| Basic Information | |
|---|---|
| Family ID | F072667 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRLLRRLLGRRRPMPRPADPERLQRIYRETHRHVEELRRAA |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.33 % |
| % of genes near scaffold ends (potentially truncated) | 23.14 % |
| % of genes from short scaffolds (< 2000 bps) | 76.86 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.165 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.661 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.893 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF12697 | Abhydrolase_6 | 24.79 |
| PF00271 | Helicase_C | 24.79 |
| PF03602 | Cons_hypoth95 | 23.97 |
| PF01467 | CTP_transf_like | 5.79 |
| PF02645 | DegV | 1.65 |
| PF00550 | PP-binding | 0.83 |
| PF00248 | Aldo_ket_red | 0.83 |
| PF01336 | tRNA_anti-codon | 0.83 |
| PF00885 | DMRL_synthase | 0.83 |
| PF17191 | RecG_wedge | 0.83 |
| PF00496 | SBP_bac_5 | 0.83 |
| PF02887 | PK_C | 0.83 |
| PF03780 | Asp23 | 0.83 |
| PF03466 | LysR_substrate | 0.83 |
| PF01799 | Fer2_2 | 0.83 |
| PF00892 | EamA | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 23.97 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 23.97 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 23.97 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 23.97 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 23.97 |
| COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 0.83 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.83 |
| COG1302 | Uncharacterized conserved protein YloU, alkaline shock protein (Asp23) family | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.17 % |
| Unclassified | root | N/A | 19.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig113392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300004114|Ga0062593_101591371 | Not Available | 709 | Open in IMG/M |
| 3300004633|Ga0066395_10800711 | Not Available | 565 | Open in IMG/M |
| 3300005093|Ga0062594_100591233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 970 | Open in IMG/M |
| 3300005093|Ga0062594_101275892 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300005171|Ga0066677_10445127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 741 | Open in IMG/M |
| 3300005175|Ga0066673_10049048 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
| 3300005178|Ga0066688_10084805 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300005179|Ga0066684_10037093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2708 | Open in IMG/M |
| 3300005329|Ga0070683_100132107 | All Organisms → cellular organisms → Bacteria | 2363 | Open in IMG/M |
| 3300005332|Ga0066388_100227627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2496 | Open in IMG/M |
| 3300005332|Ga0066388_103806975 | Not Available | 770 | Open in IMG/M |
| 3300005336|Ga0070680_101047985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 705 | Open in IMG/M |
| 3300005337|Ga0070682_101143482 | Not Available | 654 | Open in IMG/M |
| 3300005434|Ga0070709_11016940 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005435|Ga0070714_100002733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13002 | Open in IMG/M |
| 3300005439|Ga0070711_100152748 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300005440|Ga0070705_100052818 | Not Available | 2376 | Open in IMG/M |
| 3300005450|Ga0066682_10200738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
| 3300005468|Ga0070707_100006214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11123 | Open in IMG/M |
| 3300005524|Ga0070737_10014808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5842 | Open in IMG/M |
