Basic Information | |
---|---|
Family ID | F072624 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 121 |
Average Sequence Length | 42 residues |
Representative Sequence | DLARLLGDAFTIELHAVEPRIDPPPDNPHIADVVLRARRR |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 121 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.65 % |
% of genes near scaffold ends (potentially truncated) | 95.87 % |
% of genes from short scaffolds (< 2000 bps) | 93.39 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (61.983 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.661 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.579 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.322 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.35% β-sheet: 27.94% Coil/Unstructured: 64.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 121 Family Scaffolds |
---|---|---|
PF13376 | OmdA | 4.96 |
PF01740 | STAS | 2.48 |
PF06197 | DUF998 | 2.48 |
PF08241 | Methyltransf_11 | 2.48 |
PF00171 | Aldedh | 2.48 |
PF07311 | Dodecin | 1.65 |
PF12697 | Abhydrolase_6 | 1.65 |
PF00067 | p450 | 1.65 |
PF01738 | DLH | 1.65 |
PF04075 | F420H2_quin_red | 1.65 |
PF00196 | GerE | 1.65 |
PF05988 | DUF899 | 0.83 |
PF13473 | Cupredoxin_1 | 0.83 |
PF02776 | TPP_enzyme_N | 0.83 |
PF00296 | Bac_luciferase | 0.83 |
PF13560 | HTH_31 | 0.83 |
PF03706 | LPG_synthase_TM | 0.83 |
PF09995 | MPAB_Lcp_cat | 0.83 |
PF01799 | Fer2_2 | 0.83 |
PF03704 | BTAD | 0.83 |
PF02738 | MoCoBD_1 | 0.83 |
PF08044 | DUF1707 | 0.83 |
PF14026 | DUF4242 | 0.83 |
PF03006 | HlyIII | 0.83 |
PF10604 | Polyketide_cyc2 | 0.83 |
PF00723 | Glyco_hydro_15 | 0.83 |
PF13537 | GATase_7 | 0.83 |
PF01906 | YbjQ_1 | 0.83 |
PF13490 | zf-HC2 | 0.83 |
PF06114 | Peptidase_M78 | 0.83 |
PF00903 | Glyoxalase | 0.83 |
PF06441 | EHN | 0.83 |
PF01145 | Band_7 | 0.83 |
PF13410 | GST_C_2 | 0.83 |
PF06736 | TMEM175 | 0.83 |
PF00583 | Acetyltransf_1 | 0.83 |
PF07228 | SpoIIE | 0.83 |
PF00107 | ADH_zinc_N | 0.83 |
PF00155 | Aminotran_1_2 | 0.83 |
PF00440 | TetR_N | 0.83 |
PF01061 | ABC2_membrane | 0.83 |
PF06983 | 3-dmu-9_3-mt | 0.83 |
PF01243 | Putative_PNPOx | 0.83 |
PF01326 | PPDK_N | 0.83 |
PF00697 | PRAI | 0.83 |
PF13207 | AAA_17 | 0.83 |
PF04072 | LCM | 0.83 |
PF08242 | Methyltransf_12 | 0.83 |
PF02129 | Peptidase_S15 | 0.83 |
PF03596 | Cad | 0.83 |
COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
---|---|---|---|
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.48 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.48 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.48 |
COG3371 | Uncharacterized membrane protein | Function unknown [S] | 2.48 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.65 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.65 |
COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.83 |
COG4300 | Cadmium resistance protein CadD, predicted permease | Inorganic ion transport and metabolism [P] | 0.83 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.83 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.83 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.83 |
COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.83 |
COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.83 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.83 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.83 |
COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.83 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.83 |
COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.83 |
COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.83 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
COG0135 | Phosphoribosylanthranilate isomerase | Amino acid transport and metabolism [E] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 61.98 % |
Unclassified | root | N/A | 38.02 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573001|GZR05M101DI7ZU | Not Available | 520 | Open in IMG/M |
3300004479|Ga0062595_101709668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
3300005340|Ga0070689_101480053 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005529|Ga0070741_11404168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
3300005539|Ga0068853_101086229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
3300005564|Ga0070664_101363315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora saliphila | 670 | Open in IMG/M |
3300005993|Ga0080027_10357992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
3300006046|Ga0066652_100610532 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300006048|Ga0075363_100540090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
3300006092|Ga0082021_1014398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3523 | Open in IMG/M |
3300006102|Ga0075015_100738190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
3300006174|Ga0075014_100823719 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300006755|Ga0079222_10612995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 835 | Open in IMG/M |
3300006800|Ga0066660_10413181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
3300006806|Ga0079220_11118432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300009137|Ga0066709_102310932 | Not Available | 736 | Open in IMG/M |
3300009147|Ga0114129_10863461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
3300009177|Ga0105248_10933064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
3300009698|Ga0116216_10101484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1771 | Open in IMG/M |
3300010166|Ga0126306_10157974 | Not Available | 1689 | Open in IMG/M |
3300010358|Ga0126370_11259395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
3300010358|Ga0126370_12541514 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300010373|Ga0134128_11070350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
3300010398|Ga0126383_13322390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
3300010867|Ga0126347_1404091 | Not Available | 649 | Open in IMG/M |
3300012357|Ga0137384_11324472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
3300012955|Ga0164298_10338622 | Not Available | 948 | Open in IMG/M |
3300012960|Ga0164301_10147245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1435 | Open in IMG/M |
3300012976|Ga0134076_10299619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 696 | Open in IMG/M |
3300012985|Ga0164308_10103571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2007 | Open in IMG/M |
3300014150|Ga0134081_10161365 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300014272|Ga0075327_1253998 | Not Available | 574 | Open in IMG/M |
3300014657|Ga0181522_10393430 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300014658|Ga0181519_10902396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 547 | Open in IMG/M |
