| Basic Information | |
|---|---|
| Family ID | F072638 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 44 residues |
| Representative Sequence | KSAFHPELQREMTVADLVERMGGHGAGHLQQIEKLKAAASGK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.87 % |
| % of genes from short scaffolds (< 2000 bps) | 87.60 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.901 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.876 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.008 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.587 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF00591 | Glycos_transf_3 | 31.40 |
| PF02885 | Glycos_trans_3N | 5.79 |
| PF13847 | Methyltransf_31 | 3.31 |
| PF04402 | SIMPL | 3.31 |
| PF12867 | DinB_2 | 3.31 |
| PF07238 | PilZ | 1.65 |
| PF04366 | Ysc84 | 1.65 |
| PF03100 | CcmE | 0.83 |
| PF08282 | Hydrolase_3 | 0.83 |
| PF02517 | Rce1-like | 0.83 |
| PF07676 | PD40 | 0.83 |
| PF14534 | DUF4440 | 0.83 |
| PF02629 | CoA_binding | 0.83 |
| PF02786 | CPSase_L_D2 | 0.83 |
| PF01244 | Peptidase_M19 | 0.83 |
| PF00171 | Aldedh | 0.83 |
| PF14517 | Tachylectin | 0.83 |
| PF12391 | PCDO_beta_N | 0.83 |
| PF03571 | Peptidase_M49 | 0.83 |
| PF13414 | TPR_11 | 0.83 |
| PF00144 | Beta-lactamase | 0.83 |
| PF04229 | GrpB | 0.83 |
| PF03544 | TonB_C | 0.83 |
| PF03459 | TOBE | 0.83 |
| PF14319 | Zn_Tnp_IS91 | 0.83 |
| PF00155 | Aminotran_1_2 | 0.83 |
| PF08281 | Sigma70_r4_2 | 0.83 |
| PF04055 | Radical_SAM | 0.83 |
| PF08544 | GHMP_kinases_C | 0.83 |
| PF01979 | Amidohydro_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 3.31 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 3.31 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 3.31 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 1.65 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.83 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.83 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.83 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.83 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.83 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.83 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.83 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.83 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.83 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.83 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.83 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.90 % |
| Unclassified | root | N/A | 28.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10822029 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300004152|Ga0062386_101559197 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300004152|Ga0062386_101582497 | Not Available | 546 | Open in IMG/M |
| 3300005332|Ga0066388_102007735 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300005332|Ga0066388_105471513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300005445|Ga0070708_100913618 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005451|Ga0066681_10246944 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005526|Ga0073909_10589091 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005542|Ga0070732_10016772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4094 | Open in IMG/M |
