| Basic Information | |
|---|---|
| Family ID | F072664 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTAKVLAALRSWKFQPAMRGDQPVEVTAILGFGIDTNDRF |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.83 % |
| % of genes near scaffold ends (potentially truncated) | 97.52 % |
| % of genes from short scaffolds (< 2000 bps) | 85.95 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (8.264 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.182 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.719 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.71% β-sheet: 8.82% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF13682 | CZB | 19.83 |
| PF13088 | BNR_2 | 6.61 |
| PF08281 | Sigma70_r4_2 | 4.13 |
| PF07859 | Abhydrolase_3 | 2.48 |
| PF13520 | AA_permease_2 | 1.65 |
| PF00326 | Peptidase_S9 | 1.65 |
| PF00324 | AA_permease | 1.65 |
| PF09413 | DUF2007 | 1.65 |
| PF02826 | 2-Hacid_dh_C | 1.65 |
| PF05977 | MFS_3 | 1.65 |
| PF01179 | Cu_amine_oxid | 0.83 |
| PF01968 | Hydantoinase_A | 0.83 |
| PF12710 | HAD | 0.83 |
| PF02012 | BNR | 0.83 |
| PF12704 | MacB_PCD | 0.83 |
| PF00069 | Pkinase | 0.83 |
| PF02517 | Rce1-like | 0.83 |
| PF07731 | Cu-oxidase_2 | 0.83 |
| PF14522 | Cytochrome_C7 | 0.83 |
| PF12811 | BaxI_1 | 0.83 |
| PF03544 | TonB_C | 0.83 |
| PF01040 | UbiA | 0.83 |
| PF04365 | BrnT_toxin | 0.83 |
| PF00106 | adh_short | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.31 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 2.48 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 1.65 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 1.65 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 1.65 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 1.65 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.65 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.83 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_103841087 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1010582 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100985047 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300004081|Ga0063454_100007579 | All Organisms → cellular organisms → Bacteria | 2682 | Open in IMG/M |
| 3300004081|Ga0063454_100450702 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300004091|Ga0062387_100028036 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
| 3300004091|Ga0062387_100255210 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300004104|Ga0058891_1568696 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300004152|Ga0062386_100118180 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
| 3300004479|Ga0062595_100496247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 915 | Open in IMG/M |
| 3300005177|Ga0066690_10380212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300005434|Ga0070709_10369876 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300005434|Ga0070709_11708133 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005436|Ga0070713_100959297 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005468|Ga0070707_102273654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300005541|Ga0070733_10223795 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300005542|Ga0070732_10193476 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300005542|Ga0070732_10824895 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005553|Ga0066695_10375098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300005578|Ga0068854_102145592 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005591|Ga0070761_10260148 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300005602|Ga0070762_10080210 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300005712|Ga0070764_10050965 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300005888|Ga0075289_1014202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1093 | Open in IMG/M |
