVGLSIFTLP* |
| C688J35102_1205244143 | 3300002568 | Soil | VGPVLVVASILVYVAGLVLLAWEGRRDLAILLAAVGGVALSIVTLP* |
| C688J35102_1205358462 | 3300002568 | Soil | MTPVLVVLSIALYVAGLVLLAWEGRRNAAILLAVVGGVGLSIFTLP* |
| Ga0063454_1018078291 | 3300004081 | Soil | MMPALVVASILVYVAGLVLLAWEGRRDLAILLAAVGGVALSIVTLP* |
| Ga0063454_1020743442 | 3300004081 | Soil | VTPVLVVASIAVYVAGLVLLAWEGRRDVAILLAAVGGVALSIVTLP* |
| Ga0062593_1012813302 | 3300004114 | Soil | VFVVVSLAVYVAGLILLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0062594_1016686142 | 3300005093 | Soil | VGPVLVVASILVYVAGLVLLAWEGRRDMAILLAAVGGVALSIVTLP* |
| Ga0070658_102548902 | 3300005327 | Corn Rhizosphere | VSAVFVVVSLAVYVAGLILLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0068868_1008380602 | 3300005338 | Miscanthus Rhizosphere | VTPVLVVLSITLYVAGCILLAWEGRRDAAILLAVVGGVGLSVFTLP* |
| Ga0070661_1010781433 | 3300005344 | Corn Rhizosphere | RPDVRLDCSAVSAVFVVVSLAVYVAGLILLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0070671_1016025142 | 3300005355 | Switchgrass Rhizosphere | VSAVFVVVSLAVYAAGLVLLAWEGRRDVAILLAAAGGVALSIATLP* |
| Ga0070659_1001210611 | 3300005366 | Corn Rhizosphere | GAAATRPDVRLDCSAVSAVFVVVSLAVYVAGLILLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0070705_1005109322 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VFVVVSLAVYVAGLILLAWEGRRDLAILLAAVGGVAVSIATLP* |
| Ga0070664_1003382493 | 3300005564 | Corn Rhizosphere | VFVVVSLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0068856_1024419882 | 3300005614 | Corn Rhizosphere | VFVVVSLAVYVAGLILLAWEGRRDLAILLAAVGGVALSIAT |
| Ga0066651_104628761 | 3300006031 | Soil | MMPALVVASILVYAAGLVLLAWEGRRDLAILLAAVGGVALSIVTLP* |
| Ga0082029_17418122 | 3300006169 | Termite Nest | VSALFVIVSLAVYAAGLILLAWEGRRDLAILLAAAGGVALSIATLP* |
| Ga0075422_102756422 | 3300006196 | Populus Rhizosphere | VSAVFVVVSLAVYAAGLVLLAWEGRRDLAIVLAAVGGVALSIATLP* |
| Ga0079222_104370432 | 3300006755 | Agricultural Soil | VSAVFVVVSLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0075428_1006306663 | 3300006844 | Populus Rhizosphere | VSAVFVVCSIAVYATGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0075420_1012352592 | 3300006853 | Populus Rhizosphere | VSAVFVVSSIVVYVAGLLLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0079216_103610173 | 3300006918 | Agricultural Soil | VSAVFVIVSILVYGAGLVLLAWEGRRHLAIVLAAVGGIALSIATLP* |
| Ga0079216_104873662 | 3300006918 | Agricultural Soil | VSALFVVSSIAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0079218_129853402 | 3300007004 | Agricultural Soil | VIVSLAVYVAGLVLLAWEGRRDLAILLAAAGGVALSIATLP* |
| Ga0111539_105631382 | 3300009094 | Populus Rhizosphere | VSAAFVVISLVVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0111539_127713792 | 3300009094 | Populus Rhizosphere | VSAVFVIVSLAVYAAGLVLLAWEGRRDVAILLAAAGGVALSIATLP* |
| Ga0105245_124032422 | 3300009098 | Miscanthus Rhizosphere | MMPVLVVASILVYVAGLVLLAWEGRRDIAILLAAVGGVALSIVTLP* |
| Ga0075418_110638693 | 3300009100 | Populus Rhizosphere | VSAAFVVISLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0114129_113968372 | 3300009147 | Populus Rhizosphere | VSAVFVVSSLVVYVAGLLLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0114129_126112123 | 3300009147 | Populus Rhizosphere | SLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0111538_102584174 | 3300009156 | Populus Rhizosphere | VSAVFVVVSLAVYAAGLVLLAWEGRRDLAILLAAAGGVALSIATLP* |