3300015082|Ga0167662_1046529 | Not Available | 541 | Open in IMG/M |
3300015357|Ga0134072_10136359 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300015372|Ga0132256_100932006 | Not Available | 984 | Open in IMG/M |
3300015374|Ga0132255_103745488 | Not Available | 646 | Open in IMG/M |
3300015374|Ga0132255_104383585 | Not Available | 598 | Open in IMG/M |
3300016294|Ga0182041_10514355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1040 | Open in IMG/M |
3300016319|Ga0182033_11539572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
3300016371|Ga0182034_10716283 | Not Available | 852 | Open in IMG/M |
3300016387|Ga0182040_11277916 | Not Available | 619 | Open in IMG/M |
3300017823|Ga0187818_10351060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
3300017966|Ga0187776_10214843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1215 | Open in IMG/M |
3300017972|Ga0187781_10589646 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300017972|Ga0187781_11476595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
3300017975|Ga0187782_10286895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1241 | Open in IMG/M |
3300018001|Ga0187815_10102391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1208 | Open in IMG/M |
3300018037|Ga0187883_10049267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Nitrolancea → Nitrolancea hollandica → Nitrolancea hollandica Lb | 2233 | Open in IMG/M |
3300018060|Ga0187765_10874257 | Not Available | 606 | Open in IMG/M |
3300018078|Ga0184612_10456299 | Not Available | 634 | Open in IMG/M |
3300018081|Ga0184625_10547936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300020150|Ga0187768_1052294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 908 | Open in IMG/M |
3300021181|Ga0210388_11000913 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300021362|Ga0213882_10152183 | Not Available | 949 | Open in IMG/M |
3300021374|Ga0213881_10170330 | Not Available | 957 | Open in IMG/M |
3300021377|Ga0213874_10441591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 512 | Open in IMG/M |
3300021405|Ga0210387_10689422 | Not Available | 906 | Open in IMG/M |
3300021560|Ga0126371_13847151 | Not Available | 506 | Open in IMG/M |
3300025908|Ga0207643_11055733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
3300025922|Ga0207646_11306519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
3300025927|Ga0207687_11424437 | Not Available | 595 | Open in IMG/M |
3300025934|Ga0207686_11528668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
3300026550|Ga0209474_10574220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
3300026557|Ga0179587_11034774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
3300027636|Ga0214469_1209984 | Not Available | 531 | Open in IMG/M |
3300030580|Ga0311355_11553100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
3300030619|Ga0268386_10348385 | Not Available | 1057 | Open in IMG/M |
3300030706|Ga0310039_10163176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 895 | Open in IMG/M |
3300031234|Ga0302325_10707181 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
3300031251|Ga0265327_10273632 | Not Available | 748 | Open in IMG/M |
3300031544|Ga0318534_10252703 | Not Available | 1017 | Open in IMG/M |