| 3300005526|Ga0073909_10003652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4537 | Open in IMG/M |
| 3300005548|Ga0070665_102188208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
| 3300005575|Ga0066702_10979917 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005577|Ga0068857_101672444 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005587|Ga0066654_10216890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
| 3300005614|Ga0068856_100400995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1391 | Open in IMG/M |
| 3300005764|Ga0066903_100146883 | All Organisms → cellular organisms → Bacteria | 3373 | Open in IMG/M |
| 3300005764|Ga0066903_100148303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3361 | Open in IMG/M |
| 3300005764|Ga0066903_100154252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3309 | Open in IMG/M |
| 3300005764|Ga0066903_100931087 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300005764|Ga0066903_104440400 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005764|Ga0066903_105882723 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005841|Ga0068863_100372249 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300005842|Ga0068858_100535538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
| 3300005891|Ga0075283_1120356 | Not Available | 503 | Open in IMG/M |
| 3300005897|Ga0075281_1012880 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300006028|Ga0070717_10031334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 4277 | Open in IMG/M |
| 3300006028|Ga0070717_10118155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2269 | Open in IMG/M |
| 3300006046|Ga0066652_100656647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
| 3300006173|Ga0070716_100818155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
| 3300006804|Ga0079221_10991424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
| 3300006806|Ga0079220_12087974 | Not Available | 507 | Open in IMG/M |
| 3300006852|Ga0075433_10544803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1020 | Open in IMG/M |
| 3300006854|Ga0075425_102235187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300009012|Ga0066710_100391528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2069 | Open in IMG/M |
| 3300009101|Ga0105247_10983859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 658 | Open in IMG/M |
| 3300009177|Ga0105248_10550940 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300010048|Ga0126373_12666517 | Not Available | 557 | Open in IMG/M |
| 3300010154|Ga0127503_10280750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 837 | Open in IMG/M |
| 3300010301|Ga0134070_10289121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| 3300010335|Ga0134063_10389557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 682 | Open in IMG/M |
| 3300010359|Ga0126376_11583821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 687 | Open in IMG/M |
| 3300010361|Ga0126378_13078119 | Not Available | 531 | Open in IMG/M |
| 3300010362|Ga0126377_11154675 | Not Available | 844 | Open in IMG/M |
| 3300010362|Ga0126377_12318999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300010362|Ga0126377_12734556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
| 3300010366|Ga0126379_13021584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
| 3300010373|Ga0134128_10301080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1796 | Open in IMG/M |
| 3300010396|Ga0134126_10955708 | Not Available | 961 | Open in IMG/M |
| 3300012206|Ga0137380_10260996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1559 | Open in IMG/M |
| 3300012207|Ga0137381_11708245 | Not Available | 520 | Open in IMG/M |