| 3300005556|Ga0066707_10995913 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006059|Ga0075017_101292475 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006174|Ga0075014_100319679 | Not Available | 824 | Open in IMG/M |
| 3300006358|Ga0068871_100626859 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300009038|Ga0099829_11719234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300009088|Ga0099830_10275666 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300009088|Ga0099830_11476862 | Not Available | 566 | Open in IMG/M |
| 3300009089|Ga0099828_10634443 | Not Available | 961 | Open in IMG/M |
| 3300009089|Ga0099828_11770802 | Not Available | 543 | Open in IMG/M |
| 3300009522|Ga0116218_1384161 | Not Available | 627 | Open in IMG/M |
| 3300009624|Ga0116105_1255773 | Not Available | 500 | Open in IMG/M |
| 3300009632|Ga0116102_1047992 | Not Available | 1350 | Open in IMG/M |
| 3300009645|Ga0116106_1008544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3876 | Open in IMG/M |
| 3300009762|Ga0116130_1103376 | Not Available | 894 | Open in IMG/M |
| 3300010339|Ga0074046_10000963 | All Organisms → cellular organisms → Bacteria | 26662 | Open in IMG/M |
| 3300010339|Ga0074046_10005224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 10418 | Open in IMG/M |
| 3300010359|Ga0126376_10111199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2113 | Open in IMG/M |
| 3300010364|Ga0134066_10302862 | Not Available | 575 | Open in IMG/M |
| 3300010366|Ga0126379_13068927 | Not Available | 559 | Open in IMG/M |
| 3300010379|Ga0136449_101954748 | Not Available | 869 | Open in IMG/M |
| 3300010401|Ga0134121_12098689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300011271|Ga0137393_11622951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300011271|Ga0137393_11727067 | Not Available | 514 | Open in IMG/M |
| 3300012205|Ga0137362_10549629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300012351|Ga0137386_10552861 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300012362|Ga0137361_10062149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3128 | Open in IMG/M |
| 3300012362|Ga0137361_11370214 | Not Available | 631 | Open in IMG/M |
| 3300012582|Ga0137358_10553307 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300012582|Ga0137358_10756231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300012923|Ga0137359_11035363 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012923|Ga0137359_11665873 | Not Available | 525 | Open in IMG/M |
| 3300012925|Ga0137419_11817987 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012986|Ga0164304_10692710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300014162|Ga0181538_10531184 | Not Available | 617 | Open in IMG/M |
| 3300014168|Ga0181534_10853591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300014168|Ga0181534_11018652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300014489|Ga0182018_10028461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3578 | Open in IMG/M |
| 3300014489|Ga0182018_10140718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1384 | Open in IMG/M |