| 3300005952|Ga0080026_10015039 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300006057|Ga0075026_100980517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300006059|Ga0075017_100782344 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300006162|Ga0075030_100957043 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300006162|Ga0075030_101410215 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006173|Ga0070716_100857995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 707 | Open in IMG/M |
| 3300006174|Ga0075014_100115358 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300006176|Ga0070765_102168089 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009088|Ga0099830_10830980 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300009646|Ga0116132_1211417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300009839|Ga0116223_10511335 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300010337|Ga0134062_10237163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 844 | Open in IMG/M |
| 3300010341|Ga0074045_10647813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300010358|Ga0126370_10612202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 942 | Open in IMG/M |
| 3300010358|Ga0126370_10821918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300010371|Ga0134125_11728558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300010379|Ga0136449_100463463 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
| 3300010379|Ga0136449_103087283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300010398|Ga0126383_10064865 | All Organisms → cellular organisms → Bacteria | 3112 | Open in IMG/M |
| 3300010400|Ga0134122_10311076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1356 | Open in IMG/M |
| 3300011119|Ga0105246_11325583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300012930|Ga0137407_11528048 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300013308|Ga0157375_10206056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2123 | Open in IMG/M |
| 3300014969|Ga0157376_11936766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300015241|Ga0137418_10479249 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300015371|Ga0132258_10837082 | All Organisms → cellular organisms → Bacteria | 2321 | Open in IMG/M |
| 3300016270|Ga0182036_11636342 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300016404|Ga0182037_10434745 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300017823|Ga0187818_10091252 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300017955|Ga0187817_10805662 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300017955|Ga0187817_11075283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300017961|Ga0187778_11001599 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300017970|Ga0187783_10099440 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300017972|Ga0187781_10030686 | All Organisms → cellular organisms → Bacteria | 3714 | Open in IMG/M |
| 3300017993|Ga0187823_10228924 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300018006|Ga0187804_10006768 | All Organisms → cellular organisms → Bacteria | 3775 | Open in IMG/M |
