Metagenome / Metatranscriptome Family F072661

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F072661
Family Type	Metagenome / Metatranscriptome
Number of Sequences	121
Average Sequence Length	39 residues
Representative Sequence	MLRLLATLAFAASFDILLFDGKYISAVDKLAVAIIQHF
Number of Associated Samples	92
Number of Associated Scaffolds	121

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	53.72 %
% of genes near scaffold ends (potentially truncated)	31.40 %
% of genes from short scaffolds (< 2000 bps)	83.47 %
Associated GOLD sequencing projects	89
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (52.066 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.917 % of family members)
Environment Ontology (ENVO)	Unclassified (27.273 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (47.934 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.36
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 121 Family Scaffolds
PF03734	YkuD	17.36
PF13561	adh_short_C2	17.36
PF00839	Cys_rich_FGFR	5.79
PF04311	DUF459	4.13
PF00106	adh_short	3.31
PF09594	GT87	2.48
PF00188	CAP	1.65
PF00497	SBP_bac_3	1.65
PF02617	ClpS	1.65
PF00144	Beta-lactamase	0.83
PF01464	SLT	0.83
PF03992	ABM	0.83
PF13398	Peptidase_M50B	0.83
PF04055	Radical_SAM	0.83
PF00657	Lipase_GDSL	0.83
PF06186	DUF992	0.83
PF04773	FecR	0.83
PF03775	MinC_C	0.83

COG ID	Name	Functional Category	% Frequency in 121 Family Scaffolds
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	17.36
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	17.36
COG2845	Peptidoglycan O-acetyltransferase, SGNH hydrolase family	Cell wall/membrane/envelope biogenesis [M]	4.13
COG2127	ATP-dependent Clp protease adapter protein ClpS	Posttranslational modification, protein turnover, chaperones [O]	1.65
COG2340	Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain	Cell cycle control, cell division, chromosome partitioning [D]	1.65
COG0850	Septum site-determining protein MinC	Cell cycle control, cell division, chromosome partitioning [D]	0.83
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.83
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.83
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
All Organisms	root	All Organisms	47.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
cellular organisms	root	All Organisms → cellular organisms	47.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	47.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	42.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	32.23 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	22.31 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	5.79 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3.31 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Geminicoccaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae	5.79 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4.13 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	4.13 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.65 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Geminicoccus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus	5.79 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	2.48 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.65 %
Starkeya	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Starkeya	0.83 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.83 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Geminicoccus flavidas	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas	5.79 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	1.65 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.65 %
unclassified Starkeya	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Starkeya → unclassified Starkeya	0.83 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.83 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.83 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Geminicoccus flavidas	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas	5.79 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1.65 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.65 %
Starkeya sp. ORNL1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Starkeya → unclassified Starkeya → Starkeya sp. ORNL1	0.83 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.83 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.83 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000033\|ICChiseqgaiiDRAFT_c0621633	Not Available	572	Open in IMG/M