| 3300012207|Ga0137381_11730647 | Not Available | 515 | Open in IMG/M |
| 3300012210|Ga0137378_11828860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300012285|Ga0137370_10295010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
| 3300012356|Ga0137371_10193054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1595 | Open in IMG/M |
| 3300012955|Ga0164298_10354237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 931 | Open in IMG/M |
| 3300012957|Ga0164303_10150964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
| 3300012960|Ga0164301_10152362 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300012960|Ga0164301_10572007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 829 | Open in IMG/M |
| 3300012961|Ga0164302_10281453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1075 | Open in IMG/M |
| 3300012971|Ga0126369_11150214 | Not Available | 865 | Open in IMG/M |
| 3300012971|Ga0126369_11320457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 811 | Open in IMG/M |
| 3300012971|Ga0126369_13319624 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012984|Ga0164309_10282755 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300012988|Ga0164306_10338333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1111 | Open in IMG/M |
| 3300013296|Ga0157374_12546188 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300013307|Ga0157372_13137267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
| 3300013772|Ga0120158_10199770 | Not Available | 1046 | Open in IMG/M |
| 3300014326|Ga0157380_12138706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 623 | Open in IMG/M |
| 3300014497|Ga0182008_10419660 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300014969|Ga0157376_10328527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1456 | Open in IMG/M |
| 3300014969|Ga0157376_12859263 | Not Available | 522 | Open in IMG/M |
| 3300015261|Ga0182006_1331973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300015262|Ga0182007_10255092 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300015357|Ga0134072_10445359 | Not Available | 521 | Open in IMG/M |
| 3300016422|Ga0182039_10804554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 834 | Open in IMG/M |
| 3300017966|Ga0187776_10000307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23880 | Open in IMG/M |
| 3300018431|Ga0066655_10441966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
| 3300018482|Ga0066669_10831299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300020070|Ga0206356_10671740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
| 3300021560|Ga0126371_13225646 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300024055|Ga0247794_10261615 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300025912|Ga0207707_10027158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5005 | Open in IMG/M |
| 3300025921|Ga0207652_10206122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1770 | Open in IMG/M |
| 3300025922|Ga0207646_10000268 | All Organisms → cellular organisms → Bacteria | 71093 | Open in IMG/M |
| 3300025927|Ga0207687_10206251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1539 | Open in IMG/M |
| 3300025928|Ga0207700_10007827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6569 | Open in IMG/M |
| 3300025928|Ga0207700_10073111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2646 | Open in IMG/M |
| 3300025929|Ga0207664_10153497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1958 | Open in IMG/M |
| 3300025929|Ga0207664_10282294 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300025990|Ga0208527_1023248 | Not Available | 745 | Open in IMG/M |