| 3300014489|Ga0182018_10686352 | Not Available | 534 | Open in IMG/M |
| 3300014491|Ga0182014_10241980 | Not Available | 951 | Open in IMG/M |
| 3300014495|Ga0182015_10125962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1757 | Open in IMG/M |
| 3300014501|Ga0182024_10720180 | Not Available | 1228 | Open in IMG/M |
| 3300015241|Ga0137418_11199288 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300016341|Ga0182035_10621896 | Not Available | 935 | Open in IMG/M |
| 3300016371|Ga0182034_10367892 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300016387|Ga0182040_11551105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300016404|Ga0182037_10287522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1316 | Open in IMG/M |
| 3300016445|Ga0182038_11226244 | Not Available | 669 | Open in IMG/M |
| 3300017823|Ga0187818_10396616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300017938|Ga0187854_10286823 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300017948|Ga0187847_10050086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2388 | Open in IMG/M |
| 3300017955|Ga0187817_10615418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300017975|Ga0187782_10292632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1228 | Open in IMG/M |
| 3300017975|Ga0187782_10950298 | Not Available | 667 | Open in IMG/M |
| 3300018027|Ga0184605_10137350 | Not Available | 1095 | Open in IMG/M |
| 3300018034|Ga0187863_10076531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1888 | Open in IMG/M |
| 3300018037|Ga0187883_10013104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4655 | Open in IMG/M |
| 3300018043|Ga0187887_10810211 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018057|Ga0187858_10464014 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300018090|Ga0187770_10239335 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300018090|Ga0187770_11714237 | Not Available | 514 | Open in IMG/M |
| 3300020581|Ga0210399_10359219 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300021170|Ga0210400_10312596 | Not Available | 1291 | Open in IMG/M |
| 3300021362|Ga0213882_10081726 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300021377|Ga0213874_10337331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 575 | Open in IMG/M |
| 3300021401|Ga0210393_10470107 | Not Available | 1026 | Open in IMG/M |
| 3300021405|Ga0210387_11222150 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 652 | Open in IMG/M |
| 3300021407|Ga0210383_10013679 | All Organisms → cellular organisms → Bacteria | 6856 | Open in IMG/M |
| 3300021407|Ga0210383_10404433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1178 | Open in IMG/M |
| 3300021560|Ga0126371_10322386 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300021560|Ga0126371_11589033 | Not Available | 780 | Open in IMG/M |
| 3300025412|Ga0208194_1010792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1521 | Open in IMG/M |
| 3300025453|Ga0208455_1032149 | Not Available | 1195 | Open in IMG/M |