| Ga0111538_116004692 | 3300009156 | Populus Rhizosphere | VTPVLVVLSITLYVAGCILLAWEGRRNAAILLAVVGGLGLSVFTLP* |
| Ga0075423_107024522 | 3300009162 | Populus Rhizosphere | VSAVFVVVSLAVYVAGLILLAAVGGVALSIATLP* |
| Ga0126307_100623783 | 3300009789 | Serpentine Soil | VTAAFVVISLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0126307_101396804 | 3300009789 | Serpentine Soil | MTAVFVVGSLLVYGAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0126307_101976673 | 3300009789 | Serpentine Soil | VTAIFVVSSLLVYGAGLVLLAWEARRDLAILLAAVGGVALSIATLP* |
| Ga0126307_102360513 | 3300009789 | Serpentine Soil | VSAVFVIVSLAVYAAGLVLLAWEGRRDLAIVLAAVGGVALSIATLP* |
| Ga0126307_104802232 | 3300009789 | Serpentine Soil | VSAVFVVTSIVVYVAGLLLLAWEGRRDLAILLAAAGGVALSIATLP* |
| Ga0126307_110172421 | 3300009789 | Serpentine Soil | TLLAVSAVFVIVSLAVYAAGLVLLAWEGRRDLAILLAAAGGVALSIATLP* |
| Ga0126307_110943071 | 3300009789 | Serpentine Soil | VTHVLVVVSILLYAAGLILLAWEGRRDAAIALAAAGGVGLSVFTLP* |
| Ga0126313_100097926 | 3300009840 | Serpentine Soil | VSALFVIVSLAVYAAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0126313_100256514 | 3300009840 | Serpentine Soil | VSAVFVVSSLAIYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0126313_104838202 | 3300009840 | Serpentine Soil | VSAVFVVSSLVVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0126313_109949602 | 3300009840 | Serpentine Soil | MPVLVVASILVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0126313_111697452 | 3300009840 | Serpentine Soil | VTALFVVGSLLVYGAGLLLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0126305_103256823 | 3300010036 | Serpentine Soil | LAVSAIFVVSSLAVYVAGLVLLAWEGRRDLAILLAAAGGVGLSIATLP* |
| Ga0126304_109321382 | 3300010037 | Serpentine Soil | LLVYGAGLLLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0126304_112045801 | 3300010037 | Serpentine Soil | VLSAIFVVSSLAVYVAGLVLLAWEGRRDLAILLAAAGGVGLSIATLP* |
| Ga0126315_100879402 | 3300010038 | Serpentine Soil | VSAVFVVSSLAIYVAGLVLLAWDGRRDLAILLAAVGGVALSIATLP* |
| Ga0126315_109516872 | 3300010038 | Serpentine Soil | MGPVLLVLSIAIYVAGCVLLAWEGRRDAAVVLAVVGGVGLSIFTLP* |
| Ga0126309_100092253 | 3300010039 | Serpentine Soil | VSALFVIVSLAVYAAGLVLLAWEGRRDLAIVLAAVGGVALSIATLP* |
| Ga0126309_106281841 | 3300010039 | Serpentine Soil | VTPVLVVVSIALYVAGLVLLAWEGRRNAAIALAAVGGLGLSVFTLP* |
| Ga0126308_100069526 | 3300010040 | Serpentine Soil | VTALFVVSSLLVYGAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0126308_102404252 | 3300010040 | Serpentine Soil | VSAIFVVSSLAVYVAGLVLLAWEGRRDLAILLAAAGGVGLSIATLP* |
| Ga0126314_101257913 | 3300010042 | Serpentine Soil | MGPVLLVLSIVIYVAGCVLLAWEGRRDAAVVLAVVGGVGLSIFTLP* |
| Ga0126310_107463241 | 3300010044 | Serpentine Soil | VSAVFVVCSLAVYAAGLVLLAWEGRRDLAILLAAAGGVALSIATLP* |
| Ga0126306_100368481 | 3300010166 | Serpentine Soil | VTAAFVVISLAVYVAGLVLLAWEGRRDLAILLAAAGGVALSIATLP* |
| Ga0126306_102184812 | 3300010166 | Serpentine Soil | VTHVLVVVSILLYAAGLILLAWEGRRDAAIALAAVGGVGLSVFTLP* |