| 3300026088|Ga0207641_11818147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 611 | Open in IMG/M |
| 3300026116|Ga0207674_11844762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 571 | Open in IMG/M |
| 3300026300|Ga0209027_1025485 | Not Available | 2240 | Open in IMG/M |
| 3300026310|Ga0209239_1031515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2517 | Open in IMG/M |
| 3300026326|Ga0209801_1079177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1443 | Open in IMG/M |
| 3300026330|Ga0209473_1176422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 836 | Open in IMG/M |
| 3300026547|Ga0209156_10353803 | Not Available | 633 | Open in IMG/M |
| 3300027773|Ga0209810_1009704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7479 | Open in IMG/M |
| 3300027821|Ga0209811_10009364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Thermincola → Thermincola potens | 3141 | Open in IMG/M |
| 3300027874|Ga0209465_10178834 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300031226|Ga0307497_10413501 | Not Available | 647 | Open in IMG/M |
| 3300031753|Ga0307477_10123021 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300031938|Ga0308175_100000015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 160565 | Open in IMG/M |
| 3300031938|Ga0308175_101066639 | Not Available | 895 | Open in IMG/M |
| 3300031938|Ga0308175_103161791 | Not Available | 511 | Open in IMG/M |
| 3300031939|Ga0308174_10001912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10008 | Open in IMG/M |
| 3300031939|Ga0308174_10766138 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300032770|Ga0335085_10048699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5748 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.13% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.13% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.48% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025990 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0379.00006390 | 2166559005 | Simulated | MRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRHVE |
| Ga0062593_1015913712 | 3300004114 | Soil | MKLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRAA* |
| Ga0066395_108007111 | 3300004633 | Tropical Forest Soil | MKLIRRLLGRRKSAPRLLMLQADSERLQQIYRETHRQVEELRRAA* |
| Ga0062594_1005912331 | 3300005093 | Soil | MRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA* |
| Ga0062594_1012758922 | 3300005093 | Soil | MRLIRRLLGRQRPMLRAADPERLQRIYRETHRHVEELRRAA* |
| Ga0066677_104451272 | 3300005171 | Soil | MRLVALLLGRRRPAPRPTPPADPERLQRIYRETQRHVENLRRAA* |
| Ga0066673_100490483 | 3300005175 | Soil | MRVLRRLLHRRRPMPRPADPERLQRIYRETHRHVEELRRAA* |
| Ga0066688_100848052 | 3300005178 | Soil | MRLLTRLVRRLLGRGRPPSRPTPPADPERLQRIYRETHRHVEDLRRAA* |
| Ga0066684_100370932 | 3300005179 | Soil | MRVLRRLLHRRRPTPRPADPERLQRIYRETHRHVEELRRAA* |
| Ga0070683_1001321072 | 3300005329 | Corn Rhizosphere | MRLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRAA* |
| Ga0066388_1002276275 | 3300005332 | Tropical Forest Soil | MRLLVLLVDRLLGRRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA* |
| Ga0066388_1038069752 | 3300005332 | Tropical Forest Soil | MKLVRRLFRRRRPMPRLADPERLQRIYRETHRHVEELRRA |
| Ga0070680_1010479852 | 3300005336 | Corn Rhizosphere | MKLIRRLLGRRGSGPRPADPERLQRIYRETHRHVEELRRAA* |
| Ga0070682_1011434822 | 3300005337 | Corn Rhizosphere | RMKLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRAA* |
| Ga0070709_110169402 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLRRLLGRRPPAPRPADPERLQRIYRETHRQVEDLRRAA* |
| Ga0070714_1000027333 | 3300005435 | Agricultural Soil | MKLLVRLFRRRAAPLPVPPAEQERLQRIYRETHRHVADLRRTA* |