| 3300025454|Ga0208039_1087573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300025500|Ga0208686_1067237 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300025922|Ga0207646_10963342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300026351|Ga0257170_1044598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300026446|Ga0257178_1028528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300026496|Ga0257157_1045258 | Not Available | 737 | Open in IMG/M |
| 3300027629|Ga0209422_1139519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 547 | Open in IMG/M |
| 3300027645|Ga0209117_1060074 | Not Available | 1104 | Open in IMG/M |
| 3300027745|Ga0209908_10096792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300027745|Ga0209908_10136315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300027846|Ga0209180_10080800 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300028748|Ga0302156_10003551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11954 | Open in IMG/M |
| 3300028906|Ga0308309_11283704 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300030048|Ga0302273_1223776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300030659|Ga0316363_10318982 | Not Available | 618 | Open in IMG/M |
| 3300031231|Ga0170824_107661947 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031231|Ga0170824_127892189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1724 | Open in IMG/M |
| 3300031545|Ga0318541_10779784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300031546|Ga0318538_10389225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 754 | Open in IMG/M |
| 3300031679|Ga0318561_10387628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 767 | Open in IMG/M |
| 3300031744|Ga0306918_10377756 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300031819|Ga0318568_10173664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1324 | Open in IMG/M |
| 3300031879|Ga0306919_10034304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3231 | Open in IMG/M |
| 3300031890|Ga0306925_10023023 | All Organisms → cellular organisms → Bacteria | 6257 | Open in IMG/M |
| 3300031890|Ga0306925_10026631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5851 | Open in IMG/M |
| 3300031890|Ga0306925_10093298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 3198 | Open in IMG/M |
| 3300031912|Ga0306921_11828566 | Not Available | 652 | Open in IMG/M |
| 3300031941|Ga0310912_11346983 | Not Available | 540 | Open in IMG/M |
| 3300031941|Ga0310912_11460915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300031942|Ga0310916_10417663 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300031962|Ga0307479_11329258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300031962|Ga0307479_11441629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300032059|Ga0318533_10353042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter | 1071 | Open in IMG/M |
| 3300032065|Ga0318513_10665819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium CG_4_9_14_0_8_um_filter_58_9 | 510 | Open in IMG/M |
| 3300032076|Ga0306924_11312825 | Not Available | 776 | Open in IMG/M |
| 3300032160|Ga0311301_11542400 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300032174|Ga0307470_10094742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1691 | Open in IMG/M |