| 3300018012|Ga0187810_10189035 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300018062|Ga0187784_10890984 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300018085|Ga0187772_10153124 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300018085|Ga0187772_10553569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300018088|Ga0187771_11285880 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300018468|Ga0066662_10017079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3964 | Open in IMG/M |
| 3300019786|Ga0182025_1111617 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300021046|Ga0215015_10258746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300021171|Ga0210405_10833818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300021407|Ga0210383_10551904 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300021559|Ga0210409_10598959 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300021860|Ga0213851_1438589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300025457|Ga0208850_1068150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300025945|Ga0207679_10922947 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300026035|Ga0207703_10452554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1199 | Open in IMG/M |
| 3300026309|Ga0209055_1095843 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300026550|Ga0209474_10302774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 940 | Open in IMG/M |
| 3300027035|Ga0207776_1022036 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300027783|Ga0209448_10161575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300027825|Ga0209039_10413028 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027842|Ga0209580_10296847 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300027842|Ga0209580_10453090 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300027842|Ga0209580_10597026 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300027867|Ga0209167_10053908 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300027867|Ga0209167_10574470 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300027869|Ga0209579_10072070 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300027884|Ga0209275_10072461 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300027911|Ga0209698_10503576 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300027911|Ga0209698_10977696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300028792|Ga0307504_10132368 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300028795|Ga0302227_10081260 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300029636|Ga0222749_10009089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4003 | Open in IMG/M |
| 3300029923|Ga0311347_10724700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300030007|Ga0311338_10594398 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300030057|Ga0302176_10094569 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300030524|Ga0311357_11841825 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031057|Ga0170834_106411036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300031231|Ga0170824_120784145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300031233|Ga0302307_10426214 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031446|Ga0170820_13166338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300031469|Ga0170819_17632213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300031711|Ga0265314_10612174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300031718|Ga0307474_10115899 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300031754|Ga0307475_10867554 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300031954|Ga0306926_10771943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