| Ga0136631_101126152 | 3300012043 | Polar Desert Sand | MPVLVVASIAVYVAGLVLLAWEGRRDVAILLAAAGGVALSIVTLP* |
| Ga0136632_103092262 | 3300012093 | Polar Desert Sand | VTPVLIVTSIALYVAGLVLLAWEGRRQAAIVLAAVGGIGLSIFTLP* |
| Ga0136610_13006531 | 3300012184 | Polar Desert Sand | MTVLVVASIAIYVAGLVLLAWEGRRHAAIVLAAVGGVA |
| Ga0136614_102520983 | 3300012684 | Polar Desert Sand | MPVLVVASIAIYVAGLVLLAWEGRRHVAILLAAVGGVALSIVTLP* |
| Ga0157370_109050133 | 3300013104 | Corn Rhizosphere | AVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0182001_103523241 | 3300014488 | Soil | TLLAVSAVFVVCSLAVYVAGLVLLAWEGRRDLAILLAAAGGVALSIATLP* |
| Ga0132257_1021761293 | 3300015373 | Arabidopsis Rhizosphere | VYVAGLILLAWEGRRDLAILLAAVGGVALSIATLP* |
| Ga0134069_11777341 | 3300017654 | Grasslands Soil | TAMMPALVVASILVYAAGLVLLAWEGRRDLAILLAAVGGVALSIVTLP |
| Ga0183260_100128286 | 3300017787 | Polar Desert Sand | VTPVLIVTSIALYVAGLVLLAWEGRRQAAIVLAAVGGIGLSIFTLP |
| Ga0190266_102139872 | 3300017965 | Soil | VSAVFVICSLAVYAAGLVLLAWEGRRDLAIVLAAVGGVALSIATLP |
| Ga0190265_101074434 | 3300018422 | Soil | VSALFVIVSLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0190265_101487793 | 3300018422 | Soil | VLVVCSVLLYVAGLVLLAWEGRRQLAIVLAAVGGLGLSVFTLP |
| Ga0190265_118772182 | 3300018422 | Soil | VGGTLGGVTLVLLVVSIVVYVAGLVLLAWEGRRDAAILLAAVGGVGLSIFTLP |
| Ga0190265_119720022 | 3300018422 | Soil | VTPVLVVASITLYVAGLVLLAWEGRRDAAIVLAAVGGLGLSVFTLP |
| Ga0190265_127127462 | 3300018422 | Soil | VSAVFVVSSIVVYVAGLLLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0190272_102856822 | 3300018429 | Soil | VVSSLLVYGTGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0190275_130097832 | 3300018432 | Soil | VTAVFVVLSLLVYGAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0190275_133081582 | 3300018432 | Soil | VTLVLLVVSIAVYVAGLVLLAWEGRRDAAILLAAVGGVGLSIFTLP |
| Ga0190268_109174463 | 3300018466 | Soil | VFVVSSLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0190268_112894712 | 3300018466 | Soil | VVSSLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0190274_126641912 | 3300018476 | Soil | VSALFVIVSLAVYAAGLVLLAWEGRRDLAIVLAAVGGVALSIATLP |
| Ga0190264_108568152 | 3300019377 | Soil | VFVVSSIVVYVAGLLLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0190267_110842372 | 3300019767 | Soil | VVISLAVYVAGLVLLAWEGRRDLAILLAAAGGVALSIATLP |
| Ga0196958_100423243 | 3300020181 | Soil | VSAVFVIVSILVYGAGLVLLAWEGRRHLAILLAAAGGVALSIATLP |
| Ga0222622_103718262 | 3300022756 | Groundwater Sediment | VISSLAVYAAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0247786_11016262 | 3300022883 | Soil | VFVVVSLAVYVAGLILLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0207649_111454072 | 3300025920 | Corn Rhizosphere | VSAVFVLVSLAVYAAGLVLLAWEGRRDLAILLAAAGGVALSIATLP |
| Ga0207650_106002623 | 3300025925 | Switchgrass Rhizosphere | VSAVFVVVSLAVYVAGLILLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0207690_116523042 | 3300025932 | Corn Rhizosphere | VSAAFVVVSLAVYVAGLILLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0207679_105666072 | 3300025945 | Corn Rhizosphere | VFVVVSLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0207677_110154692 | 3300026023 | Miscanthus Rhizosphere | VTPVLVVLSITLYVAGCILLAWEGRRDAAILLAVVGGVGLSVFTLP |