| 3300032180|Ga0307471_100499101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1364 | Open in IMG/M |
| 3300032261|Ga0306920_101693781 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.74% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.31% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.31% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 3.31% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.48% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.65% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.65% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 1.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.83% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030048 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_108220292 | 3300001593 | Forest Soil | LKVSDLSKSAFHPELQREMTVADLVERMGAHGAAHLQQIEKLKAAASKK* |
| Ga0062386_1015591972 | 3300004152 | Bog Forest Soil | PEMQREMTVADLVERMGGHGTAHLRQIEKLKEAATKSGRND* |
| Ga0062386_1015824972 | 3300004152 | Bog Forest Soil | SAFHPELQREMTVADLVERMGGHGAGHLRQIEKLKAAAGKKQ* |
| Ga0066388_1020077352 | 3300005332 | Tropical Forest Soil | LKIEDLKKSAFHPELNGPVTVADLVEKMSGHGAGHLQQIEQLKKEAAGK* |
| Ga0066388_1054715132 | 3300005332 | Tropical Forest Soil | SAFHPELQRAITVAELVEKMAGHGASHLQQIESLKAAASNPTLA* |
| Ga0070708_1009136182 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | FHPELQREVTVAELVGTMGGHGASHLRQIEQLKRQAGGK* |
| Ga0066681_102469442 | 3300005451 | Soil | DLAKSAFHPELQRDVTLAEMIEKMSGHGAGHLQQIERLKKESAGK* |
| Ga0073909_105890912 | 3300005526 | Surface Soil | MQREMTVADLVERMGGHGAAHLQQIEELKASASGKPR* |
| Ga0070732_100167724 | 3300005542 | Surface Soil | SDLSKSAFHPEMQREMTVADLVERMGGHGATHLQQIEKLKAAAGKK* |
| Ga0066707_109959131 | 3300005556 | Soil | RRAKAADFSKSAFHPELQREITVAELVGTMGGHGASHLQQIETLKKMASR* |
| Ga0075017_1012924751 | 3300006059 | Watersheds | PPDLLKSAFHPEMQREITVADLVERMGAHGAAHLQQIEKLKAAATRG* |
| Ga0075014_1003196791 | 3300006174 | Watersheds | PEMQREVSVAELVERMGGHGAGHLQQIEKLKAAANKK* |
| Ga0068871_1006268594 | 3300006358 | Miscanthus Rhizosphere | REMTVADLVERMGGHGAAHLQQIEELKASASGKPR* |
| Ga0099829_117192342 | 3300009038 | Vadose Zone Soil | SKGAFHPELQREMTVADLVERMGGHGAGHLQQIEKLKAAASNK* |
| Ga0099830_102756661 | 3300009088 | Vadose Zone Soil | SLKASDLSKGAFHPELQREMTVADLVERMGGHGAGHLQQIEELKAAASGK* |
| Ga0099830_114768621 | 3300009088 | Vadose Zone Soil | SLKASDLSKGAFHPELQREMTVADLVERMGGHGAGHLQQIEKLKAAASNK* |
| Ga0099828_106344432 | 3300009089 | Vadose Zone Soil | PELQREMTVADLVERMGGHGAGPLQQMEKFKAAASGK* |
| Ga0099828_117708021 | 3300009089 | Vadose Zone Soil | LSKGAFHPELQREMTVADLVERMGGHGAGHLQQIEKLKAAASNK* |
| Ga0116218_13841611 | 3300009522 | Peatlands Soil | LSKSAFHPELQREMTVADLVERMGGHGAAHLQQIEKLKAAASKT* |
| Ga0116105_12557731 | 3300009624 | Peatland | LSKSAFHPEMQKDMSVADLVERMGGHGAGHLQQIERLKTAAGLK* |
| Ga0116102_10479921 | 3300009632 | Peatland | RLLRSLKLSDLSKSAFHPELQREMTVADLVERMGGHGAAHLQQIKNLKAAASKM* |
| Ga0116106_10085445 | 3300009645 | Peatland | SKSAFHPEMQREITVADLVERMGGHGADHLRQIEELKVAATEDGRNK* |
| Ga0116130_11033762 | 3300009762 | Peatland | QREMTVADLVERMGGHGAAHLRQIENLKAAASKT* |
| Ga0074046_100009631 | 3300010339 | Bog Forest Soil | ELQREMTVADLVERMGGHGAAHLQQIERLKAAASKK* |