3300000041\|ARcpr5oldR_c018638	All Organisms → cellular organisms → Bacteria → Proteobacteria	613	Open in IMG/M
3300000156\|NODE_c0635000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2014	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10003361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4344	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10060043	All Organisms → cellular organisms → Bacteria → Proteobacteria	975	Open in IMG/M
3300004268\|Ga0066398_10221911	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	507	Open in IMG/M
3300004633\|Ga0066395_10899803	Not Available	536	Open in IMG/M
3300005093\|Ga0062594_100244388	All Organisms → cellular organisms → Bacteria → Proteobacteria	1305	Open in IMG/M
3300005147\|Ga0066821_1017667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas	578	Open in IMG/M
3300005161\|Ga0066807_1012911	Not Available	791	Open in IMG/M
3300005332\|Ga0066388_104885579	Not Available	682	Open in IMG/M
3300005337\|Ga0070682_100167810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1523	Open in IMG/M
3300005339\|Ga0070660_100719424	Not Available	837	Open in IMG/M
3300005339\|Ga0070660_100975968	Not Available	716	Open in IMG/M
3300005444\|Ga0070694_101927910	Not Available	505	Open in IMG/M
3300005548\|Ga0070665_100812663	Not Available	948	Open in IMG/M
3300005618\|Ga0068864_100099416	All Organisms → cellular organisms → Bacteria	2577	Open in IMG/M
3300005713\|Ga0066905_100002135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	7230	Open in IMG/M
3300005713\|Ga0066905_100297120	All Organisms → cellular organisms → Bacteria → Proteobacteria	1266	Open in IMG/M
3300005713\|Ga0066905_100685014	All Organisms → cellular organisms → Bacteria → Proteobacteria	878	Open in IMG/M
3300005713\|Ga0066905_101878483	Not Available	554	Open in IMG/M
3300005719\|Ga0068861_102662963	Not Available	504	Open in IMG/M
3300005764\|Ga0066903_100358097	Not Available	2365	Open in IMG/M
3300005764\|Ga0066903_103856917	Not Available	805	Open in IMG/M
3300005764\|Ga0066903_104070106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Starkeya → unclassified Starkeya → Starkeya sp. ORNL1	783	Open in IMG/M
3300005764\|Ga0066903_106459936	All Organisms → cellular organisms → Bacteria	611	Open in IMG/M
3300005841\|Ga0068863_101437529	Not Available	698	Open in IMG/M
3300006041\|Ga0075023_100291247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	669	Open in IMG/M
3300006041\|Ga0075023_100583641	Not Available	517	Open in IMG/M
3300006057\|Ga0075026_100474459	Not Available	716	Open in IMG/M
3300006057\|Ga0075026_100541577	Not Available	676	Open in IMG/M
3300006057\|Ga0075026_100781632	All Organisms → cellular organisms → Bacteria → Proteobacteria	577	Open in IMG/M
3300006173\|Ga0070716_100955059	Not Available	675	Open in IMG/M
3300006175\|Ga0070712_100557948	Not Available	966	Open in IMG/M
3300006175\|Ga0070712_101898520	Not Available	521	Open in IMG/M
3300006178\|Ga0075367_10884772	Not Available	569	Open in IMG/M
3300006237\|Ga0097621_100856523	Not Available	844	Open in IMG/M
3300006581\|Ga0074048_12347100	Not Available	508	Open in IMG/M
3300006806\|Ga0079220_12095781	Not Available	506	Open in IMG/M
3300006844\|Ga0075428_100663530	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1112	Open in IMG/M
3300007076\|Ga0075435_100712562	Not Available	872	Open in IMG/M
3300009093\|Ga0105240_10342745	Not Available	1697	Open in IMG/M
3300009148\|Ga0105243_10533613	Not Available	1118	Open in IMG/M
3300010043\|Ga0126380_10222659	Not Available	1282	Open in IMG/M
3300010043\|Ga0126380_10529518	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	911	Open in IMG/M
3300010043\|Ga0126380_10951672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	718	Open in IMG/M
3300010043\|Ga0126380_11456856	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas	604	Open in IMG/M
3300010046\|Ga0126384_10064209	All Organisms → cellular organisms → Bacteria	2585	Open in IMG/M
3300010046\|Ga0126384_11672910	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas	601	Open in IMG/M
3300010047\|Ga0126382_10467375	All Organisms → cellular organisms → Bacteria	1005	Open in IMG/M
3300010359\|Ga0126376_10458518	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1167	Open in IMG/M
3300010359\|Ga0126376_12832976	Not Available	535	Open in IMG/M