| Ga0070711_1001527481 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLIRRLLGRRRPMLRAADPERLQRIYRKTHRHVEELRRAA* |
| Ga0070705_1000528183 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRA |
| Ga0066682_102007382 | 3300005450 | Soil | MRLLRRLLRRRRPTARPADPERLQRIYRETHLHVEELRRAA* |
| Ga0070707_1000062144 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MMVLRRLFGRRRPMPRPADPERLQRIYRETHRHVEELRRAA* |
| Ga0070737_100148084 | 3300005524 | Surface Soil | VRGSLLLLRLVRRLAGRRPPPASTPAADPERLQRVYRETRRRVERLRRAA* |
| Ga0073909_100036526 | 3300005526 | Surface Soil | MKLIRRLLGRPRPMLHPADPERLQRIYRETHRHVEELRRAA* |
| Ga0070665_1021882082 | 3300005548 | Switchgrass Rhizosphere | MRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRH |
| Ga0066692_103256183 | 3300005555 | Soil | RMMRLLALLRRGRSRPAPRPLDPERLQRIYRETHRQVEELRRAA* |
| Ga0066702_109799172 | 3300005575 | Soil | MRLLTRLVRRLLGRRRPPSRPTPPADPERLQRIYRETHRHVEDLRRAA* |
| Ga0068857_1016724442 | 3300005577 | Corn Rhizosphere | MRLIRRLLGRRRPMLRAAVPERRQRIYRETHRHVEELRRAA* |
| Ga0066654_102168901 | 3300005587 | Soil | MRVLRRLLRRRLPSPRPADPERLQRIYRETHRHVEELRRAA* |
| Ga0068856_1004009953 | 3300005614 | Corn Rhizosphere | FGPRRPMLRPADPARLQHIYRETHRHVEDLRRAA* |
| Ga0066903_1001468834 | 3300005764 | Tropical Forest Soil | MRILLAVIRRLFGGTRPRQRPTPPPDSDRFDRIYRETHRDVEDLRRAA* |
| Ga0066903_1001483032 | 3300005764 | Tropical Forest Soil | MRLFRRLLGRRRPVPRPADPERLQRIYRETHRRVEELRRAA* |
| Ga0066903_1001542524 | 3300005764 | Tropical Forest Soil | MRLVRRLLGRRRPLPRPTDPERLQRIYRETHRRVEELRRAA* |
| Ga0066903_1009310872 | 3300005764 | Tropical Forest Soil | MKLLRRLLGRRPPAPRPTDPERLQRVYRETHRQVEELRRAA* |
| Ga0066903_1044404002 | 3300005764 | Tropical Forest Soil | VFLGLRRKRRVVVPADPERLQQIYRETHRHVEDLRRAA* |
| Ga0066903_1058827232 | 3300005764 | Tropical Forest Soil | MTLIRRLLSRRRPASRLLLLQADSERLQQIYRETHRQVEELRRAA* |
| Ga0068863_1003722493 | 3300005841 | Switchgrass Rhizosphere | MRLIRRLLSRRRPMLRAADPERLQRIYRETHRHVEELRRAA* |
| Ga0068858_1005355383 | 3300005842 | Switchgrass Rhizosphere | VRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYREAQRHVEELRRAA* |
| Ga0075283_11203562 | 3300005891 | Rice Paddy Soil | MRLLVLLVRRLLGRRQPTPRPRPPADPERLQRIYRDTQRQVEELRRAA* |
| Ga0075281_10128802 | 3300005897 | Rice Paddy Soil | MRLLVLLVRRLLGRGQPTPRPRPPADPERLQRIYRDTQRQVEELRRAA* |
| Ga0070717_100313343 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLRRLLGRRPPPPRPADPERLQRIYRETHRHVEDLRRAA* |
| Ga0070717_101181552 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRLFALLLGRPRRTAPPIDSERLLQIYRETHEHVEELRRAA* |
| Ga0066652_1006566472 | 3300006046 | Soil | MRLLRRLLRRRRPMARPADPERLQRIYRETHRHVEELRRAA* |
| Ga0070716_1008181552 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLFRRLFARRRPAPRLADPERLHRIYRETHRQVEGLRRAA* |
| Ga0079221_109914242 | 3300006804 | Agricultural Soil | MKLIHRLLGRRKPAPRPVDSERLHRIYRETHRQVEELRRAA* |
| Ga0079220_120879742 | 3300006806 | Agricultural Soil | MRLIRRLLARRRTVPRLADPERLQQIYRETHRRVEELRRAA* |
| Ga0075433_105448031 | 3300006852 | Populus Rhizosphere | IRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRAA* |
| Ga0075425_1022351872 | 3300006854 | Populus Rhizosphere | MRTLLLLIDHLLGRRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA* |
| Ga0066710_1003915285 | 3300009012 | Grasslands Soil | MRVLRRLLHRRRPMPRPADPGRLQRIYRETHRHVEELRRAA |
| Ga0105247_109838591 | 3300009101 | Switchgrass Rhizosphere | MRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYREAQRHVEELRRAA* |
| Ga0105248_105509401 | 3300009177 | Switchgrass Rhizosphere | MRLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELR |
| Ga0126373_126665172 | 3300010048 | Tropical Forest Soil | MKLLRRLRRRRSPALRLADPDDLQRIYRETHRQVEELRRAA* |
| Ga0127503_102807502 | 3300010154 | Soil | MRLLRRLLSRRRSKPRPADPERLLRIYRETHRHVEELRRAA* |
| Ga0134070_102891212 | 3300010301 | Grasslands Soil | MRLLRRLLRRRRPIARPADPERLQRIYRETHRHVEELRRAA* |
| Ga0134063_103895572 | 3300010335 | Grasslands Soil | MRLLTRLVRRLLGRGRPPSRPTPPADPERLQRIYRETHRHVEDLR |
| Ga0126376_115838212 | 3300010359 | Tropical Forest Soil | MRLLVLLVDRLLGRRRRPAPRPRPPHDPECLQRVYRETQR |
| Ga0126378_130781191 | 3300010361 | Tropical Forest Soil | AGVRLVRRLLGRRRPLPRPTDPERLQRIYRETHRRVEELRRAA* |
| Ga0126377_111546752 | 3300010362 | Tropical Forest Soil | RLLVLLVDRLLGRRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA* |
| Ga0126377_123189992 | 3300010362 | Tropical Forest Soil | MKLIRRLLGRRRPASRLLLLQADSERLQQIYRETHRQVEELRRAA* |
| Ga0126377_127345561 | 3300010362 | Tropical Forest Soil | MTLLRRLFGRRRPTPRAADPERLQRIYRETHRQVE |
| Ga0126379_130215842 | 3300010366 | Tropical Forest Soil | VRLLRRLLGHRRPALRPADPEHLQRIYRETHRHIEELRRAA* |
| Ga0134128_103010802 | 3300010373 | Terrestrial Soil | MRLLARLIRRLLGRRRPAPRPVPPTDPERLQRIYRETHRQVEDLRRAA* |
| Ga0134126_109557082 | 3300010396 | Terrestrial Soil | MRLLLLRLLRRRRPVPRPADSERLQRIYRETHRHVEKL |
| Ga0137380_102609962 | 3300012206 | Vadose Zone Soil | MRLLAQLVRRLLGRRRPAPRFVPPTDPERLHRIYCDTHREVEDLRRAA* |
| Ga0137381_117082451 | 3300012207 | Vadose Zone Soil | MRLLSQLVRRLLGRRRPAPRPVPSTDPERLHRIYCDTHREVEDLRRAA* |
| Ga0137381_117306472 | 3300012207 | Vadose Zone Soil | MRLLVPINRRLRGRSRPAPGPLDPERLQRIYRETHRQVEELRRAA* |
| Ga0137378_118288602 | 3300012210 | Vadose Zone Soil | MRLLTRLVRRLLRRGRPPSRPTPPADPERLQRIYRETHRHVEDLRRAA* |
| Ga0137370_102950101 | 3300012285 | Vadose Zone Soil | LRRLLHRRRPMPRPADPERLQRIYRETHRHVEELRRAA* |
| Ga0137371_101930542 | 3300012356 | Vadose Zone Soil | MRLLSQLVRRLLDRRRPGPRPVPPTDPERLHRIYCDTHREVEDLRRAA* |
| Ga0164298_103542372 | 3300012955 | Soil | MKLIRRLLGRRRPVLRPADPERLQLIYRETHRHVEELRRAA* |
| Ga0164303_101509642 | 3300012957 | Soil | MKLIRRLLGRPRPILHPADPERLQRIYRETHRHVEELRRAA* |
| Ga0164301_101523622 | 3300012960 | Soil | MKLIRRLVSRRGPGPRPADPERLQRIYRETQRQVEELRRAA* |
| Ga0164301_105720071 | 3300012960 | Soil | MQLIRRLLGRPRPILHPADPERLQRIYRETHRHVEELRRAA* |
| Ga0164302_102814531 | 3300012961 | Soil | RMKLIRRLLGRPRPMLHPADPERLQRIYRETHRHVEELRRAA* |
| Ga0126369_111502142 | 3300012971 | Tropical Forest Soil | MRLILRLLGRRRPMPRPADPERLQRIYRDTHRHVEELRRAA* |
| Ga0126369_113204571 | 3300012971 | Tropical Forest Soil | MRLILRLLGRRRPVPRPADPERLQQIYRETHRTVEELRRAA* |
| Ga0126369_133196242 | 3300012971 | Tropical Forest Soil | VKLIHRLFRRRRPEPRPVDSEVLHRIYRETHRQVEELRRAA* |
| Ga0164309_102827553 | 3300012984 | Soil | MKLIRRLLGRPRPMLHPADPERLQRIYRETHRRVEELRRAA* |
| Ga0164306_103383333 | 3300012988 | Soil | RMKLIRRLLGRRRPMLRATDAERLQRIYRETHRHVEELRRAA* |
| Ga0157374_125461882 | 3300013296 | Miscanthus Rhizosphere | VRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA* |
| Ga0157372_131372672 | 3300013307 | Corn Rhizosphere | MKLIRRLLGRRGSGPRPADPERLQRIYRVTHRHVEELRRAA* |
| Ga0120158_101997702 | 3300013772 | Permafrost | MRLVVRVSRLLSRRQPTPRPGPPADPERLQRIYRETQRHLEDLRRVA* |
| Ga0157380_121387062 | 3300014326 | Switchgrass Rhizosphere | MRLIRRLLGRRRPTLRAADPERLQRIYRETHRHVEELRRAA |
| Ga0182008_104196602 | 3300014497 | Rhizosphere | VRLLAQLIRRLLGGGRPAPRPVPPTDPERLQRIYRETHRQVEDLRRAA* |
| Ga0157376_103285273 | 3300014969 | Miscanthus Rhizosphere | MRLIRRLLGRRRPMLRAADTERLQRIYRETHRHVEELRRAA* |
| Ga0157376_128592632 | 3300014969 | Miscanthus Rhizosphere | MKLVRRLLGRRRPMPRPADAERLQQIYRETHRQVEELRRAA* |
| Ga0182006_13319732 | 3300015261 | Rhizosphere | VRLLAELLRRLLGRRRSAPRPVPPTDPERLQRIYRETHRQVEDL |