| Ga0074046_100052241 | 3300010339 | Bog Forest Soil | SLKASGLSKSAFHPEMQKEITVADLVERMGSHGAAHLQQIEELKRGASGR* |
| Ga0126376_101111991 | 3300010359 | Tropical Forest Soil | FHPEIQGNVTVGDLVERMGGHGAAHLQQIEQLKAESNNT* |
| Ga0134066_103028622 | 3300010364 | Grasslands Soil | LQRDVTLAEMIEKMSGHGTGHLQQIERLKKESAGK* |
| Ga0126379_130689272 | 3300010366 | Tropical Forest Soil | FHPEAQRNVTVAELVQMMARHGAGHLQQIEKLKAAASQ* |
| Ga0136449_1019547481 | 3300010379 | Peatlands Soil | DLSKSAFHPELQREMTVADLVERMGVHGAGHLQQIEKLKTAASKK* |
| Ga0134121_120986892 | 3300010401 | Terrestrial Soil | MKREMTVADLVERMGGHGAAHLQQIEELKASASGKPR* |
| Ga0137393_116229511 | 3300011271 | Vadose Zone Soil | KASDLSKGAFHPELQREMTVADLVERMGGHGAGHLQQIEKLKAAASNK* |
| Ga0137393_117270671 | 3300011271 | Vadose Zone Soil | ELQREMTVADLVERMGGHGAGHLQQIEKLKAAASGK* |
| Ga0137362_105496291 | 3300012205 | Vadose Zone Soil | LSKGAFHPELQREMTVADLVERMGGHGSGHLQQIEKLKAAARSK* |
| Ga0137386_105528612 | 3300012351 | Vadose Zone Soil | PELNRKVTVAELLEKLSAHGAGHLQQIEKLKKAATQ* |
| Ga0137361_100621491 | 3300012362 | Vadose Zone Soil | PELQREVTVAEMIEKMSGHGTGHLQQIERLKKESAGK* |
| Ga0137361_113702141 | 3300012362 | Vadose Zone Soil | PELQREMTVADLVERMGGHGSGHLQQIEKLKAAARSK* |
| Ga0137358_105533072 | 3300012582 | Vadose Zone Soil | ASELSKSAFHPELQREMTVADLVERMGGHGTGHLRQIEQLKAAASGK* |
| Ga0137358_107562312 | 3300012582 | Vadose Zone Soil | LKVSDLSKSAFHPELQREMTIADLVERMGGHGTGHLQQIEKLKATASKK* |
| Ga0137359_110353632 | 3300012923 | Vadose Zone Soil | GAFHPELQREMTVADLVERIGGHGAGHLRQIEQLKAAASGK* |
| Ga0137359_116658731 | 3300012923 | Vadose Zone Soil | AFHPELQREVTVAEMIEMMSGHGNGHLQQIERLKKESAGK* |
| Ga0137419_118179872 | 3300012925 | Vadose Zone Soil | FHPELQREMTVADLVERMGGHGAGHLQQIEKLKAMAIKK* |
| Ga0164304_106927101 | 3300012986 | Soil | HPELQRAVTVAEMIEKLAGHGDGHLKQIERLKKESAGK* |
| Ga0181538_105311842 | 3300014162 | Bog | FHPELQREMTDADLVERMGGHGAAHLQQIEKLKAAAGNK* |
| Ga0181534_108535912 | 3300014168 | Bog | LSKSAFHPEMQREMTVADLVERMGGHGTAHLQKIEKLKAAAGSK* |
| Ga0181534_110186522 | 3300014168 | Bog | FSKSAFHPEMQKDITVVDLVERMGGHGAGHLQQIERLKAAASKK* |
| Ga0182018_100284615 | 3300014489 | Palsa | LKASDLSKSAFHPELQREVTGADLVERMGGHGAGHLQQIEKLKTAA |
| Ga0182018_101407181 | 3300014489 | Palsa | LSKSAFHPELQREVTGADLVERMGGHGAGHLQQIEKLKTAAGKK* |
| Ga0182018_106863522 | 3300014489 | Palsa | LSKSAFHPELQREVTGADLVERMGGHGAGHLQQIEKLKTAASKK* |
| Ga0182014_102419802 | 3300014491 | Bog | LRSLKAPDFAKSAFHPEMQREMTVADLIERMGGHGAGHLKQIEKLKAAASVN* |
| Ga0182015_101259622 | 3300014495 | Palsa | LKASDLSKSAFHPELQREVTGADLVERMGGHGAGHLQQIEKLKTAASKK* |
| Ga0182024_107201802 | 3300014501 | Permafrost | FSKSAFHPELQREMTVADLVERIGGHGAAHLRQIEKLKTAASKK* |
| Ga0137418_111992882 | 3300015241 | Vadose Zone Soil | SKSAFHPELRREMTVADLVERMGGHGAGHLQQIEKLKAMAIKK* |
| Ga0182035_106218961 | 3300016341 | Soil | VSDLSKSAFHPETQREVTVADLVERMAGHGAAHLRQIEQLKAAASNE |
| Ga0182034_103678922 | 3300016371 | Soil | DLSKSAFHPETQRDVTVADLVQRMAGHGTGHLQQIEKLKAAACSE |
| Ga0182040_115511051 | 3300016387 | Soil | LLRALRVSDLSKSAFHPEIQRNVTVADLVERMGGHGAAHLQQIERLKTEASNL |
| Ga0182037_102875221 | 3300016404 | Soil | KVSDLSKSAFHPETQGRVTVADLVERMAAHGAAHLRQIEQLKAGASNE |