3300010360\|Ga0126372_10262612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1490	Open in IMG/M
3300010366\|Ga0126379_11411763	Not Available	802	Open in IMG/M
3300010375\|Ga0105239_10582324	Not Available	1276	Open in IMG/M
3300010396\|Ga0134126_10175838	Not Available	2577	Open in IMG/M
3300010397\|Ga0134124_11440114	Not Available	716	Open in IMG/M
3300010401\|Ga0134121_10034916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	4087	Open in IMG/M
3300010401\|Ga0134121_10231833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1608	Open in IMG/M
3300011120\|Ga0150983_10718067	Not Available	763	Open in IMG/M
3300011444\|Ga0137463_1186769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	778	Open in IMG/M
3300012480\|Ga0157346_1008334	All Organisms → cellular organisms → Bacteria → Proteobacteria	712	Open in IMG/M
3300012483\|Ga0157337_1024671	Not Available	579	Open in IMG/M
3300012488\|Ga0157343_1002144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1050	Open in IMG/M
3300012951\|Ga0164300_10255027	Not Available	893	Open in IMG/M
3300012957\|Ga0164303_10085192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1520	Open in IMG/M
3300012958\|Ga0164299_10546346	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas	781	Open in IMG/M
3300012984\|Ga0164309_10217584	Not Available	1325	Open in IMG/M
3300012985\|Ga0164308_10382389	Not Available	1146	Open in IMG/M
3300012987\|Ga0164307_11291796	Not Available	609	Open in IMG/M
3300012988\|Ga0164306_11439814	Not Available	588	Open in IMG/M
3300013105\|Ga0157369_10314840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1627	Open in IMG/M
3300014324\|Ga0075352_1272226	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	529	Open in IMG/M
3300015371\|Ga0132258_11459965	All Organisms → cellular organisms → Bacteria → Proteobacteria	1727	Open in IMG/M
3300015371\|Ga0132258_12197341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas	1385	Open in IMG/M
3300015371\|Ga0132258_13484167	Not Available	1078	Open in IMG/M
3300015374\|Ga0132255_100347327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2148	Open in IMG/M
3300017792\|Ga0163161_11798333	Not Available	545	Open in IMG/M
3300017944\|Ga0187786_10031623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1488	Open in IMG/M
3300017944\|Ga0187786_10044957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1305	Open in IMG/M
3300017944\|Ga0187786_10311704	Not Available	650	Open in IMG/M
3300017947\|Ga0187785_10000756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	11559	Open in IMG/M
3300017947\|Ga0187785_10006273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	3946	Open in IMG/M
3300017947\|Ga0187785_10015938	All Organisms → cellular organisms → Bacteria	2615	Open in IMG/M
3300017947\|Ga0187785_10035254	All Organisms → cellular organisms → Bacteria → Proteobacteria	1828	Open in IMG/M
3300017974\|Ga0187777_10157778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1516	Open in IMG/M
3300018028\|Ga0184608_10470584	Not Available	539	Open in IMG/M
3300018054\|Ga0184621_10141698	Not Available	864	Open in IMG/M
3300018064\|Ga0187773_10164763	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	1154	Open in IMG/M
3300018072\|Ga0184635_10033507	Not Available	1941	Open in IMG/M
3300021478\|Ga0210402_10769280	Not Available	888	Open in IMG/M
3300021560\|Ga0126371_13281030	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	547	Open in IMG/M
3300022507\|Ga0222729_1027514	Not Available	706	Open in IMG/M
3300022533\|Ga0242662_10082903	Not Available	888	Open in IMG/M
3300022533\|Ga0242662_10131337	Not Available	742	Open in IMG/M
3300022694\|Ga0222623_10017026	Not Available	2691	Open in IMG/M
3300022756\|Ga0222622_10010223	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	4422	Open in IMG/M
3300025893\|Ga0207682_10452637	Not Available	608	Open in IMG/M
3300025915\|Ga0207693_10009737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	7825	Open in IMG/M
3300025915\|Ga0207693_10470083	Not Available	982	Open in IMG/M
3300025942\|Ga0207689_10043380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3718	Open in IMG/M
3300025981\|Ga0207640_10573134	Not Available	952	Open in IMG/M
3300027523\|Ga0208890_1085951	Not Available	521	Open in IMG/M
3300027894\|Ga0209068_10866309	Not Available	534	Open in IMG/M
3300027910\|Ga0209583_10740170	Not Available	517	Open in IMG/M
3300030945\|Ga0075373_10183966	Not Available	506	Open in IMG/M