| 3300031996|Ga0308176_11774525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300032076|Ga0306924_10539282 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300032174|Ga0307470_10167047 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300032180|Ga0307471_102004930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300032770|Ga0335085_10367699 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300032783|Ga0335079_10069195 | All Organisms → cellular organisms → Bacteria | 4021 | Open in IMG/M |
| 3300032805|Ga0335078_10137690 | All Organisms → cellular organisms → Bacteria | 3471 | Open in IMG/M |
| 3300032828|Ga0335080_10343098 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300032828|Ga0335080_10767179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300032829|Ga0335070_10369271 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300032892|Ga0335081_10921436 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300032954|Ga0335083_10102612 | All Organisms → cellular organisms → Bacteria | 2813 | Open in IMG/M |
| 3300033004|Ga0335084_11570439 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300033158|Ga0335077_11468150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300034125|Ga0370484_0072275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300034163|Ga0370515_0235734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.13% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.13% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.48% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.65% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.65% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1038410872 | 3300000364 | Soil | ILAALRNWKFQPAMRNNQPVAVTAILGFGIDTNDRF* |
| AP72_2010_repI_A10DRAFT_10105822 | 3300000651 | Forest Soil | PAQMTAKVVAALRNWKFQPAMRNSQPVEVTAILGFGIDTNDRF* |
| JGIcombinedJ26739_1009850471 | 3300002245 | Forest Soil | KNPRVLEAGPAEFTVKILAALRSWKFQPATRGNQPVEVTAILGFGIDTNDRF* |
| Ga0063454_1000075793 | 3300004081 | Soil | VLEAGSAQMTAKVLASLRAWKFQPAMRGKQPVEVTAILGFGIDTNDRF* |
| Ga0063454_1004507021 | 3300004081 | Soil | PAAMTAKVLSALRSWKFQPAMRNDQPVDVTAILGFGVNTDDRF* |
| Ga0062387_1000280364 | 3300004091 | Bog Forest Soil | LEAGPADMTAKVLIALRAWKFQPAILGNDPVEVTAILGFGVDTNDRF* |
| Ga0062387_1002552102 | 3300004091 | Bog Forest Soil | NVRVLEPGPAEMTAKIIASLRGWKLQPAMRGDQPIEVTAILGFGIDTNDRF* |
| Ga0058891_15686961 | 3300004104 | Forest Soil | VLEAGPAGMTAEVIAALHSWKFQPAMRGNQPVAVTAILGFGISTDDRF* |
| Ga0062386_1001181803 | 3300004152 | Bog Forest Soil | MTGQVLSALRSWKFQPAMKGDQPVEVTAILGFGIDTNDRY* |
| Ga0062595_1004962471 | 3300004479 | Soil | PGPANMTAKILSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF* |
| Ga0066690_103802121 | 3300005177 | Soil | PAQMTAKVVAALRNWKFQPATRNNQPLEVTAIIGFGIDTSDRF* |
| Ga0070709_103698761 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TGKIVAALRGWKFQPAMRGNEPVEVTAILGFNIDTNDRF* |
| Ga0070709_117081332 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PGPAEVTAKVITALRSWKLQPVMRNNQPIQVDAILGFGIDTNDRF* |
| Ga0070713_1009592971 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GNLHVLEAGPATMTAKVVAALHSWKFQPAMKNNQPVEVNAILGFGINTNDRF* |
| Ga0070707_1022736541 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TDTTTKVLASLPNWKFSPALRGDQPVEVTVYLGFNIDTKDRF* |