| Ga0182038_112262441 | 3300016445 | Soil | KVSDLSNSAFHPETQREVTVADLVERMAGHGAAHLRQIEQLKAAASNE |
| Ga0187818_103966161 | 3300017823 | Freshwater Sediment | KVSDLSKSAFHPELQREMTVADLVERMGGHGTAHLRQIENLKTAASKT |
| Ga0187854_102868232 | 3300017938 | Peatland | LKASDFSKSAFHPEMQREITVADLVERMGGHGADHLRQIEELKVAATEDGRNK |
| Ga0187847_100500861 | 3300017948 | Peatland | MQREMTVADLIERMGGHGAGHLKQIEKLKAAASVN |
| Ga0187817_106154182 | 3300017955 | Freshwater Sediment | LLRSLKASDLSKSAFHPEMQKEITVADLVERMGTHGAAHLRQIEELKREAGSR |
| Ga0187782_102926321 | 3300017975 | Tropical Peatland | IQREITVADLVERMGNHGAAHLRQIENLKAEANRKAVRH |
| Ga0187782_109502982 | 3300017975 | Tropical Peatland | SKSAFHPEMQQQMTVADLVQRMAAHGAAHLQQIEKLKAAARRK |
| Ga0184605_101373502 | 3300018027 | Groundwater Sediment | PDLDKGGFHPERNRKVTVAELVEMMAKHGANHLQQIERLKQQPA |
| Ga0187863_100765311 | 3300018034 | Peatland | LLRSLKASDLSKSAFHPEMQKDITVADLIERMGGHGAGHLQQIEKLKTAASNR |
| Ga0187883_100131041 | 3300018037 | Peatland | FHPEMQREITVADVVERMGGHGTAHLRQIEELKAAATKTAATSSFSQP |
| Ga0187887_108102111 | 3300018043 | Peatland | KAAFHPELQRDMTVADLIERMGGHGAGHLQQIERLKAAASKK |
| Ga0187858_104640142 | 3300018057 | Peatland | LKLSDLSKSAFHPELQREMTVADLVERMGGHGAAHLQQIESLKAAASKT |
| Ga0187770_102393351 | 3300018090 | Tropical Peatland | VSDLSKSAYHPEIKREVTVADLVERMAAHGAAHLRQIEKLKAEASK |
| Ga0187770_117142371 | 3300018090 | Tropical Peatland | VSDLSKSAYHPEIKREVTVADLVERMAAHGAAHLRQIEKLKSEANK |
| Ga0210399_103592191 | 3300020581 | Soil | LRLLRSLKAADFSKSAFHPELQREVTVAELVERMGGHGAGHLQQIEKLKTAAGKK |
| Ga0210400_103125963 | 3300021170 | Soil | PEAQREVTVADLVERMSGHGTAHLEQIEKLKAAVSKK |
| Ga0213882_100817262 | 3300021362 | Exposed Rock | SERLRDVTVADLVERIGAHGAAHLQQIENLKAEARRK |
| Ga0213874_103373312 | 3300021377 | Plant Roots | LRGLSLCDLSKSAFHPETKREVTVADLVERISAHGAAHLQQIENLKAEAGRK |
| Ga0210393_104701071 | 3300021401 | Soil | LRLLRSLKPSDFSKSAFHPEAQREVTVADLVERMSGHGTAHLQQIEKLKAAVSKK |
| Ga0210387_112221501 | 3300021405 | Soil | LSKSAFHPEMEREVTVADLVERMGGHGVAHLQQIERLKAAASCKQ |
| Ga0210383_100136796 | 3300021407 | Soil | AQREVTVADLVERMSGHGTAHLQQIEKLKAAVSKK |
| Ga0210383_104044331 | 3300021407 | Soil | FHPELQRDMTVAELVERISAHGASHLQQIEKLKAAANH |
| Ga0126371_103223863 | 3300021560 | Tropical Forest Soil | DLSKSAFHPEMQRQMTVADLVQRMAGHGAAHLEQIEKLKAAARRK |
| Ga0126371_115890332 | 3300021560 | Tropical Forest Soil | AFHPEIQGNVTVADLVERMGGHGAAHLQQIERLKAESNNM |
| Ga0208194_10107923 | 3300025412 | Peatland | PEMQREMTVADLIERMGGHGAGHLKQIEKLKAAASVN |
| Ga0208455_10321492 | 3300025453 | Peatland | RLLRSLKLSDLSKSAFHPELQREMTVADLVERMGGHGAAHLQQIKNLKAAASKM |
| Ga0208039_10875732 | 3300025454 | Peatland | LSKSAFHPEMQREITVADVVERMGGHGTAHLRQIEELKAAATKTAATSSFSQP |
| Ga0208686_10672371 | 3300025500 | Peatland | AFHPEMQREITVADLVERMGGHGADHLRQIEELKVAATEDGRNK |
| Ga0207646_109633422 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RRAKAADFSKSAYHPELQRDVTVAEIVEGMGGHGASHLQQIEKLKQQAGGK |
| Ga0257170_10445981 | 3300026351 | Soil | KSAFHPELQREMTVADLVERMGGHGAGHLQQIEKLKAAASGK |
| Ga0257178_10285281 | 3300026446 | Soil | SKGALHPELQREMTVADLVERMGGHGAGHLQQIEELKAAASGK |
| Ga0257157_10452582 | 3300026496 | Soil | ELQREMTVADLVERMGGHGAGHLQQIEKLKAMASGK |