3300031231\|Ga0170824_119731895	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8731	Open in IMG/M
3300031455\|Ga0307505_10565755	Not Available	551	Open in IMG/M
3300031538\|Ga0310888_10042290	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2089	Open in IMG/M
3300031720\|Ga0307469_11111594	Not Available	743	Open in IMG/M
3300031744\|Ga0306918_11023199	Not Available	641	Open in IMG/M
3300032017\|Ga0310899_10042099	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1627	Open in IMG/M
3300032075\|Ga0310890_11189313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas	620	Open in IMG/M
3300032174\|Ga0307470_10378673	Not Available	992	Open in IMG/M
3300032180\|Ga0307471_101694091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus flavidas	786	Open in IMG/M
3300033004\|Ga0335084_11182975	Not Available	765	Open in IMG/M
3300033412\|Ga0310810_10233952	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2039	Open in IMG/M
3300033433\|Ga0326726_10016899	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6350	Open in IMG/M
3300033433\|Ga0326726_11944557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	573	Open in IMG/M
3300034090\|Ga0326723_0230089	Not Available	824	Open in IMG/M
3300034090\|Ga0326723_0282272	All Organisms → cellular organisms → Bacteria	743	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	77.69%
Host-Associated	Host-Associated	21.49%
Engineered	Engineered	0.83%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	66.94%
Plants	Host-Associated → Plants	21.49%
Aquatic	Environmental → Aquatic	10.74%
Solid Waste	Engineered → Solid Waste	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	63.64%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.57%
Sediment	Environmental → Aquatic → Sediment	10.74%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.26%
Peat	Environmental → Terrestrial → Peat	3.31%
Roots	Host-Associated → Plants → Roots	1.65%
Grass	Engineered → Solid Waste → Grass	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	38.84%
Loam	Environmental → Terrestrial → Soil → Loam	15.70%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	10.74%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	9.09%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.44%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.13%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.31%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.31%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.83%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.83%
Composting	Engineered → Solid Waste → Grass → Composting	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.97%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	10.74%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	9.92%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	9.92%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	9.09%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.44%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.13%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.31%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.31%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.48%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.65%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.83%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.83%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.83%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	0.83%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	9.92%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	9.09%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.44%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	7.44%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	5.79%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.13%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.13%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.31%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.31%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	3.31%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.48%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.48%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.48%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	2.48%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.65%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.65%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.65%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.65%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.83%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.83%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.83%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.83%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.83%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Host-Associated	Open in IMG/M