| Ga0070733_102237951 | 3300005541 | Surface Soil | VRVLEAGPASMTAKIVAALRNWKFQPAMRGDQPVEVTAILGFGIDTNDRF* |
| Ga0070732_101934761 | 3300005542 | Surface Soil | NVRVLEAGPADMTAKVVAALNNWKFQPALRGDQPVEVTAILGFGINTNDRF* |
| Ga0070732_108248951 | 3300005542 | Surface Soil | LEAGPAGMTAKVVAALRSWKFQPAMRNNQPLEVTAILGFGIDTNDRF* |
| Ga0066695_103750982 | 3300005553 | Soil | KVLASLPNWKFSPALRGDQPVEVTVYLGFNIDTKDRF* |
| Ga0068854_1021455922 | 3300005578 | Corn Rhizosphere | LSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF* |
| Ga0070761_102601481 | 3300005591 | Soil | EMTAKLVAALRTWKFQPAMRGDQPVEVTAILGFNIDTNDRF* |
| Ga0070762_100802101 | 3300005602 | Soil | TGSAEMTAKLVAALRTWKFQPAMRGDQPVEVTAILGFNIDTNDRF* |
| Ga0070764_100509652 | 3300005712 | Soil | TAKLVAALRTWKFQPAMRGDQPVEVTAILGFNIDTNDRF* |
| Ga0075289_10142021 | 3300005888 | Rice Paddy Soil | GPASMTAKVLAALRSWKFQPAMRNDQPVDVTAILGFGVNTDDRF* |
| Ga0080026_100150392 | 3300005952 | Permafrost Soil | AGNLKNVRVLEPGPADVTAKIVAALRAWKFQPAMRGNEAVEVTAILGFNIDTNDRF* |
| Ga0075026_1009805172 | 3300006057 | Watersheds | AVMTAKILADLRSWKFQPAMRSNQPVEVTAILGFGVDTNDRF* |
| Ga0075017_1007823441 | 3300006059 | Watersheds | AKIIAALRGWKLQPAMRGDQPIEVTAILGFGIDTNDRF* |
| Ga0075030_1009570432 | 3300006162 | Watersheds | AKVVAALNNWKFQPALRGDQPVEVTAILGFGINTNDRF* |
| Ga0075030_1014102151 | 3300006162 | Watersheds | LEAGPAGMTAKVVAALRSWKFQPAMRNNQPVEVTAILGFGIDTNDRF* |
| Ga0070716_1008579951 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SALQSWKFQPAMRNDQPVGVTAILGFGVNTDDRF* |
| Ga0075014_1001153581 | 3300006174 | Watersheds | GMTAKVVAALRSWKFQPAMRNNQPVEVTAILGFGIDTNDRF* |
| Ga0070765_1021680891 | 3300006176 | Soil | TSKVLSALRSWKFQPALRGNQPVEVTAILGFVIDTNDRF* |
| Ga0099830_108309802 | 3300009088 | Vadose Zone Soil | AALSKWKFRPALRGNQPVEVNAFLGFNIDTNDRF* |
| Ga0116132_12114171 | 3300009646 | Peatland | ADMTAKVMLALRGWKFQPAMRGDQPVEVTAILGFGIDTNDRN* |
| Ga0116223_105113352 | 3300009839 | Peatlands Soil | VVALRSWKFQPALRGGQPVEVSAILGFGINTDDRF* |
| Ga0134062_102371633 | 3300010337 | Grasslands Soil | EPGPANMTAKVLSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF* |
| Ga0074045_106478132 | 3300010341 | Bog Forest Soil | IAKVLAALGGWKFRPALRGGQPVEVTAILGFNIDTNDRY* |
| Ga0126370_106122022 | 3300010358 | Tropical Forest Soil | VLEAGPATMTAKVVAALNSWKFQPALRGDQPVEVTAILGFGVDTNDRF* |
| Ga0126370_108219181 | 3300010358 | Tropical Forest Soil | LTAKVLAALRTWKFQPAMRNNQPVEVTAILGFGIDTSDRF* |
| Ga0134125_117285581 | 3300010371 | Terrestrial Soil | SGPAAMTAKVLSALRSWKFQPAMRNDQPVDVTAILGFGVNTDDRF* |
| Ga0136449_1004634633 | 3300010379 | Peatlands Soil | GPADMTAKVMTALRSWKFQPAMRGTQPVEVTAILGFGIDTNDRF* |
| Ga0136449_1030872831 | 3300010379 | Peatlands Soil | LAALRAWKFQPALRGSQPVDVIAILGFNIDTNDRF* |
| Ga0126383_100648655 | 3300010398 | Tropical Forest Soil | VLEPGPATMTAKVVAALRSWKFQPAMRNSQPVEVTAILGFGIDTNDRF* |
| Ga0134122_103110763 | 3300010400 | Terrestrial Soil | EPADAGMTSKVLAALPRWKFQPAMRDGKAVEVNAILGFNIDTNDRF* |
| Ga0105246_113255832 | 3300011119 | Miscanthus Rhizosphere | VIAALPHWKFKPAMRVNQPVEVTAILGFNIDTNDRY* |
| Ga0137407_115280482 | 3300012930 | Vadose Zone Soil | GMTAKILAAVRGWKFQPAMRGNQPVEVTAILGFGISTDDRF* |
| Ga0157375_102060561 | 3300013308 | Miscanthus Rhizosphere | VMMAKVIAALPHWKFKPAMRVNQPVEVTAILGFNIDTNDRN* |
| Ga0157376_119367662 | 3300014969 | Miscanthus Rhizosphere | MTAKVLAALNGRKFRAALRGDQPVEVTAILGFGIDTNDRF* |
| Ga0137418_104792492 | 3300015241 | Vadose Zone Soil | MMAKVMAALPHWKFKPATRGAQPVEVTAILGFNVDTSDRY* |
| Ga0132258_108370821 | 3300015371 | Arabidopsis Rhizosphere | AQMTAKVLAALRTWKFQPAMRNNRPVEVTAILGFGIDTNDHF* |