3300031561|Ga0318528_10699088 | Not Available | 543 | Open in IMG/M |
3300031564|Ga0318573_10195866 | Not Available | 1070 | Open in IMG/M |
3300031564|Ga0318573_10642547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
3300031640|Ga0318555_10132196 | Not Available | 1331 | Open in IMG/M |
3300031681|Ga0318572_10143595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1376 | Open in IMG/M |
3300031744|Ga0306918_10920616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
3300031744|Ga0306918_11082700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
3300031748|Ga0318492_10317254 | Not Available | 812 | Open in IMG/M |
3300031753|Ga0307477_10439905 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300031765|Ga0318554_10324613 | Not Available | 875 | Open in IMG/M |
3300031769|Ga0318526_10094012 | Not Available | 1192 | Open in IMG/M |
3300031770|Ga0318521_10200510 | Not Available | 1152 | Open in IMG/M |
3300031778|Ga0318498_10213275 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300031890|Ga0306925_11037915 | Not Available | 833 | Open in IMG/M |
3300031896|Ga0318551_10528309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
3300031896|Ga0318551_10941524 | Not Available | 505 | Open in IMG/M |
3300031897|Ga0318520_10294077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 977 | Open in IMG/M |
3300031910|Ga0306923_11219082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 803 | Open in IMG/M |
3300031912|Ga0306921_11994361 | Not Available | 618 | Open in IMG/M |
3300031912|Ga0306921_12409856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
3300031912|Ga0306921_12773958 | Not Available | 502 | Open in IMG/M |
3300031962|Ga0307479_12069416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
3300032009|Ga0318563_10580426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
3300032010|Ga0318569_10229337 | Not Available | 862 | Open in IMG/M |
3300032055|Ga0318575_10178762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1062 | Open in IMG/M |
3300032060|Ga0318505_10411832 | Not Available | 639 | Open in IMG/M |
3300032064|Ga0318510_10164988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 881 | Open in IMG/M |
3300032080|Ga0326721_10603610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
3300032089|Ga0318525_10702673 | Not Available | 514 | Open in IMG/M |
3300032091|Ga0318577_10313047 | Not Available | 751 | Open in IMG/M |
3300032205|Ga0307472_102081329 | Not Available | 570 | Open in IMG/M |
3300032261|Ga0306920_102483142 | Not Available | 713 | Open in IMG/M |
3300032261|Ga0306920_102844663 | Not Available | 658 | Open in IMG/M |
3300032261|Ga0306920_104250519 | Not Available | 516 | Open in IMG/M |
3300032770|Ga0335085_10017044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10478 | Open in IMG/M |
3300032770|Ga0335085_11694241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
3300032770|Ga0335085_12053893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300032782|Ga0335082_10065775 | All Organisms → cellular organisms → Bacteria | 3688 | Open in IMG/M |
3300032892|Ga0335081_11067178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 934 | Open in IMG/M |
3300032892|Ga0335081_11086307 | Not Available | 923 | Open in IMG/M |
3300032898|Ga0335072_10337661 | Not Available | 1659 | Open in IMG/M |
3300032898|Ga0335072_11181020 | Not Available | 682 | Open in IMG/M |