| Ga0207677_119021782 | 3300026023 | Miscanthus Rhizosphere | MMPVLVVASILVYVAGLVLLAWEGRRDIAILLAAVGGVALSIVTLP |
| Ga0207674_105404733 | 3300026116 | Corn Rhizosphere | VSAVFVVVSLAVYAAGLVLLAWEGRRDLAILLAAAGGVALSIATLP |
| Ga0207683_119842682 | 3300026121 | Miscanthus Rhizosphere | MPVLVVLSIALYVAGCVLLAWEGRRDVAILLAVVGGVGLSVFTLP |
| Ga0208612_11072452 | 3300027638 | Polar Desert | MTVLVVASIAIYVAGLVLLAWEGRRHAAIVLAAVGGVALSIVTLP |
| Ga0209485_12164182 | 3300027691 | Agricultural Soil | VSAVFVIVSILVYGAGLVLLAWEGRRHLAIVLAAVGGIALSIATLP |
| Ga0209481_102433922 | 3300027880 | Populus Rhizosphere | VSAAFVVISLVVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0247821_106671562 | 3300028596 | Soil | VVSSLAVYVAGLILLAWEGRRDLAILLAAAGGVALSIATLP |
| Ga0247821_107955502 | 3300028596 | Soil | VSAVFVVISLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0307315_101748781 | 3300028721 | Soil | VTAIFVISSLAVYAAGLVLLAWEGRRDLAILLAAVGG |
| Ga0307318_102001732 | 3300028744 | Soil | VISSLAVYAAGLVLLAWEGRRDLAILLAAVGAVALSIATLP |
| Ga0307320_101839532 | 3300028771 | Soil | MPALVVASILVYVAGLVLLAWEGRRDVAILLAAVGGVALSIVTLP |
| Ga0307292_103956291 | 3300028811 | Soil | VTAIFVISSLAVDAAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0307289_101575572 | 3300028875 | Soil | VTAVFVISSLAVYAAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0307277_100102955 | 3300028881 | Soil | MPVLVVASIAVYVAGIVLLAWEGRRDVAILLAAVGGVALSIVTLP |
| Ga0247826_110928762 | 3300030336 | Soil | VSAAFVVISLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0247826_112543812 | 3300030336 | Soil | VSPVLVVASLLVYCAGLVLLAWEGRRDMAILLAAVGGVALSIVTLP |
| Ga0247826_113763822 | 3300030336 | Soil | VVSSLAVYVAGLLLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0307408_1014442051 | 3300031548 | Rhizosphere | VVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0307405_104251433 | 3300031731 | Rhizosphere | SLVVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0307407_110458031 | 3300031903 | Rhizosphere | PAATLLAVSAVFVVSSLVVYVAGLVLLAWEGRRDLAILLAAVGGVALRIATLP |
| Ga0308175_1014210083 | 3300031938 | Soil | LAVYAAGLVLLAWEGRRDLAILLAAAGGVALSIATLP |
| Ga0307409_1010595742 | 3300031995 | Rhizosphere | VTAAFVVISLAVYVAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0307409_1019026951 | 3300031995 | Rhizosphere | SDTGRGGLRLHCRPVSALFVVVSLAVYVAGLVLLAWEGRRDLAILLAAAGGVALSIATLP |
| Ga0307414_106176892 | 3300032004 | Rhizosphere | VSALFVIVSLAVYAAGLVLLAWEGRRDLAILLAAVGGVALSIATLP |
| Ga0307411_108418143 | 3300032005 | Rhizosphere | GLRLHCRPVSALFVVVSLAVYVAGLVLLAWEGRRDLAILLAAAGGVALSIATLP |
| Ga0326721_100812322 | 3300032080 | Soil | MTAVFVVGSLLLYGAGLVLLAWEERRDLAILLAAVGGVALSIATLP |
| Ga0326721_101012472 | 3300032080 | Soil | VIVSLAVYAAGLVLLAWEGRRDLAILLAAAGGVALSIATLP |
| Ga0326721_103084482 | 3300032080 | Soil | MGLVLLVLSIAIYVAGCVLLAWEGRRDAAVVLAVVGGVGLSIFTLP |
| Ga0247829_114942142 | 3300033550 | Soil | PVATLLAVSAVFVVISLAVYVAGLVLLAWEGRRDLAILLAALGGVALSIATLP |
| Ga0372943_0979964_50_190 | 3300034268 | Soil | VTAVLVVLSITLYVAGCILLAWEGRRDAAIALAAVGAVGLSIFTLP |
| ⦗Top⦘ |