| Ga0182036_116363421 | 3300016270 | Soil | LEPASATVTAKIVAALRAWKFQPAMKNNQPVEVTAILGFGIDTNDRF |
| Ga0182037_104347452 | 3300016404 | Soil | KVLDPGPAAMTAKVLAALSSWKFQPAMRGTQSVELTAILGFGIDTNDRF |
| Ga0187818_100912521 | 3300017823 | Freshwater Sediment | IRNVRVLEAGPAGMTAKVPSDLRSWKFQPAMRNNQPVEVTAILGFGINTDDRF |
| Ga0187817_108056622 | 3300017955 | Freshwater Sediment | AKIVAALRSWKFQPAMRGNQPVEVTAILGFGIDTNDRF |
| Ga0187817_110752831 | 3300017955 | Freshwater Sediment | AEMTAKILAALRTWKFQPAMRGNQPVEVTAILGFGVDTNDRF |
| Ga0187778_110015991 | 3300017961 | Tropical Peatland | AKVLAALHSWKFQPALRGDQPVEVTAILGFNIDTNDRF |
| Ga0187783_100994403 | 3300017970 | Tropical Peatland | GPATMTAKIRSALRAWKFQPAMRNGQPVEVNAILGFNITTDDVTNGSNLR |
| Ga0187781_100306864 | 3300017972 | Tropical Peatland | LTNLRVLEAGPPGMTAKLLASLRTWKFEPAMRNKQPVEVTAILGFGIDTNDRF |
| Ga0187823_102289242 | 3300017993 | Freshwater Sediment | RNVRVLEAGPAGMTAKVLAALRGWKFQPAMRGNQPVEVTAILGFGIDTNDRF |
| Ga0187804_100067681 | 3300018006 | Freshwater Sediment | AMNSKVLAALSSWKFRPAFHGDQPVEVTAILGFDIDTR |
| Ga0187810_101890352 | 3300018012 | Freshwater Sediment | GPADMTARVQTALHGWKFRPALRGDQPVEVTAILGFNIDTNDRF |
| Ga0187784_108909841 | 3300018062 | Tropical Peatland | KVLAALRTWKFQPALRGSEPVEVTAILGFNIDTNDRF |
| Ga0187772_101531242 | 3300018085 | Tropical Peatland | RVLEPGPADMTAKILAALRAWKFRPALREDQPIEVTAIIGFNIDTNDRF |
| Ga0187772_105535691 | 3300018085 | Tropical Peatland | RAKILSALQSWKFQPAVRGNEPVEVDAILGFGVDTR |
| Ga0187771_112858801 | 3300018088 | Tropical Peatland | MTAKVLAALRAWKFRPALRSDQPIEVTAILGFNIDTNDRF |
| Ga0066662_100170797 | 3300018468 | Grasslands Soil | VLEPGPANMTAKVLSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF |
| Ga0182025_11116172 | 3300019786 | Permafrost | PGPAEMTAKIVAALRSWKFQPAMRGNQPVAVTAILGFGIDTNDRF |
| Ga0215015_102587461 | 3300021046 | Soil | VMAALESWKFRPATRGGQPVEVNALLGFGIDTNDRN |
| Ga0210405_108338182 | 3300021171 | Soil | LSALRIWKFEPAMRGNQPVEVTAILGFGVDTNDRF |
| Ga0210383_105519043 | 3300021407 | Soil | LPALRSWKFEPALRGTQPVDVTAILGFGIDTNDRF |
| Ga0210409_105989591 | 3300021559 | Soil | TSGNLKNLRVLEAGPAGMTARILPALRAWKLEPAMRGGQPVEVTAILGFGINTDDRF |
| Ga0213851_14385891 | 3300021860 | Watersheds | KNPRVLDPDPPQMTARVLAALRSWKFQPATRNNQPLEVTAIIGFGIDTSDHF |
| Ga0208850_10681502 | 3300025457 | Arctic Peat Soil | DMTAKVLAALRSWKFQPAMRGTQPVEVTAILGFGIDTNDRF |
| Ga0207679_109229472 | 3300025945 | Corn Rhizosphere | ANMTAKILSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF |
| Ga0207703_104525543 | 3300026035 | Switchgrass Rhizosphere | QVLEPADAGMTSKVLAALPRWKFQPAMRDGKAVEVNAILGFNIDTNDRF |
| Ga0209055_10958432 | 3300026309 | Soil | VVAALRNWKFQPATRNNQPLEVTAIIGFGIDTSDRF |
| Ga0209474_103027743 | 3300026550 | Soil | AKVLSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF |
| Ga0207776_10220362 | 3300027035 | Tropical Forest Soil | NMTAKVLAALRGWKFQPALRGDQPVEVTAIIGFGIDTNDRF |
| Ga0209448_101615751 | 3300027783 | Bog Forest Soil | DMTAKVLIALRAWKFQPAILGNDPVEVTAILGFGVDTNDRF |
| Ga0209039_104130282 | 3300027825 | Bog Forest Soil | LAALRSWKFQPAKRGDQPVEVTAILGFGIDTNDRF |
| Ga0209580_102968472 | 3300027842 | Surface Soil | IIAALRSWKFQPATRNNQPVEVTAILGFGIDTNDRF |
| Ga0209580_104530902 | 3300027842 | Surface Soil | EAGPATMTAKVLAALPSWKFQPAMRGNQPVEVTAILGFGIDTNDRF |
| Ga0209580_105970262 | 3300027842 | Surface Soil | RVLEAGPAGMTAKVVAALRSWKFQPAMRNNQPLEVTAILGFGIDTNDRF |
| Ga0209167_100539082 | 3300027867 | Surface Soil | NVRVLEAGPASMTAKIVAALRNWKFQPAMRGDQPVEVTAILGFGIDTNDRF |
| Ga0209167_105744701 | 3300027867 | Surface Soil | GSATMTAKVLAALRTWKFQPAMRNNQPVEVTAILGFGIDTSDRF |