| Ga0209422_11395191 | 3300027629 | Forest Soil | SAFHPEMLREMTVAELVERMAGHGAAHLQQIERLKAMASKKAGLTPRTE |
| Ga0209117_10600741 | 3300027645 | Forest Soil | SAFHPELQREMTVADLVERIGGHGAAHLQQIEKLKAMAIGK |
| Ga0209908_100967922 | 3300027745 | Thawing Permafrost | LKASDLSKSAFHPELQREVTGADLVERMGGHGAGHLQQIEKLKTAAGKK |
| Ga0209908_101363151 | 3300027745 | Thawing Permafrost | SPGKMCIRDSSKSAFHPELQREMTVADLVERMGGHGAGHLQQIEKLKAAASKK |
| Ga0209180_100808004 | 3300027846 | Vadose Zone Soil | PELQREMTVADLVERMGGHGAGHLQQIEKLKAAASGK |
| Ga0302156_1000355113 | 3300028748 | Bog | LRSLKAPDFAKSAFHPEMQREMTVADLIERMGGHGAGHLKQIEKLKAAASVN |
| Ga0308309_112837041 | 3300028906 | Soil | NLRLLRSLKASDLSKSAFHPEMQREMTVADLVERMGGHGATHLQQIEKLKAAAGKK |
| Ga0302273_12237762 | 3300030048 | Bog | TPADLTKSAFHPEMQREMTVAEIVERIGVHGANHLAQIEKLKKMANQ |
| Ga0316363_103189822 | 3300030659 | Peatlands Soil | SDLSKSAFHPEMQREMTVADLIERMSGHGAGHLQQIERLKAAASNK |
| Ga0170824_1076619471 | 3300031231 | Forest Soil | PEMQQEITVADLVERMGGHGAAHLQQIEKLKALASRK |
| Ga0170824_1278921891 | 3300031231 | Forest Soil | MQREMTVADLVERMGAHGAAHLQQIEELKASANGKPR |
| Ga0318541_107797841 | 3300031545 | Soil | HPETQGRVTVADLVERMAAHGAAHLRQIEQLKAGASNE |
| Ga0318538_103892252 | 3300031546 | Soil | ETQREVTVADLLERMAGHGAAHLRQIEQLKAAASNE |
| Ga0318561_103876281 | 3300031679 | Soil | LRNLKVSDLSKSAFHPETQREVTVADLVERMAGQGAGHLRQIEQLKAAASNE |
| Ga0306918_103777562 | 3300031744 | Soil | KSAFHPETQRDVTVADLVQRMAGHGTGHLQQIEKLKAAACSE |
| Ga0318568_101736641 | 3300031819 | Soil | LRVSDLSKSAFHPEIQRNVTVADLVERMGGHGAAHLQQIGRLKAEAASCSFS |
| Ga0306919_100343045 | 3300031879 | Soil | SAFHPETQGRVTVADLVERMAAHGAAHLRQIEQLKAGASNE |
| Ga0306925_100230231 | 3300031890 | Soil | LKAADLSKSAFHPETQRDVTVADLVQRMAGHGTGHLQQIEKLKAAACSE |
| Ga0306925_100266318 | 3300031890 | Soil | RLLRNLKVSDLSKSAFHPETQREVTVADLVERMAGHGAAHLRQIEQLKAAASNE |
| Ga0306925_100932982 | 3300031890 | Soil | RNLKVSDLSKSAFHPETQREVTVADLVERMAGQGAGHLRQIEQLKAAASNE |
| Ga0306921_118285661 | 3300031912 | Soil | HNLRLLRNLKVSDLSKSAFHPETQREVTVADLVERMAGHGAAHLRQIEQLKAAASNE |
| Ga0310912_113469831 | 3300031941 | Soil | TQREVTVADLVERMAGHGAAHLRQIEKLKAAASNE |
| Ga0310912_114609151 | 3300031941 | Soil | NLKAADLSKSAFHPETQRDVTVADLVQRMAGHGTGHLQQIERLKAAARSE |
| Ga0310916_104176632 | 3300031942 | Soil | HPETQRDVTVADLVQRMAGHGTGHLQQIEKLKAAACSE |
| Ga0307479_113292581 | 3300031962 | Hardwood Forest Soil | SAFHPELQREMTVADLVERMGEHGAGHLQQIEKLKAAASGK |
| Ga0307479_114416292 | 3300031962 | Hardwood Forest Soil | NLRLLRRLKVSDLSKSAFHPELQREMTVADLVERMGGHGTGHLQQIEQLKTAASSK |
| Ga0318533_103530421 | 3300032059 | Soil | SKSAFHPETQREVTVADLVERMAGHGAAHLRQIEQLKAAASNE |
| Ga0318513_106658191 | 3300032065 | Soil | SDLSKSAFHPETQREVTVADLVERMAGHGAAHLRQIEQLKAAASNE |
| Ga0306924_113128252 | 3300032076 | Soil | HPETQREVTVADLVERMAGHGAAHLRQIEQLKAAASNE |
| Ga0311301_115424001 | 3300032160 | Peatlands Soil | DLSKSAFHPELQREMTVADLVERMGVHGAGHLQQIEKLKTAASKK |
| Ga0307470_100947424 | 3300032174 | Hardwood Forest Soil | KSAFHPEMQREVTVADLVERMGGHGATHLQQIERLKAAASSKQS |
| Ga0307471_1004991011 | 3300032180 | Hardwood Forest Soil | AFHPELQREVTVAEMIEKMSGHGAGHLQQIERLKKEAASK |
| Ga0306920_1016937813 | 3300032261 | Soil | SDLSKSAFHPEIQQNVTVADLVERMGGHGSAHLQQIERLKAEASNV |
| ⦗Top⦘ |