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered	Open in IMG/M
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental	Open in IMG/M
3300004268	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005147	Soil and rhizosphere microbial communities from Laval, Canada - mgLMC	Environmental	Open in IMG/M
3300005161	Soil and rhizosphere microbial communities from Laval, Canada - mgLPA	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012480	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610	Host-Associated	Open in IMG/M
3300012483	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610	Host-Associated	Open in IMG/M
3300012488	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610	Host-Associated	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300014324	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022507	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022533	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027523	Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental	Open in IMG/M
3300030945	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031455	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiDRAFT_06216331	3300000033	Soil	MLRLLATLAFAASFEIILFDGRYLHAADKVAVAIIRSF*
ARcpr5oldR_0186382	3300000041	Arabidopsis Rhizosphere	MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQXF*
NODE_06350002	3300000156	Sugar Cane Bagasse Incubating Bioreactor	VRAYALRMLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF*
AF_2010_repII_A1DRAFT_100033615	3300000597	Forest Soil	MLLRILAMLAFAWSLDGKYISAVDKVAVAIFQSF*
AF_2010_repII_A1DRAFT_100600433	3300000597	Forest Soil	MLRLLATLAFVASFDILLFGGSHITAADRLAVQIFQHF*
Ga0066398_102219111	3300004268	Tropical Forest Soil	MLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF*ARAPQSQSIG
Ga0066395_108998031	3300004633	Tropical Forest Soil	NRMLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF*
Ga0062594_1002443882	3300005093	Soil	MLLRILATLAFAASFDTLILDGKYISAVDKVAVTIFQSF*
Ga0066821_10176671	3300005147	Soil	MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0066807_10129112	3300005161	Soil	MLLRILATLAFAASFDILIMDGKYISAVDKVAVAIIQSF*
Ga0066388_1048855791	3300005332	Tropical Forest Soil	RMLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF*
Ga0070682_1001678103	3300005337	Corn Rhizosphere	TYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0070660_1007194241	3300005339	Corn Rhizosphere	HMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0070660_1009759681	3300005339	Corn Rhizosphere	SRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0070694_1019279101	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	FETYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0070665_1008126634	3300005548	Switchgrass Rhizosphere	MLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0068864_1000994165	3300005618	Switchgrass Rhizosphere	MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQS
Ga0066905_1000021352	3300005713	Tropical Forest Soil	MLRLLATLAFAASFDIILFDGRYLNAADKVAVAIIRSF*
Ga0066905_1002971202	3300005713	Tropical Forest Soil	MLLRILATLAFAASFDILILDGKYISAVDKVAAIFQSF*
Ga0066905_1006850142	3300005713	Tropical Forest Soil	MLCLLATLAFAASFDIILFDGRYITAVDKVAVAIFRSF*
Ga0066905_1018784831	3300005713	Tropical Forest Soil	MLRLLATLAFAASFDIVLFDGKYISAVDRVAVAIFRGF*
Ga0068861_1026629631	3300005719	Switchgrass Rhizosphere	MLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0066903_1003580973	3300005764	Tropical Forest Soil	LANLAFAASFDILLFDGKCISTVDKIAVQIIGHF*
Ga0066903_1038569171	3300005764	Tropical Forest Soil	MLLRILATLAFAASFDILGLDGKYISAVDKVAVAIFQSF*
Ga0066903_1040701063	3300005764	Tropical Forest Soil	MLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF*
Ga0066903_1064599362	3300005764	Tropical Forest Soil	MLRLLATLAFAASFDIVLFDGKYISAVDRVAVAIFRSF*
Ga0068863_1014375291	3300005841	Switchgrass Rhizosphere	LRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0075023_1002912472	3300006041	Watersheds	MLRLLTTMAIAASFDILLFDGKYTDAAHQLAVIAIQHF*