| Ga0209579_100720703 | 3300027869 | Surface Soil | KGIRVLEAGPADMTAKVLAALRSWKFQPAMRDNQPVEVTAILGFGINTNDRF |
| Ga0209275_100724611 | 3300027884 | Soil | SAEMTAKLVAALRTWKFQPAMRGDQPVEVTAILGFNIDTNDRF |
| Ga0209698_105035761 | 3300027911 | Watersheds | DMTAKVLTALRSWKFQPAMRGSEPVAVTAILGFGIDTNDRF |
| Ga0209698_109776961 | 3300027911 | Watersheds | LEPGPPDMTAKVLSAMLSWKFQPALRGDHPVEVTAILGFGIDTNDRF |
| Ga0307504_101323681 | 3300028792 | Soil | PAVMTSKVLAALSKWKFRPALRGNQPVEVNAFLGFNIDTNDRF |
| Ga0302227_100812601 | 3300028795 | Palsa | LEAGPATMTAKVLAALRNWKFQPALRGDQPVEVTAILGFGIDTNDRF |
| Ga0222749_100090897 | 3300029636 | Soil | ESSGSEMTSKVMAALPGWKFRPAMRGDQPVEVNAILGFGIDTNDRF |
| Ga0311347_107247001 | 3300029923 | Fen | AAETTSKILAALPNWKFRPAFRGNEPVEVTAILGFGIDTR |
| Ga0311338_105943983 | 3300030007 | Palsa | MTAKILVALRSWKFQPAMRGAQPVQVTAILGFGIDTNDRF |
| Ga0302176_100945693 | 3300030057 | Palsa | LKNVRVLEAGPATMTAKVLAALRNWKFQPALRGDQPVEVTAILGFGIDTNDRF |
| Ga0311357_118418252 | 3300030524 | Palsa | AGMTAKVVASLRTWKFEPATRNKQPVEVTAILGFGIDTNDRF |
| Ga0170834_1064110363 | 3300031057 | Forest Soil | KNIRVREPGPAGMTSKILAALRSWKFQPAMRGDQPVEITAILGFGIDTNDRF |
| Ga0170824_1207841452 | 3300031231 | Forest Soil | AGMTAKVLAALHSWKFQPAMRGDQPVPVTAILGFGIDTNDRF |
| Ga0302307_104262142 | 3300031233 | Palsa | LKNVRVLEAGPAGMTAKVVASLRTWKFEPATRNKQPVEVTAILGFGIDTNDRF |
| Ga0170820_131663381 | 3300031446 | Forest Soil | LKGIRVLEAGPADMTAKVLAALGSWKFQPAMRANQPVEVTAILGFGINTNDRF |
| Ga0170819_176322132 | 3300031469 | Forest Soil | PAGMTAKILAALPSWKFQPAMRGDQPVEITAILGFGIDTNDRF |
| Ga0265314_106121742 | 3300031711 | Rhizosphere | VLAALRSWKFQPAMRGDQPVEVTAILGFGIDTNDRF |
| Ga0307474_101158992 | 3300031718 | Hardwood Forest Soil | AEMTSKILSALRSWKFQPALRGNQPVEVTAILGFGIDTNDRF |
| Ga0307475_108675541 | 3300031754 | Hardwood Forest Soil | GMTAKVLAALRSWKFQPAMRGTQPVEVTAILGFGIDTNDRF |
| Ga0306926_107719432 | 3300031954 | Soil | QMTAKVLAALHTWKFQPAMRNNQPVEVTAILGFGIDTNDRF |
| Ga0308176_117745253 | 3300031996 | Soil | GNVRVLEPGPANMTAKILSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF |
| Ga0306924_105392821 | 3300032076 | Soil | MTAKVLAALSSWKFQPAMRGTQSVELTAILGFGIDTNDRF |
| Ga0307470_101670471 | 3300032174 | Hardwood Forest Soil | VRVREPGPAGMTAKILAALRSWKFQPAMRGDQPVEITAILGFGIDTNDRF |
| Ga0307471_1020049302 | 3300032180 | Hardwood Forest Soil | MTSKVLAALRNWKFQPATRNNQPLEVTAIFGFGIDTSDHF |
| Ga0335085_103676992 | 3300032770 | Soil | GPAEMTAKVIAALRSWKFQPATRGNQPVEVTAILGFGIDTNDRF |
| Ga0335079_100691954 | 3300032783 | Soil | LEAGPADMTAKVVAALRSWKFQPAMRGDQPVEVSAILGFGIDTNDRF |
| Ga0335078_101376903 | 3300032805 | Soil | VHVLEGPNDATARVVAALRSWKFQPALRGEQPVEVTAILGFAIDTNDRF |
| Ga0335080_103430981 | 3300032828 | Soil | GPATMTAKVIAALRTWKFQPAMRNSQPVEVTAILGFGIDTNDRF |
| Ga0335080_107671791 | 3300032828 | Soil | MTAKILAALPTWKFQPAMRNNQPVEVTAILGFSINTDDRF |
| Ga0335070_103692711 | 3300032829 | Soil | LDASGNFRNLHVLEGPAEVTPRVAAALRAWKFQPAMRGDKPVEVTAILGFGIDTNDRF |
| Ga0335081_109214361 | 3300032892 | Soil | AMTAKVMAALKNWKFQPALRSGQPVEVTAILGFGINTDDRL |
| Ga0335083_101026122 | 3300032954 | Soil | LEAGSATMTAKVLAALRTWKFQPAMRNNQPVEVTAILGFGIDTSDRF |
| Ga0335084_115704392 | 3300033004 | Soil | TAKVVAALRSWKFQPAMKNNQPVEVTAILGFGIDTNDRFWV |
| Ga0335077_114681501 | 3300033158 | Soil | ATTAKILAALPTWKFQPAMRNNQPVEVTAILGFGINTDDRF |
| Ga0370484_0072275_745_867 | 3300034125 | Untreated Peat Soil | MTAKVLAALRSWKFQPAMRGDQPVEVTAILGFGIDTNDRF |
| Ga0370515_0235734_664_777 | 3300034163 | Untreated Peat Soil | KVLAALRNWKFQPALRGDQPVEVTAILGFGIDTNDRF |
| ⦗Top⦘ |