| Ga0182007_102550922 | 3300015262 | Rhizosphere | VRLLAELLRRLLGRRRSAPRPVPPTDPERLQRIYRETHRQVEDLRRAA* |
| Ga0134072_104453591 | 3300015357 | Grasslands Soil | RLLHRRRPMPRPADPERLQRIYRETHRHVEELRRAA* |
| Ga0182039_108045542 | 3300016422 | Soil | MRLLRRLLGRRRPMPRPADPERLQRIYRETHRHVEELRRAA |
| Ga0187776_1000030722 | 3300017966 | Tropical Peatland | MRLLVLLIDRLLGRRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA |
| Ga0066655_104419662 | 3300018431 | Grasslands Soil | MRLLRRLLRRRRPMARPADPERLQRIYRETHRHVEELRRAA |
| Ga0066669_108312992 | 3300018482 | Grasslands Soil | MSVLRRLLHRRRPMPRPADPERLQRIYRETHRHVEELRRAA |
| Ga0206356_106717401 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLIRRLLGRRRPMLRAADPEHLQRIYRETHRHVEELRRAA |
| Ga0126371_132256462 | 3300021560 | Tropical Forest Soil | MKLLRRLLGRRRPAPRPADPERLQRIYRETHRQVEELRRAA |
| Ga0247794_102616152 | 3300024055 | Soil | MRLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRAA |
| Ga0207707_100271585 | 3300025912 | Corn Rhizosphere | MKLIRRLLGRRGSGPRPADPERLQRIYRETHRHVEELRRAA |
| Ga0207652_102061224 | 3300025921 | Corn Rhizosphere | MKLIRRLLGRPGSGPRPADPERLQRIYRETHRHVEELRRAA |
| Ga0207646_1000026863 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MMVLRRLFGRRRPMPRPADPERLQRIYRETHRHVEELRRAA |
| Ga0207687_102062514 | 3300025927 | Miscanthus Rhizosphere | LFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA |
| Ga0207700_100078271 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRHV |
| Ga0207700_100731111 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | HRLLGRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA |
| Ga0207664_101534973 | 3300025929 | Agricultural Soil | MKLLRRLLGRRPPPPRPADPERLQRIYRETHRHVEDLRRAA |
| Ga0207664_102822942 | 3300025929 | Agricultural Soil | MKLLVRLFRRRAAPLPVPPAEQERLQRIYRETHRHVADLRRTA |
| Ga0208527_10232481 | 3300025990 | Rice Paddy Soil | MRLLVLLVRRLLGRRQPTPRPRPPADPERLQRIYRDTQRQVEELRRAA |
| Ga0207641_118181472 | 3300026088 | Switchgrass Rhizosphere | MRLIRRLLSRRRPMLRAADPERLQRIYRETHRHVEELRRAA |
| Ga0207674_118447621 | 3300026116 | Corn Rhizosphere | VRLVRLLFGPRRPMLRPADPARLQHIYRETHRHVERPALRGLTA |
| Ga0209027_10254852 | 3300026300 | Grasslands Soil | MRVLRRLLRRRRPTPRPADPERLQRIYRETHRHVEELRRAA |
| Ga0209239_10315152 | 3300026310 | Grasslands Soil | MRLLRRLLRRRPMARPADPERLQRIYRETHRHVEELRRAA |
| Ga0209801_10791772 | 3300026326 | Soil | MRLLTRLVRRLLGRGRPPSRPTPPADPERLQRIYRETHRHVEDLRRAA |
| Ga0209473_11764221 | 3300026330 | Soil | MRLFALLIRRRPAPRPRPPADPERLQQIYRETQRHVEDLRRAA |
| Ga0209156_103538031 | 3300026547 | Soil | MRVLRRLLHGRRPMPRPADPERLQRIYRETHRHVEELRRAA |
| Ga0209810_10097049 | 3300027773 | Surface Soil | VRGSLLLLRLVRRLAGRRPPPASTPAADPERLQRVYRETRRRVERLRRAA |
| Ga0209811_100093642 | 3300027821 | Surface Soil | MKLIRRLLGRPRPMLHPADPERLQRIYRETHRHVEELRRAA |
| Ga0209465_101788342 | 3300027874 | Tropical Forest Soil | MKLIRRLLGRRKSAPRLLMLQADSERLQQIYRETHRQVEELRRAA |
| Ga0307497_104135011 | 3300031226 | Soil | LLRRRRPTPRPADPERLQRIYRETHRHVEELRRAA |
| Ga0307477_101230213 | 3300031753 | Hardwood Forest Soil | MRLLVLLIDRLLGRRRRPSPRPRSPHDPERLQRVYRETQRHVEELRRAA |
| Ga0308175_100000015156 | 3300031938 | Soil | MRLLVQVIRRLLGRRGRPAPRPTPPTDPERLHRIYRETHRHVEDLRRAA |
| Ga0308175_1010666392 | 3300031938 | Soil | MKAVRRLLGRRGPVPRPRPPIDSERLERIYRETHRRMEELRR |
| Ga0308175_1031617912 | 3300031938 | Soil | MRLVALLLGRRRPAQRPTPPADPERLQRIYRETQRHVEELRRAA |
| Ga0308174_1000191210 | 3300031939 | Soil | VKLIRRLLARRRPTSSPADPERLQRIYHETHRRVEELRRAA |
| Ga0308174_107661382 | 3300031939 | Soil | MRLLARLIRRLLGRRRPAPRPVPPTDPERLQRIYRETHRQVEDLRRAA |
| Ga0335085_1004869910 | 3300032770 | Soil | VKLFARLRHRLLGRRRPTPRSKLSADPERLQRIYRETQRHVEELRRAA |
| ⦗Top⦘ |