3300033134|Ga0335073_10181434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2634 | Open in IMG/M |
3300033181|Ga0272431_10067567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2705 | Open in IMG/M |
3300033289|Ga0310914_10383931 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
3300033290|Ga0318519_10344786 | Not Available | 879 | Open in IMG/M |
3300033551|Ga0247830_11212910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces → unclassified Actinomyces → Actinomyces sp. | 603 | Open in IMG/M |
3300033755|Ga0371489_0007254 | All Organisms → cellular organisms → Bacteria | 11138 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.44% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.13% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.31% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.48% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.48% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.65% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.65% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.65% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.65% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.65% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.65% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.65% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.83% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.83% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.83% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.83% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.83% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.83% |
Wastewater Treatment Plant | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant | 0.83% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006092 | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore | Engineered | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033181 | Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sud | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD2_01962530 | 2189573001 | Grass Soil | STILVPLLDNDFTVELHTVEARIDPPSGTPHISDVVLRARRR |
Ga0062595_1017096682 | 3300004479 | Soil | MSVHKLGGLLGDEFTVELHAVEPRIDPPPGTPHIADVVLRARRR* |
Ga0070689_1014800531 | 3300005340 | Switchgrass Rhizosphere | DYVGVDDLASLLDEDFTVELREVAPRIDPPPNTPHIADVILRARRR* |
Ga0070741_114041681 | 3300005529 | Surface Soil | GDDFAIERYGVEPRVDPPPGTPHVGDVVLRARCH* |
Ga0068853_1010862292 | 3300005539 | Corn Rhizosphere | PDEYVGADDLAPLLEADFAVELHAVEPRIDPPPGTPHVADVVLRARRR* |
Ga0070664_1013633151 | 3300005564 | Corn Rhizosphere | LFRLLGDDFTVELHAVEPRIDPPPGTPHIADVVLRARRR* |
Ga0080027_103579921 | 3300005993 | Prmafrost Soil | ADYVGADDLGQLLGDDFTVELHGVESRIDPPPDNPYIADIVLRARRR* |
Ga0066652_1006105322 | 3300006046 | Soil | LLGADFTVELHAVEPRIDPPRDTPHIADVILRARHH* |
Ga0075363_1005400903 | 3300006048 | Populus Endosphere | QLLGADFTVELHAVEPRIDPPPGNPHIADVVLRARRR* |
Ga0082021_10143986 | 3300006092 | Wastewater Treatment Plant | ALLATRDDFTVELDVVEPRVDPPGGNPHIADVVVRARRR* |
Ga0075015_1007381902 | 3300006102 | Watersheds | PADYVGADDLEQLLGADFVIELHAVEPRIDPPPGTPHIADIVLRARRH* |
Ga0075014_1008237191 | 3300006174 | Watersheds | LLGDDFTVELDVVEPRVDPPPHTPHIADVVLRARRG* |
Ga0079222_106129953 | 3300006755 | Agricultural Soil | LAPLLAADFTIELHAAEPRIDPPPGTPHIADVVLRARRR* |
Ga0066660_104131811 | 3300006800 | Soil | MKSHGVDRADYIGAADLGQLLGEDFTIELHAVEARIDPPPGTTRVADVVVRARRH* |
Ga0079220_111184321 | 3300006806 | Agricultural Soil | RLLGGEFTIELHAVQPRIDPPPDHRDIADVVLRARRR* |
Ga0066709_1023109321 | 3300009137 | Grasslands Soil | RLLGDDFTIEMHTVEPRIDPPPGTPHIADVVLRARHR* |
Ga0114129_108634611 | 3300009147 | Populus Rhizosphere | VDPADYFGDDDLGRLLSDDFTVERHAVEPRIYPPPGTPHIADIILRARRR* |
Ga0105248_109330642 | 3300009177 | Switchgrass Rhizosphere | LDDDFTVERHAIEPRIDPPPGTPHVADVVLRARRR* |
Ga0116216_101014841 | 3300009698 | Peatlands Soil | RLLGDDFTIELRAVQPRIDPPPDHPHIADVVLRARRR* |
Ga0126306_101579741 | 3300010166 | Serpentine Soil | VGADYLGRLLSDDFTIEVHAVEPRIDPPPDTPHSADVVLRARHR* |
Ga0126370_112593951 | 3300010358 | Tropical Forest Soil | FDADDLARLLGDAFTIELHAVEPRLDAPPDNPHIADVVLRARRR* |
Ga0126370_125415142 | 3300010358 | Tropical Forest Soil | DYVDAGDLARLLGGHFTIGLHAVEPRIDPPPDTPHIADVVLRAWRR* |
Ga0134128_110703501 | 3300010373 | Terrestrial Soil | FGADDLARLLDDDFTVERHAIEPRIDPPPGTPHVADVVLRARRR* |
Ga0126383_133223901 | 3300010398 | Tropical Forest Soil | DYVGADDLARLLGDAFTVELHAVEPRIDPPPGTPHIADIVLRARRR* |
Ga0126347_14040911 | 3300010867 | Boreal Forest Soil | ADYIEADGLCQLLGDEFTVELFAVEPRIDPPPDNPHVADVVLRARRR* |
Ga0137384_113244721 | 3300012357 | Vadose Zone Soil | DYFGADDLGRLLGDDCTIEMHTVEPRIDPPPGTPHIADVVLRARHR* |
Ga0164298_103386223 | 3300012955 | Soil | GADDLVPLLAGDFTVELHAVEPRIDPPPGTPHIADVVLRARRR* |
Ga0164301_101472451 | 3300012960 | Soil | PADYVGADDLVPLLAGDFTVELHAVEPRIDPPPGTPHIADVVLRARRR* |
Ga0134076_102996192 | 3300012976 | Grasslands Soil | DLGRLLGEDFAVELHAVEARIDPPPGTPHIADVVLRARRH* |
Ga0164308_101035713 | 3300012985 | Soil | DYVGADELRELLVADFTIELDVVEPRLDPPPGTPHVADIVLRARRR* |
Ga0134081_101613652 | 3300014150 | Grasslands Soil | IDPADYVGADDLGRLLGNDFRVELRTVEPRLDPPPGTSHIADIILRARRS* |
Ga0075327_12539982 | 3300014272 | Natural And Restored Wetlands | GDDFTVERHAVEARIDPPPGAPHIADVVLRARRR* |
Ga0181522_103934302 | 3300014657 | Bog | SQGIDPADYVDADDLGRLLADEFTIELRAVKPRIDPPPDNPHIADVVLRARRR* |
Ga0181519_109023961 | 3300014658 | Bog | LLGDDFTVDLHAVEPRIDPPPEGVHIADVVLRARRR* |
Ga0167662_10465291 | 3300015082 | Glacier Forefield Soil | VDPADYVDADDLRPLLGDEFAVELHAVEPRIDPPPDNPHIADVVLRARRR* |
Ga0134072_101363593 | 3300015357 | Grasslands Soil | DLGRLLGNDFRVELRTVEPRLDPPPGTSHIADIILRARRS* |
Ga0132256_1009320061 | 3300015372 | Arabidopsis Rhizosphere | YVSADDLHRLLGEDFTVELHAVEPRIDPPPDNPHIADVVLRARRR* |
Ga0132255_1037454882 | 3300015374 | Arabidopsis Rhizosphere | RELLVADFTIELDVVEPRLDPPPGTPHVADIVLRARRR* |
Ga0132255_1043835851 | 3300015374 | Arabidopsis Rhizosphere | LATLLGDDFTVELHAAEPRVDPPPGTPHIADVVLRARRR* |
Ga0182041_105143552 | 3300016294 | Soil | DLARLLGDAFTIELHAIEPRIDPPPDNPHIADVVLRARRR |
Ga0182033_115395721 | 3300016319 | Soil | LARLLVGAFTIERHAAEPRIDPPPDAPHIAEVVLRARRR |
Ga0182034_107162832 | 3300016371 | Soil | DYVDADDLARLLGDAFTIELHAVEPRIDPPPDNPHIADVVLRARRR |
Ga0182040_112779161 | 3300016387 | Soil | DPADYFGIDDVAHVLADDFTIEFHSVEARVDPPPGTPHIADAVLRARRH |
Ga0187818_103510601 | 3300017823 | Freshwater Sediment | PADYVDADALGRLLGGKFTIELHAVQPRIDPPPDTPHIADVVLRARRR |
Ga0187776_102148431 | 3300017966 | Tropical Peatland | DLARLLGDAFTIELHAAGPRIDPPPDNPHIADVVLRARRR |
Ga0187781_105896462 | 3300017972 | Tropical Peatland | DLARLLDGDFTIELHATGPRIDPPPDTPHIADVVLRARRHCR |
Ga0187781_114765951 | 3300017972 | Tropical Peatland | DPADYVDADDLSRLLGGQFTIELHAVQPRIDPPPDAPHIADVVLRARRR |
Ga0187782_102868952 | 3300017975 | Tropical Peatland | MKDRGARLLGEAFTIELLAVEPRIGPPPDNPHVADVVLRARRR |
Ga0187815_101023913 | 3300018001 | Freshwater Sediment | LGDEFTIELHAVQPRIDPPPDNPHIADVVLRARRR |
Ga0187883_100492671 | 3300018037 | Peatland | LISDDFTVELHSVEPRIDPPPDNPHIADVVLRARRR |
Ga0187765_108742572 | 3300018060 | Tropical Peatland | LLGGQFTIELHAVQPRIDPPPDHRHIADVVLRARRR |
Ga0184612_104562992 | 3300018078 | Groundwater Sediment | FGDNDLGRLLGDDFTVERHAVEPRIDPPTGTPDITDIILRARRR |
Ga0184625_105479361 | 3300018081 | Groundwater Sediment | DDLGRLLGDDFTVERHAVEPRIDPPPGTPHIADIILRARRR |
Ga0187768_10522941 | 3300020150 | Tropical Peatland | VDADDLGRLLSDEFTIELHAVEPRIDPPPDTPHIADVVLRARRR |
Ga0210388_110009131 | 3300021181 | Soil | AAYVGVDDLRALLGGDFDVELHAIEPRTDPPAGTPHVADVVLRARRRA |
Ga0213882_101521832 | 3300021362 | Exposed Rock | LARLLGGAFTIELHAVEPRIDPPPDNPHIADVVLRARRRGD |
Ga0213881_101703302 | 3300021374 | Exposed Rock | RLLGDEFTIELHAVQPRIDPPPDNPHIADVVLRARRR |
Ga0213874_104415912 | 3300021377 | Plant Roots | DYVDADDLARLLGDVFTIELHVVEPRIDPPPDHPDIADIVLRARRR |
Ga0210387_106894222 | 3300021405 | Soil | YVGAEDLYRLLGDDFTVELNVVEPRIDPPPDAPHIADAVLRARRR |
Ga0126371_138471511 | 3300021560 | Tropical Forest Soil | DYVDADDLGRLLSGQFTVELHAVEPRIDPPPDNPHIADVVLRARRC |
Ga0207643_110557331 | 3300025908 | Miscanthus Rhizosphere | PADYVLADDLARLLDEAFTVELHAVDARIDPPPGTPHIADVVLRARRR |
Ga0207646_113065191 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GRLLSDDFTVELHAVEPRIDPPPGTPHIADVVLRARRR |
Ga0207687_114244372 | 3300025927 | Miscanthus Rhizosphere | AKGHDPADYVAIEDLTRLLGDDFTIGRLVTEPRIDPPPDNPHVADVVLLARRR |
Ga0207686_115286682 | 3300025934 | Miscanthus Rhizosphere | DPADYVGADDLIQLLHDNFTLELHAVSPRIDPPPDTPHIADVVLRGRRR |
Ga0209474_105742202 | 3300026550 | Soil | GADDLVDLLGDDFTVELHAVEPRIDPPPGTPHIADIVVRARRH |
Ga0179587_110347741 | 3300026557 | Vadose Zone Soil | NAEDLALLLGDAFTIEWHAAEPRIDPPPDNPHTADVVLRARRR |
Ga0214469_12099842 | 3300027636 | Soil | ADYVGADDLGRLLGDDFMVELHAVEPRVDPPAGSPHIADVVVLGRRR |
Ga0311355_115531002 | 3300030580 | Palsa | LGDEFTIELHAVEPRIDPPADSPDIADVVLRARRG |
Ga0268386_103483853 | 3300030619 | Soil | VGADDLDRLLGDDFTVELHAVEPRIDPPAGSPHIADVVLRARRR |
Ga0310039_101631761 | 3300030706 | Peatlands Soil | ADYVDADDLARLLGEEFTIELHAVQPRIDPPPDNPHIADVVLRARRR |
Ga0302325_107071812 | 3300031234 | Palsa | DYVSADDLGRLLGDDFTVEVHAVEPRINPPADNPHAADVVLRARRR |
Ga0265327_102736321 | 3300031251 | Rhizosphere | LADDFTLELDVVEPRIDPPPDTPHIADVVLRARRR |
Ga0318534_102527033 | 3300031544 | Soil | IGRLLGDAFTIELHAVQPRIDPPADTPHIADVVLRARRR |
Ga0318528_106990881 | 3300031561 | Soil | YIGADDLVQFLDDFTVELHAVEPRIDPPPDTPHVADVVLRAQRR |
Ga0318573_101958662 | 3300031564 | Soil | VSGGAFTIELHAAEPRIDPPPDTPHIADVVLRARRR |
Ga0318573_106425471 | 3300031564 | Soil | VDADDLGRLLGDAFTIELHAVEPRIDPPPDNPHIADIVLRARRR |
Ga0318555_101321963 | 3300031640 | Soil | ARLLGGAFTIELHAAEPRIDPPPDTPHIADVVLRARRR |
Ga0318572_101435951 | 3300031681 | Soil | ADDLARLLGDAFTIELHEVRPRIDPPPDNPHIDDIVLRARRR |
Ga0306918_109206162 | 3300031744 | Soil | LGRLLGGQFTIELHAAQPRIDPPPDNPHIADVVLRARRR |
Ga0306918_110827001 | 3300031744 | Soil | YFDADDLARLLGDAFTIELHAIEPRIDPPPDNPHIADVVLRARRR |
Ga0318492_103172541 | 3300031748 | Soil | LGRLLGDAFTIELHAVQPRIDPPADTPHIADVVLRARRR |
Ga0307477_104399052 | 3300031753 | Hardwood Forest Soil | DYVDADDLRQLLGDDFTVELDTVEPRIDPPPDTPHIADVVLRARRR |
Ga0318554_103246131 | 3300031765 | Soil | DYVDADDLGRLLGGEFTIELHAVQPRIDPPPDHRDIADVVLRARRR |
Ga0318526_100940122 | 3300031769 | Soil | DYVDADGLARLLGGAFTIELHAAEPRIDPPPDTPHIADVVLRARRR |
Ga0318521_102005102 | 3300031770 | Soil | RRLLGGEFTLELHAVQPRIDPPPDHRDIADVVLRARRR |
Ga0318498_102132751 | 3300031778 | Soil | DLARLLGDAFTIELHAVEPRIDPPPDNPHIADVVLRARRR |
Ga0306925_110379152 | 3300031890 | Soil | LGRLLGDEFTIELHAVQPRINPPPDHRDIADVVLRARRR |
Ga0318551_105283091 | 3300031896 | Soil | RLLGDAFTIELHAVQPRIDPPPDNPHIADVVLRARRR |
Ga0318551_109415242 | 3300031896 | Soil | VDPADYVDVDDLGRLLGDAFTIERHAVQPRIYPPPDNPHIADVVLRARRR |
Ga0318520_102940771 | 3300031897 | Soil | VDPADYVDADDLARLLGEEFTIELHAVEPRIDPPPDHRHIADIVLRARRH |
Ga0306923_112190821 | 3300031910 | Soil | LGDAFTIELHAIEPRIDPPPDNPHIADVVLRARRR |
Ga0306921_119943612 | 3300031912 | Soil | LDDEFAIELHTIEPRIDPPPGNPHFADVVIRARRR |
Ga0306921_124098562 | 3300031912 | Soil | ADYVDADDLRRLLGGEFMIELHAVQPRIDPPPDHRDIADVVLRARRR |
Ga0306921_127739582 | 3300031912 | Soil | LLGDAFTIERHAVQPRIYPPPDNPHIADVVLRARRR |
Ga0307479_120694161 | 3300031962 | Hardwood Forest Soil | RLLSDDFTVELHAVEPRIDPPPGTPHVADVVLCARRR |
Ga0318563_105804262 | 3300032009 | Soil | VGDLLLLLGGQFTVELHAIEPRIDPPPGNPHIADVIVRARRR |
Ga0318569_102293371 | 3300032010 | Soil | LVQFLDDFTVELHAVEPRIDPPPDTPHVADVVLRAQRR |
Ga0318575_101787622 | 3300032055 | Soil | LGEEFTIELHAVEPRIDPPPDHRHIADIVLRARRH |
Ga0318505_104118321 | 3300032060 | Soil | RLLGDAFTIELHAVQPRIHPPADTPHIADVVLRARRR |
Ga0318510_101649882 | 3300032064 | Soil | VDADDLRRLLGGEFMIELHAVQPRIDPPPDHRDIADVVLRARRR |
Ga0326721_106036102 | 3300032080 | Soil | GAEDLVSLLGDDFTVESHAVEPRLDPPPGTPHVADVVLRARRR |
Ga0318525_107026731 | 3300032089 | Soil | VDADGLARLLGGAFTIELHAAEPRIDPPPDTPHIADVVLRARRR |
Ga0318577_103130472 | 3300032091 | Soil | RGLLSDDFMVELHAIEPRVDPPPDTPHIADVVLRARRR |
Ga0307472_1020813292 | 3300032205 | Hardwood Forest Soil | FVAQQPDYVDADDLGRLLGDEFTIDRHTAEPRIDPPPDTAHIGDIVLRARRR |
Ga0306920_1024831422 | 3300032261 | Soil | VDADDLARLLGDAFTIELHAVEPRIDPPPDNPHIADVVLRARRR |
Ga0306920_1028446632 | 3300032261 | Soil | ARLLGDAFTIELHAVEPRVDPPPDHPHIAGVVLRARRR |
Ga0306920_1042505191 | 3300032261 | Soil | DLRRLLAEDFTVELDAVEPRVDPPPDTSHMADVVLRARGR |
Ga0335085_100170446 | 3300032770 | Soil | MSMRRGSPVRLLGDAFTIELHAVEPRFDPPPDSPHIAGVVLRARRG |
Ga0335085_116942411 | 3300032770 | Soil | VDPADYVDADDLGRLLGDEFTIELHAVQPRIDPPPDHRDIADVVLRARRR |
Ga0335085_120538932 | 3300032770 | Soil | LGGEFTIELRAVQPRIDPPPDHRDIADVVLRARRR |
Ga0335082_100657751 | 3300032782 | Soil | LLGGEFTIELRAVQPRIDPPPDHRDIADVVLRARRR |
Ga0335081_110671782 | 3300032892 | Soil | DRLLGDAFTIELHAVEPRIDPPPDNPHIADLVLRARRR |
Ga0335081_110863071 | 3300032892 | Soil | VDPADYFDADDLARLLGDAFTIELHAAEPRIDPPPDNPHIADVVLRARRR |
Ga0335072_103376611 | 3300032898 | Soil | GADDVVRLLGDGFVLERHAAEPRTDPPPGTPHIADVVVRARRR |
Ga0335072_111810201 | 3300032898 | Soil | VSGDFTVEQHSVQERIDPPPDTPHVADVVLRARRR |
Ga0335073_101814344 | 3300033134 | Soil | LLGDDFTVELHAVEPRIDPPPDTPHIVDVVLRARHR |
Ga0272431_100675671 | 3300033181 | Rock | MLAEEFTVELHAVEARIDPPPDNPHVADVVLRARRR |
Ga0310914_103839312 | 3300033289 | Soil | ARLLVGAFTIERHAAEPRIDPPPDTPHIAEVVLRARRR |
Ga0318519_103447861 | 3300033290 | Soil | DYVDADDLRRLLGGEFTLELHAVQPRIDPPPDHRDIADVVLRARRR |
Ga0247830_112129102 | 3300033551 | Soil | DDVARVLGEGFAIELHAVEPRLDPPPGTPHIADIVLRARRR |
Ga0371489_0007254_11030_11137 | 3300033755 | Peat Soil | LGDDFTVELHAVEPRIDPPPDNPHIADVVLRARRR |
⦗Top⦘ |