Ga0075023_1005836412	3300006041	Watersheds	MLLRILATLAFAASFDILIMDGKYIGAVDKLAVAIFQSF*
Ga0075026_1004744592	3300006057	Watersheds	MLRLLATLAFAASFDILLFDGKYIGAVSKIAVAIIQHF*
Ga0075026_1005415772	3300006057	Watersheds	MLLRILATLAFAASFDILIMDGKYIGAVDKVAVAIIQSF*
Ga0075026_1007816322	3300006057	Watersheds	MLLRILATLAFAASFDILILDGKYISAGDKVAVAIFQSF*
Ga0070716_1009550592	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MLRLLATLAFAASFDILLNDGKYISAVNKLAVAVIHHF*
Ga0070712_1005579481	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	RMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0070712_1018985202	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	RILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0075367_108847722	3300006178	Populus Endosphere	AAHMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0097621_1008565231	3300006237	Miscanthus Rhizosphere	IFETYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0074048_123471001	3300006581	Soil	MLRLLATLAFAASFDILIMDGKYISAVDKVAVAIIQSF*
Ga0079220_120957812	3300006806	Agricultural Soil	MLRLLATLAFAASFDILLFDGKYITAVDRIAAQIIQ
Ga0075428_1006635301	3300006844	Populus Rhizosphere	YTARMLRLLATLAFAASFEIILFDGRYLHAADKVAVAIIRSF*
Ga0075435_1007125621	3300007076	Populus Rhizosphere	YASHMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0105240_103427453	3300009093	Corn Rhizosphere	MLRLLATLAFAASFDILLFDGKYISAVANIAVAIVQHF*
Ga0105243_105336131	3300009148	Miscanthus Rhizosphere	MLLRILATLAFAASFDTLILDGKYISAVHKLAVAIIQHF*
Ga0126380_102226592	3300010043	Tropical Forest Soil	MQRFLATLAFAAAFDILILDGKYVSAVNHVALTFFRGF*
Ga0126380_105295182	3300010043	Tropical Forest Soil	MLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF*
Ga0126380_109516722	3300010043	Tropical Forest Soil	MLLRILATLAFAASFDILIMDGKYISAVDKVAVAIFQSF*
Ga0126380_114568562	3300010043	Tropical Forest Soil	MLRLLATLAFAASFDIILFDGRYITAVDKVAVAIYRSF*
Ga0126384_100642091	3300010046	Tropical Forest Soil	MQRFLATLAFAAAFDILFLDGKYLSAVNQVALVYFRGF*
Ga0126384_116729102	3300010046	Tropical Forest Soil	MLLRILAMLTFAWSLDGKYISAVDKVAVAIFQSF*
Ga0126382_104673752	3300010047	Tropical Forest Soil	MLRLLATLAFAVGFDILLSDGKFTDAAHRVAVAAIQNL*
Ga0126376_104585182	3300010359	Tropical Forest Soil	MLLRILATLAIAASFDILILDGKYISAVDKVALAIFQSF*
Ga0126376_128329761	3300010359	Tropical Forest Soil	MLRLLATLAFAAGFDILLSDGKFTDAAYRVAVAAIQNL*
Ga0126372_102626123	3300010360	Tropical Forest Soil	MLRLLATLAFAASFDILLCDGKYITAVDRIAVQIIQHF*
Ga0126379_114117632	3300010366	Tropical Forest Soil	MLRLLATPAFAASFDILLFDGKCTSTVDKIAVQIIGHF*
Ga0105239_105823243	3300010375	Corn Rhizosphere	DSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0134126_101758383	3300010396	Terrestrial Soil	MLRLLATLAVAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0134124_114401143	3300010397	Terrestrial Soil	FETYDSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0134121_100349161	3300010401	Terrestrial Soil	MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIF
Ga0134121_102318331	3300010401	Terrestrial Soil	TYDSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0150983_107180673	3300011120	Forest Soil	MPRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF*
Ga0137463_11867692	3300011444	Soil	MLRLLATLAFAVSFDILLFDGKYVNAVEHIALAVVQKF*
Ga0157346_10083342	3300012480	Arabidopsis Rhizosphere	MLLRILATLAFAASFDSLIMDGKYLSAVDKVAVAIFQSF*
Ga0157337_10246712	3300012483	Arabidopsis Rhizosphere	LATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0157343_10021442	3300012488	Arabidopsis Rhizosphere	MLLCILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF*
Ga0164300_102550273	3300012951	Soil	IIAVQESTSLIFETYDSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF*
Ga0164303_100851925	3300012957	Soil	MLRLLATLGFAVSFDILLFDGKYVNAVEHIALAVVQKF*
Ga0164299_105463461	3300012958	Soil	MLRLLATLAFAASFDILLFDGKYITAVDKIAVALIQHF*
Ga0164309_102175844	3300012984	Soil	ETYDSRMLRLLATLAFAASFDILLFDGRYISAVANIAVAIVQHF*
Ga0164308_103823893	3300012985	Soil	MLRLLATLAFAASFDILLFDGKYISAVHILAVAIIQHF*
Ga0164307_112917962	3300012987	Soil	MLRLLATLAFAASFDILLNDGKYISAVNKLAVAIIQHF*
Ga0164306_114398141	3300012988	Soil	IFETYDSRMLRLLATLAFAASFDILLFDGKYISAVANIAVAIVQHF*
Ga0157369_103148404	3300013105	Corn Rhizosphere	MLRLLATLAFAASFDILLFDCKYISAVHKLAVAIIQHF*
Ga0075352_12722263	3300014324	Natural And Restored Wetlands	LLATLAFAASFDIILFDGKYISAVDKVAVAIIRNF*
Ga0132258_114599651	3300015371	Arabidopsis Rhizosphere	MLRLLATLAFVASFDILLFDGKYITVVNKIAVQIIQHF*
