| Basic Information | |
|---|---|
| Family ID | F072622 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MPKKSKKHPMEMTDEEALKHLFHPEIVKAVRKHLKGQTQPKRKAVNK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.78 % |
| % of genes near scaffold ends (potentially truncated) | 17.36 % |
| % of genes from short scaffolds (< 2000 bps) | 78.51 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.686 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.355 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.620 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.719 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF12760 | Zn_Tnp_IS1595 | 36.36 |
| PF12762 | DDE_Tnp_IS1595 | 26.45 |
| PF11645 | PDDEXK_5 | 4.13 |
| PF00782 | DSPc | 2.48 |
| PF00005 | ABC_tran | 1.65 |
| PF01906 | YbjQ_1 | 1.65 |
| PF03720 | UDPG_MGDP_dh_C | 0.83 |
| PF00462 | Glutaredoxin | 0.83 |
| PF02517 | Rce1-like | 0.83 |
| PF02321 | OEP | 0.83 |
| PF04672 | Methyltransf_19 | 0.83 |
| PF03989 | DNA_gyraseA_C | 0.83 |
| PF02272 | DHHA1 | 0.83 |
| PF00144 | Beta-lactamase | 0.83 |
| PF02780 | Transketolase_C | 0.83 |
| PF02828 | L27 | 0.83 |
| PF13620 | CarboxypepD_reg | 0.83 |
| PF06983 | 3-dmu-9_3-mt | 0.83 |
| PF05235 | CHAD | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 1.65 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.65 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.83 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.83 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.83 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.83 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.83 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.83 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.83 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.69 % |
| Unclassified | root | N/A | 22.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001084|JGI12648J13191_1003260 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300004092|Ga0062389_100495738 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300004092|Ga0062389_102218530 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300004631|Ga0058899_11347906 | Not Available | 506 | Open in IMG/M |
| 3300005178|Ga0066688_10736806 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005180|Ga0066685_10876925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300005181|Ga0066678_10915857 | Not Available | 573 | Open in IMG/M |
| 3300005445|Ga0070708_101938022 | Not Available | 546 | Open in IMG/M |
| 3300005447|Ga0066689_10562776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300005468|Ga0070707_100614696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
| 3300005468|Ga0070707_100699936 | Not Available | 976 | Open in IMG/M |
| 3300005468|Ga0070707_100999979 | Not Available | 802 | Open in IMG/M |
| 3300005534|Ga0070735_10011828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6629 | Open in IMG/M |
| 3300005536|Ga0070697_100333741 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300005536|Ga0070697_100735342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300005541|Ga0070733_10173342 | Not Available | 1406 | Open in IMG/M |
| 3300005541|Ga0070733_10439821 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005542|Ga0070732_10596294 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005554|Ga0066661_10749940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300005712|Ga0070764_10763804 | Not Available | 599 | Open in IMG/M |
| 3300006174|Ga0075014_100902347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300006797|Ga0066659_10368054 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300006797|Ga0066659_10829657 | Not Available | 767 | Open in IMG/M |
| 3300006806|Ga0079220_11444357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300007258|Ga0099793_10724645 | Not Available | 501 | Open in IMG/M |
| 3300009038|Ga0099829_10447143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1071 | Open in IMG/M |
| 3300009038|Ga0099829_11496758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300009137|Ga0066709_104112602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300009143|Ga0099792_10782427 | Not Available | 624 | Open in IMG/M |
| 3300009519|Ga0116108_1014139 | All Organisms → cellular organisms → Bacteria | 2875 | Open in IMG/M |
| 3300009623|Ga0116133_1066918 | Not Available | 896 | Open in IMG/M |
| 3300009700|Ga0116217_10275131 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300010320|Ga0134109_10008045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2937 | Open in IMG/M |
| 3300010326|Ga0134065_10175941 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300010329|Ga0134111_10145829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300010343|Ga0074044_10302740 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300010358|Ga0126370_10325975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1230 | Open in IMG/M |
| 3300010379|Ga0136449_100004217 | All Organisms → cellular organisms → Bacteria | 42965 | Open in IMG/M |
| 3300010379|Ga0136449_100159304 | All Organisms → cellular organisms → Bacteria | 4402 | Open in IMG/M |
| 3300011120|Ga0150983_15465207 | Not Available | 555 | Open in IMG/M |
| 3300011270|Ga0137391_10290555 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300012096|Ga0137389_10465304 | Not Available | 1083 | Open in IMG/M |
| 3300012096|Ga0137389_10627540 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300012096|Ga0137389_10751194 | Not Available | 838 | Open in IMG/M |
| 3300012198|Ga0137364_10057282 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
| 3300012205|Ga0137362_10205858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1694 | Open in IMG/M |
| 3300012206|Ga0137380_10723807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300012207|Ga0137381_11032464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300012208|Ga0137376_10311497 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300012208|Ga0137376_11270851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300012357|Ga0137384_10039720 | All Organisms → cellular organisms → Bacteria | 3880 | Open in IMG/M |
| 3300012359|Ga0137385_11219020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300012929|Ga0137404_11076784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300012930|Ga0137407_10746321 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300012944|Ga0137410_11527730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300014157|Ga0134078_10327099 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300014489|Ga0182018_10707912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300014495|Ga0182015_10292026 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300014495|Ga0182015_10471803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300014502|Ga0182021_10228042 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300017931|Ga0187877_1313785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300017934|Ga0187803_10164555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300017940|Ga0187853_10079441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1637 | Open in IMG/M |
| 3300017941|Ga0187850_10084998 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300017948|Ga0187847_10058330 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
| 3300017959|Ga0187779_10660919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300017961|Ga0187778_10001732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15017 | Open in IMG/M |
| 3300017972|Ga0187781_10042290 | Not Available | 3137 | Open in IMG/M |
| 3300017972|Ga0187781_10647420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300017975|Ga0187782_10866781 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300017975|Ga0187782_11080942 | Not Available | 626 | Open in IMG/M |
| 3300018006|Ga0187804_10392778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300018009|Ga0187884_10099399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1270 | Open in IMG/M |
| 3300018019|Ga0187874_10212214 | Not Available | 801 | Open in IMG/M |
| 3300018026|Ga0187857_10052338 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
| 3300018038|Ga0187855_10018445 | All Organisms → cellular organisms → Bacteria | 4586 | Open in IMG/M |
| 3300018042|Ga0187871_10225317 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300018046|Ga0187851_10495030 | Not Available | 694 | Open in IMG/M |
| 3300018047|Ga0187859_10072617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1812 | Open in IMG/M |
| 3300018047|Ga0187859_10766717 | Not Available | 552 | Open in IMG/M |
| 3300018062|Ga0187784_10621702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300018085|Ga0187772_10558502 | Not Available | 811 | Open in IMG/M |
| 3300018086|Ga0187769_10969035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300018086|Ga0187769_11112610 | Not Available | 598 | Open in IMG/M |
| 3300018088|Ga0187771_10037025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3747 | Open in IMG/M |
| 3300018088|Ga0187771_10916783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300018090|Ga0187770_10349727 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300018090|Ga0187770_10421868 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300018431|Ga0066655_10458683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300018482|Ga0066669_11755640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300019788|Ga0182028_1541902 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300020580|Ga0210403_10979212 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300020583|Ga0210401_10224563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1737 | Open in IMG/M |
| 3300021401|Ga0210393_10076470 | All Organisms → cellular organisms → Bacteria | 2647 | Open in IMG/M |
| 3300021477|Ga0210398_10975089 | Not Available | 677 | Open in IMG/M |
| 3300021478|Ga0210402_10121035 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
| 3300022504|Ga0242642_1007123 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300025922|Ga0207646_10589986 | Not Available | 998 | Open in IMG/M |
| 3300027439|Ga0209332_1027146 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300027575|Ga0209525_1011553 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
| 3300027862|Ga0209701_10437924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300027867|Ga0209167_10018803 | All Organisms → cellular organisms → Bacteria | 3278 | Open in IMG/M |
| 3300027867|Ga0209167_10520747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300027903|Ga0209488_10487431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
| 3300027905|Ga0209415_10012447 | Not Available | 14171 | Open in IMG/M |
| 3300027986|Ga0209168_10035163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2745 | Open in IMG/M |
| 3300028047|Ga0209526_10827861 | Not Available | 570 | Open in IMG/M |
| 3300029943|Ga0311340_10040653 | All Organisms → cellular organisms → Bacteria | 5607 | Open in IMG/M |
| 3300031057|Ga0170834_105154106 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031231|Ga0170824_105246560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300031231|Ga0170824_121133466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300031234|Ga0302325_12792638 | Not Available | 572 | Open in IMG/M |
| 3300031236|Ga0302324_101752922 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300031708|Ga0310686_105659712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300031708|Ga0310686_118373064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7664 | Open in IMG/M |
| 3300031718|Ga0307474_11034235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300032160|Ga0311301_10080292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6700 | Open in IMG/M |
| 3300032805|Ga0335078_10120714 | All Organisms → cellular organisms → Bacteria | 3749 | Open in IMG/M |
| 3300032805|Ga0335078_10292521 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
| 3300033547|Ga0316212_1055863 | Not Available | 565 | Open in IMG/M |
| 3300033977|Ga0314861_0002599 | All Organisms → cellular organisms → Bacteria | 18817 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 11.57% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.48% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.48% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.48% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.65% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.83% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12648J13191_10032603 | 3300001084 | Forest Soil | VPKKSKKPPMEMTDEEALKHLFHPKIVRAVKTHLNGQTQKPSKRKKKA* |
| Ga0062389_1004957381 | 3300004092 | Bog Forest Soil | MPKKKKHAMDLTDEEVLKRVFHPQIAKAVKRHLKGQTKPERKTKLKQ* |
| Ga0062389_1022185301 | 3300004092 | Bog Forest Soil | MPKRSKKHPMEMTDEEALKHLFHPEIVKALRKHLSEKPTRKRKSKKN |
| Ga0058899_113479061 | 3300004631 | Forest Soil | MPTKKKHPMKMTDEEALKHLFHPEIVKAVQTHLKGQSQPKRKPKAKQ* |
| Ga0066688_107368061 | 3300005178 | Soil | MPKRKKHPMHMTDEEALKHLFHPEIVKAVRKHVKGQSKQEQKPKPKR* |
| Ga0066685_108769251 | 3300005180 | Soil | MPTKKKHPMHMTDEEALKHLFHPEIVKAVRKHVKGQSKQERKPK |
| Ga0066678_109158571 | 3300005181 | Soil | MRKKSNKHPMQMTDEEALKHLFHPEIVKAVKRHAKGQTPKPSKRKKKA* |
| Ga0070708_1019380221 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRKKLKKHPMEMTDEEALKHLFHPEIVKAVRRHVKGQTKPGKKRKQKA* |
| Ga0066689_105627762 | 3300005447 | Soil | KKHPMHMTDEEALKHLFHPEIVKAVRKHVKGQSKQERKPTPRR* |
| Ga0070707_1006146962 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRKKKHPMEMNDEEALKHLFHPEIVKAVRKHLRGQTKPAKKSKKTR* |
| Ga0070707_1006999361 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRKKKHPMEMTDDEALKHLFHPEIVKAVRKHVKAQSKRKTSSPKRKP* |
| Ga0070707_1009999791 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKKSKKHPIEMTDEEALKHLFHPEIAKAVRKHLKDQTKPAPKRKK* |
| Ga0070735_100118285 | 3300005534 | Surface Soil | MPKKKKHPSEMTDEEALKHLFHPEIQKAVKTHLEGQTKSEKKPKAK* |
| Ga0070697_1003337412 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKRKKHPMHMTDEEALKHLFHPEIVKAVRKHVKGQTKQERKPKPRR* |
| Ga0070697_1007353422 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRKKLKKHPMEMTDEEALKHLFHPEIVKAVRRHVKGQTKPVKKRKRKA* |
| Ga0070733_101733423 | 3300005541 | Surface Soil | MPKKKKHAMELTDEEVLKRVFHPEIAKAVKRHLKGQTKPGKKSSPKQ* |
| Ga0070733_104398212 | 3300005541 | Surface Soil | MSKKKKHPMEMTDEEALKHLFHPKIVKAVQKHTRSQAEEAPKPESKTKP* |
| Ga0070732_105962942 | 3300005542 | Surface Soil | MPKKKKHAMEMTDEEALKHLFHPEIVKAVKRHVKGQTKQEKKSTPKR* |
| Ga0066661_107499401 | 3300005554 | Soil | KSKKHPMEMTDEEALKHLFHPEIAKAVRKHLKGQSKPEKKSSAKR* |
| Ga0070764_107638041 | 3300005712 | Soil | MPRKKSKKPPMEMTDEEALRHLFHPEIAKAVRKHLKGRSKPEGKARKKR* |
| Ga0075014_1009023471 | 3300006174 | Watersheds | MRKKSKKHPMEMTDEEALKHLFHPEIVKAVKRHVKGQTKNNLKRTVKPKS* |
| Ga0066659_103680542 | 3300006797 | Soil | MPKRKKHPMHMTDEEALKHLFHPEIVKAIRKHVKGQTKQEQKPKPKR* |
| Ga0066659_108296572 | 3300006797 | Soil | MPKKKKHPMQMTDEEALRHLFHPEIVKAVKKHTKAQPQGKKTKPKQ* |
| Ga0079220_114443572 | 3300006806 | Agricultural Soil | MPKKKKHATEMTDEEALKHLFHPEIVKAVKRHVKGQTKPGKKSQPTR* |
| Ga0099793_107246452 | 3300007258 | Vadose Zone Soil | MPKRSKKHPIEMTDEEALKHLFHPEIVKSVRKHLKDQTKPAPKRKEK* |
| Ga0099829_104471432 | 3300009038 | Vadose Zone Soil | MPKKSKKHPIEMTDDEALKHLFHPEIAKAVRKHLKDQTKPARKRKEK* |
| Ga0099829_114967581 | 3300009038 | Vadose Zone Soil | MPKKKHAMQMTDEEALKHLFHPEIVKAVRKHVKDQTKKTAKRKRKA* |
| Ga0066709_1041126022 | 3300009137 | Grasslands Soil | MPKRKKHPMHMTDEEALKHLFHPEIVKAVRKHVKGQSKQE |
| Ga0099792_107824271 | 3300009143 | Vadose Zone Soil | MAKRKSKKHPMEMTDEEALKHLFHPKIVKAVRKHLKTEEKADEPKSKNGQ* |
| Ga0116108_10141392 | 3300009519 | Peatland | MPKSSKKHPIHMTDEEALKHLFHPEIVKAVRKHLRGQTQPKRKPVKK* |
| Ga0116133_10669182 | 3300009623 | Peatland | MPKASKKHPIHMTDEEALKHLFHPEIVKSVRKHLKDQTKPKPKAVKK* |
| Ga0116217_102751312 | 3300009700 | Peatlands Soil | MPKSSKKHPIHMTDEEALKHLFHPEIVKAVRKHLKGQTKPVAKRKKK* |
| Ga0134109_100080451 | 3300010320 | Grasslands Soil | MPKKKKHPMHMTDEEALKHLFHPEIVKAVRKHVKGQSKQE |
| Ga0134065_101759413 | 3300010326 | Grasslands Soil | MPKKKKHPMHMTDEEALKHLFHPEIVKAVRKHVKVQSK* |
| Ga0134111_101458293 | 3300010329 | Grasslands Soil | GFIVFHKVTMPKQKKHPMHMTDEEALKHLFHPEIVKAVRKHVKGQTKRERKPKPRRQP* |
| Ga0074044_103027402 | 3300010343 | Bog Forest Soil | MPKKSKKHPMEMTDEEALKHLFHPEIAKAVRKHLKGQTQPKRKPVKK* |
| Ga0126370_103259752 | 3300010358 | Tropical Forest Soil | MPKKKKHPAHMTDEEALKHLFHPEIVKAVQQHVQGQTKPERKPKPKR* |
| Ga0136449_10000421718 | 3300010379 | Peatlands Soil | MPKKKKHAMELTDEEALKHLFHPEIVKAVKRHVKGQTKPEKKSRPKR* |
| Ga0136449_1001593044 | 3300010379 | Peatlands Soil | MTKRKQKKHPMEMTDEEALRHLFHPRIANAVRKHLKAQEANPEPKRKPKSEC* |
| Ga0150983_154652071 | 3300011120 | Forest Soil | MPTKKKHPMKMTDEEALKHLFHPEIVKAVQTHLKGQSQPKRKPKAKKRTSSNPSPP* |
| Ga0137391_102905551 | 3300011270 | Vadose Zone Soil | MPRKKSRKHPMEMTDEEALKHLFHPEIVKAVKRHVKGQTTQKLKRKPKR* |
| Ga0137389_104653042 | 3300012096 | Vadose Zone Soil | MPKKSKKHPIEMTDEEALKHLFHPEIAKAVRQHLKDQTKPAPKQKEK* |
| Ga0137389_106275401 | 3300012096 | Vadose Zone Soil | KHPMEMTDQEALKHLFHPEIVKAVQRHLKGQTKPKRKRKHSE* |
| Ga0137389_107511941 | 3300012096 | Vadose Zone Soil | SKKHPIEMTDDEALKHLFHPEIAKAVRKHLKDQTKPARKRKEK* |
| Ga0137364_100572822 | 3300012198 | Vadose Zone Soil | MPRKKLKKHPMEMTDEEALKHLFHPEIVKAVRRHVRGQTKPAKKRKQKA* |
| Ga0137362_102058582 | 3300012205 | Vadose Zone Soil | MPRKKLKKHPMKMTDEEALKHLFHPEIVRAVKRHIKGESKTKSRKRS* |
| Ga0137380_107238072 | 3300012206 | Vadose Zone Soil | MPRKKLKKHPMEMTDEEALKHLFHPEIVKAVRRHVRGQTKPGKKRKQKA* |
| Ga0137381_110324641 | 3300012207 | Vadose Zone Soil | MKVTMPKRKKHPMHMTDEEALKHLFHPEIVKAVRKHVKGQTKQERKPKPRRQP* |
| Ga0137376_103114973 | 3300012208 | Vadose Zone Soil | MPKRKKHPMHMTDEEALKHLFHPEIVKALRKHVKGQTKQERKPKPRR* |
| Ga0137376_112708512 | 3300012208 | Vadose Zone Soil | MPRKKLKKHPMEMTDEEALKHLFHPEIVKAVRRHVKGQTKPVKKRKQKA* |
| Ga0137384_100397203 | 3300012357 | Vadose Zone Soil | MPRKKKHPMHMTDEEALKHIFHPEIVKAVRKHVKGQSKSEAKTTRRSKLKA* |
| Ga0137385_112190201 | 3300012359 | Vadose Zone Soil | SLFFMKVTMPKRKKHPMHMTDEEALKHLFHPEIVKAVRKHMKGQTTQERKPKPRR* |
| Ga0137404_110767842 | 3300012929 | Vadose Zone Soil | MPRKKLKKHPMEMTDDEALKHLFHPEIVKAVAGHINAQRERDRKRVPKQVKGQ |
| Ga0137407_107463211 | 3300012930 | Vadose Zone Soil | MPRKKLKKHPMEMTDEEGLKHLFHPEIVKAVRRHVKGQTKPVKKRKQKA* |
| Ga0137410_115277302 | 3300012944 | Vadose Zone Soil | MPKKKKHPMQMTDEEALKHIFHPKIVKAVKTHLKGQTTKKRERK* |
| Ga0134078_103270993 | 3300014157 | Grasslands Soil | KHPMHMTDEEALKHLFHPEIVKAVRKHVKGQSKQEQKPKPKR* |
| Ga0182018_107079121 | 3300014489 | Palsa | MPKKKKHAMELTDEEVLKRVFHPEIAKAVRKHVKGQTKPEKKANQKE* |
| Ga0182015_102920261 | 3300014495 | Palsa | MPKSSKKHPIHMTDEEALKHLFHPEIVKAVKTHLKGQTKPAPKRKKK* |
| Ga0182015_104718032 | 3300014495 | Palsa | MPKKKKHPTQWTDDEVLKKIFHPEIAKAVRKHLKGETKTEKKDQKQ* |
| Ga0182021_102280421 | 3300014502 | Fen | MPKSSKKHPIHMTDEEALKHLFHPEIVKAVRRHLKGQTQPKPKAVKK* |
| Ga0187877_13137851 | 3300017931 | Peatland | MPKTSKKHPIHMTDEEALKHLFHPEIVKAVRKHLKGQTQPAPKRKKK |
| Ga0187803_101645551 | 3300017934 | Freshwater Sediment | MGAPVRRKLKKHPMEMTDEEALKHLFHPKIVRAVRKHVEGQTKQKPKRKRK |
| Ga0187853_100794412 | 3300017940 | Peatland | MPKSSKKHPIHMTDEEALKHLFHPEIVKAVRKHLRGQTQPKRKPVKK |
| Ga0187850_100849982 | 3300017941 | Peatland | MTQKKSKKHPMEMTDEEALKHLFHPEIVKAVRKHLSGKPTRKKKTNKNA |
| Ga0187847_100583302 | 3300017948 | Peatland | MPKASKKHPIHMTDEEALKHLFHPEIVKSVRKHLKDQTKPKPKAVKK |
| Ga0187779_106609192 | 3300017959 | Tropical Peatland | MPKKKKHAMELTDDEALKRIFHPEIVKAVRKHLKGQNHQSKKSVSKGKAQ |
| Ga0187778_100017322 | 3300017961 | Tropical Peatland | MSKKKKHPMEMTDEEALRHIFHPEIQKAVRKHLKGQNHRSQKSVPKKKSQ |
| Ga0187781_100422903 | 3300017972 | Tropical Peatland | MPKKKKHPMEMTDEEALKHIFHPEIAKAVRKHLRTQEKKGKPKPKR |
| Ga0187781_106474201 | 3300017972 | Tropical Peatland | MRRKLKKHPMEMTDDEALKHLFHPKIVRAVRKHVEGQTKTNPKRKRKS |
| Ga0187782_108667812 | 3300017975 | Tropical Peatland | MRKQLKKPPIEMTDKEALNHLFHPEIVKAVRKHLKDGKKAGTKRKIKPQP |
| Ga0187782_110809422 | 3300017975 | Tropical Peatland | APVVKKPKRHPMEMTDEEALKHLFHPEIVKAVQRHVKGQTEKKPKPKKS |
| Ga0187804_103927781 | 3300018006 | Freshwater Sediment | MPKKKKHAMEMTDEEALRHIFHPEIAKAIRKHLKGQTKQKPKRKVKR |
| Ga0187884_100993991 | 3300018009 | Peatland | SSKKHPIHMTDEEALKHLFHPEIVKAVRKHLRGQTQPKRKPVKK |
| Ga0187874_102122141 | 3300018019 | Peatland | MASVIRSPMPKSSKKHPIHMTDEEALKHLFHPEIVKAVRKHLRGQTQPKRKPVKK |
| Ga0187857_100523382 | 3300018026 | Peatland | MPKSSKKHPIHMTDEEALKHLFHPEIVKAVKRHLKGQTKPKPKAVKK |
| Ga0187855_100184452 | 3300018038 | Peatland | MPKSSKKHPIHMTDEEALKHLFHPEIVKAVRKHLKGQTQPKRKAVKK |
| Ga0187871_102253172 | 3300018042 | Peatland | MPKKSKKHPMEMTDEEALNHLFHPEIAKAVRKHLKGQTQPKRKAVKK |
| Ga0187851_104950301 | 3300018046 | Peatland | MPKSSKKHPIEMTDEEALKHLFHPEIVKAVKRHLKGQSKPAPKRKKK |
| Ga0187859_100726173 | 3300018047 | Peatland | MPKKKKHPLEMTDEEALKHLFHPKIVRAVQKHTKEQTEEARKRESKTKP |
| Ga0187859_107667171 | 3300018047 | Peatland | HPIHMTDEEALKHLFHPEIVKAVKRHLKGQTKPKPKAVKK |
| Ga0187784_106217022 | 3300018062 | Tropical Peatland | MGKKLKKHPMQMTDDEALKHLFHPKIVKAVQKHVKGQTQNGPKRKRKS |
| Ga0187772_105585022 | 3300018085 | Tropical Peatland | MTKRKSKKHPMEMTDEEALKHLFHPKIAKAVRDHLKSEGKKKLKSGR |
| Ga0187769_109690352 | 3300018086 | Tropical Peatland | MPRKKKHAMELTDEEALKRVFHPEIVKAVRKHLKNQNHKSSKSVPKQKSQ |
| Ga0187769_111126102 | 3300018086 | Tropical Peatland | MRKKLKKHPMQMTDEEALKHLFHPKIVRAVHKHVEGQSNPSPKRKRKG |
| Ga0187771_100370254 | 3300018088 | Tropical Peatland | MPKKKKHAMELTDEEALKRVFHPEIVKAVRKHLKNQNGKSNKSVPKGKSH |
| Ga0187771_109167833 | 3300018088 | Tropical Peatland | MPKKKKHAMELTDVEALKRVFHPEIVKAVRKHLKNQNHKSSKSVPKRKSQ |
| Ga0187770_103497271 | 3300018090 | Tropical Peatland | KKHAMELTDEEALKRVFHPEIVKAVRKHLKNQNHKSSKSVPKRKSQ |
| Ga0187770_104218683 | 3300018090 | Tropical Peatland | MRRKLKKHPMEMTDEEALKHLFHPKIVKKVREHLKGQTPKRSKRKRNA |
| Ga0066655_104586832 | 3300018431 | Grasslands Soil | MPTKKKHPMHMTDEEALKHLFHPEIVKAIRKHVKGQTKQERKPKPKR |
| Ga0066669_117556402 | 3300018482 | Grasslands Soil | MPTKKKHQMHMTDEEALKHLCHPEIVKAIRKHVKGQTKQERK |
| Ga0182028_15419022 | 3300019788 | Fen | MPKSSKKHPIHMTDEEALKHLFHPEIVKAVRRHLKGQTQPKPKAVKK |
| Ga0210403_109792122 | 3300020580 | Soil | MPKKKKHAMELTDEEVLKRVFHPEIAKAVRKHLKGQTKAERKTKPKQ |
| Ga0210401_102245632 | 3300020583 | Soil | MNEFQHRNHRSPMPKKKKHAMEMTDEEALKHLFHPEIVKAVKRHVRGQTKPEKKSKPKR |
| Ga0210393_100764703 | 3300021401 | Soil | MPRKKSKKPPMEMTDEEALRHLFHPEIAKAVRKHLKGRSKPEGKARKKR |
| Ga0210398_109750891 | 3300021477 | Soil | MPKKKKHPMEMTDEEALKHLFHPKIVKAVQKHAKSQTEETPKRASKTKP |
| Ga0210402_101210354 | 3300021478 | Soil | MPKKKKHPTQWTDTEVLKNVFHPEIAKAVRKHVKGQTKSEKKENQKQ |
| Ga0242642_10071233 | 3300022504 | Soil | MAKKKSKKHPMEMTDEEALKHIFHPKIVKAVQTHLKGQTEPAPKQVKK |
| Ga0207646_105899861 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRKKKHPMEMTDDEALKHLFHPEIVKAVRKHVKAQSKRKTSSPKRKP |
| Ga0209332_10271462 | 3300027439 | Forest Soil | MKKSKKHPNEMTDEEALKHLFHPEIVKAVKTHLKGQSKPAPKRKKK |
| Ga0209525_10115532 | 3300027575 | Forest Soil | MPKKSKKRPMDMTDEEALKHLFHPDIVKAVQTHLKGQTKPAPKRKKK |
| Ga0209701_104379242 | 3300027862 | Vadose Zone Soil | MPRKKSRKHPMEMTDEEALKHLFHPEIVKAVKRHVKGQTTQKLKRKPKR |
| Ga0209167_100188034 | 3300027867 | Surface Soil | MSKKKKHPMEMTDEEALKHLFHPKIVKAVQKHTRSQAEEAPKPESKTKP |
| Ga0209167_105207472 | 3300027867 | Surface Soil | MPKKKKHAMELTDEEVLKRVFHPEIAKAVKRHLKGQTKPGKKSSPKQ |
| Ga0209488_104874311 | 3300027903 | Vadose Zone Soil | MAKRKSKKHPMEMTDEEALKHLFHPKIVKAVRKHLKTEEKADEPKSKNGQ |
| Ga0209415_1001244714 | 3300027905 | Peatlands Soil | MPKSSKKHPIHMTDEEALKHLFHPEIVKAVRKHLKGQTKPVAKRKKK |
| Ga0209168_100351632 | 3300027986 | Surface Soil | MPKKKKHPSEMTDEEALKHLFHPEIQKAVKTHLEGQTKSEKKPKAK |
| Ga0209526_108278611 | 3300028047 | Forest Soil | MPKRSKKHPLEMTDEEALKHLFHPEIVKSVRKHLKDQTKPAPKRKEK |
| Ga0311340_100406532 | 3300029943 | Palsa | MPKSSKKHPIHMTDEEALKHLFHPEIVKAVKTHLKGQTKPAPKRKKK |
| Ga0170834_1051541062 | 3300031057 | Forest Soil | MPKKKKHAMELTDDEVLKRIFHPEIAKAVRKHLKGQTKPEKKLSPKQ |
| Ga0170824_1052465602 | 3300031231 | Forest Soil | MPRKKKHPMEMTDEEALKHLFHPKIVKAMKTHLKGQTSPAPKRKKK |
| Ga0170824_1211334661 | 3300031231 | Forest Soil | MPKKKKHPMHMTDDESLKHIFHPEIVKAVRKHVKGEAKPKKA |
| Ga0302325_127926381 | 3300031234 | Palsa | KKHPMDMTDEEALKHIFHPKIASAVRKHLKTQGKPESATRKKDQ |
| Ga0302324_1017529222 | 3300031236 | Palsa | MPKASKKHPIHMTDEEALKHLFHPEIVKAVKTHLKGQTKPAPKRKKK |
| Ga0310686_1056597121 | 3300031708 | Soil | MPKKKKHPMEMTDEEALKHLFHPKIVKAVQKHTKEQTEEAPKPESKTKP |
| Ga0310686_1183730645 | 3300031708 | Soil | MPRKKSKKPPMEMTDEEALKHLFHPEIAKAVRKHLRGQSKPEGKSRKKR |
| Ga0307474_110342351 | 3300031718 | Hardwood Forest Soil | MPKKSKKHPMEMTDEEALKHLFHPEIVKAVRKHLKGQTQPKRKAVNK |
| Ga0311301_100802922 | 3300032160 | Peatlands Soil | MPKKKKHAMELTDEEALKHLFHPEIVKAVKRHVKGQTKPEKKSRPKR |
| Ga0335078_101207143 | 3300032805 | Soil | MTKRKSKKHAMEMTDEEALKHLFHPKIVKVVRTHLKEEGKKKPKNGR |
| Ga0335078_102925212 | 3300032805 | Soil | MTKRKSKKHPMEMTDEEALKHLFHPKIVKAVRSHLKQEGKKKPKNGR |
| Ga0316212_10558632 | 3300033547 | Roots | VRKKSKKHPMEMTDEEALKHLFHPEIVKAVKRHVRGQTPKPPKRKKKA |
| Ga0314861_0002599_8086_8238 | 3300033977 | Peatland | MAKKAKKHPMEMTDEEALKHLFHPKIVKAVKRHVKGQTQTETKREQKPKP |
| ⦗Top⦘ |