Ga0132258_121973413	3300015371	Arabidopsis Rhizosphere	MLRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF*
Ga0132258_134841672	3300015371	Arabidopsis Rhizosphere	MLLRILATLAFAASFDTLILDGKYISAVDKVAVAIFQSF*
Ga0132255_1003473271	3300015374	Arabidopsis Rhizosphere	AVQESTSLIFETYDSRMLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF*
Ga0163161_117983332	3300017792	Switchgrass Rhizosphere	MLLRILATLAFAASFDTLILDGKYISAVDKVAVTIFQSF
Ga0187786_100316234	3300017944	Tropical Peatland	MMRLLLATLAFAVSFDVLLFDGKYTDAVHRIAVIAIQHF
Ga0187786_100449571	3300017944	Tropical Peatland	MQRFLATLAFAAAFDILFLDGKYISAVDHVALAFFRGF
Ga0187786_103117042	3300017944	Tropical Peatland	VGAYAPRMLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF
Ga0187785_1000075612	3300017947	Tropical Peatland	MLRLLLATLVFAVSFDVLLFDGKYTDAVHQIAVVAVQHF
Ga0187785_100062735	3300017947	Tropical Peatland	MLLRILATLAFAASFDILIMDGKYISAVDKVAVAIFQSF
Ga0187785_100159382	3300017947	Tropical Peatland	MQRFLATLAFAAAFDILFLDGKYISAVDRAALAFFRGF
Ga0187785_100352543	3300017947	Tropical Peatland	MLRLLSTTLAFVVSFDVLLFDGEYTDAVHQIAVVAIQHF
Ga0187777_101577782	3300017974	Tropical Peatland	MLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHF
Ga0184608_104705842	3300018028	Groundwater Sediment	MLRFLAFAASFDILLLEGKYISAVDKVAVAIVRSF
Ga0184621_101416982	3300018054	Groundwater Sediment	MLRLLATLAFAASFDIILFDGKYISAVDKVAVAIVR
Ga0187773_101647634	3300018064	Tropical Peatland	MPRLSATPTFAASFDILLFDGKYISAVDKVAVAVIRSF
Ga0184635_100335071	3300018072	Groundwater Sediment	MLRILATLAFAASFDIILFDGKYISAVDKVAVAIVRSF
Ga0210402_107692802	3300021478	Soil	MLRLLATLAFAASFDILLCDGKYISAVNKLAVAIIQHF
Ga0126371_132810301	3300021560	Tropical Forest Soil	MLRLLATLAFAASFDILLFDGKYITAVDRIAVQIIQHFCARSPQS
Ga0222729_10275141	3300022507	Soil	MPRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF
Ga0242662_100829033	3300022533	Soil	MLRLLATLAFAASFDILLFDGKYIGAVNKIAVAIIQHF
Ga0242662_101313373	3300022533	Soil	MLRLLATLAFAASFDILLFDGKYICAGDKIAVALIQHF
Ga0222623_100170262	3300022694	Groundwater Sediment	MLRLLATLAFAASFDIILFDGKYISAVDKVAVAIVRSF
Ga0222622_1001022310	3300022756	Groundwater Sediment	MLRFLVTLAFAASFDILLLEGKYISAVDKVAVAIVRSF
Ga0207682_104526372	3300025893	Miscanthus Rhizosphere	MLRLLATLAFAASFDILLFDGKYISAVHKLAVAIIQHF
Ga0207693_100097371	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	HMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF
Ga0207693_104700834	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MLRLLATLAFAASFDILLFDGKYISAVANIAVAIVQHF
Ga0207689_100433806	3300025942	Miscanthus Rhizosphere	MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSV
Ga0207640_105731343	3300025981	Corn Rhizosphere	NSRMLRLLATLAFAASFDILLFDGKYISAVGNIAVAIVQHF
Ga0208890_10859511	3300027523	Soil	MLRLLTTMAIAASFDILLFDGKYTDAAHQLAVIAIQ
Ga0209068_108663092	3300027894	Watersheds	MLRLLATLAFAASFDILLFDGKYISAVDKLAVAIIQHF
Ga0209583_107401702	3300027910	Watersheds	MLLRILATLAFAASFDILIMDGKYIGAVDKLAVAIFQSF
Ga0075373_101839661	3300030945	Soil	MLRLLATLAFAASFDILLFDGKYIGAVSKIAVAIIQHF
Ga0170824_11973189511	3300031231	Forest Soil	MLRFLVTLAFAASFDILLLEGKYISAVDKVAVAIVRSY
Ga0307505_105657551	3300031455	Soil	MLRLLATLAFAASFDILFFDGKYIGAVSKIAVAIIQHF
Ga0310888_100422901	3300031538	Soil	EHIVGDYASHMLLRILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF
Ga0307469_111115941	3300031720	Hardwood Forest Soil	MLRLLATLAFAASFDILLNDGKYISAVNKLAVAIIQHF
Ga0306918_110231991	3300031744	Soil	MLRLLATPAFAASFDILLFDGISTVDKIAVQIIGNF
Ga0310899_100420992	3300032017	Soil	MLLCILATLAFAASFDILIMDGKYLSAVDKVAVAIFQSF
Ga0310890_111893132	3300032075	Soil	MLLRILATLAFAASFDILIMDGKYLSAVDKVAVAI
Ga0307470_103786732	3300032174	Hardwood Forest Soil	MLRLLATLAFAASFDILLNDGKYISAVNKLAVAII
Ga0307471_1016940911	3300032180	Hardwood Forest Soil	MLRLLATLAFAASFDVLLNDGKYISAVNKLAVAIIQHF
Ga0335084_111829752	3300033004	Soil	MLLRILATLAFAASFDILIMDGKYIGAVDKIAVAILQSF
Ga0310810_102339521	3300033412	Soil	ITKIYDEIMLRLLATLGFAVSFDILLFDGKYVNAVEHIALAVVQKF
Ga0326726_100168997	3300033433	Peat Soil	MLRLLITMAIAASFDILLFDGKYADAAHQLAVIAIQHF
Ga0326726_119445572	3300033433	Peat Soil	MFRLLATLAFVVGSDILLFDGKYTDAAHQLAVIAIQHL
Ga0326723_0230089_595_711	3300034090	Peat Soil	MLRLLTTMAIAASFDILLFDGKYTDAAHQLAVIALQHF
Ga0326723_0282272_299_415	3300034090	Peat Soil	MLRLSATLAFAASFDILLFDGKNISAVDKVAVAIIRSF

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F072661

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences