| Basic Information | |
|---|---|
| Family ID | F072593 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 45 residues |
| Representative Sequence | TATLRRICIYIPAMGAEERKRLADSLRAAGGAINAAIADLEKAEK |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.31 % |
| % of genes near scaffold ends (potentially truncated) | 94.21 % |
| % of genes from short scaffolds (< 2000 bps) | 92.56 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.603 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (9.917 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.793 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.198 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.73% β-sheet: 0.00% Coil/Unstructured: 60.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF02737 | 3HCDH_N | 91.74 |
| PF12704 | MacB_PCD | 2.48 |
| PF02636 | Methyltransf_28 | 1.65 |
| PF00135 | COesterase | 0.83 |
| PF02446 | Glyco_hydro_77 | 0.83 |
| PF14559 | TPR_19 | 0.83 |
| PF00909 | Ammonium_transp | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 91.74 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 91.74 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 91.74 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 91.74 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 91.74 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 91.74 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 91.74 |
| COG1565 | SAM-dependent methyltransferase, MidA family | General function prediction only [R] | 1.65 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.83 |
| COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.83 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.60 % |
| Unclassified | root | N/A | 12.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10007391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7581 | Open in IMG/M |
| 3300001175|JGI12649J13570_1022188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 682 | Open in IMG/M |
| 3300001593|JGI12635J15846_10263118 | Not Available | 1099 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101495165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 570 | Open in IMG/M |
| 3300002907|JGI25613J43889_10189152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300004082|Ga0062384_101460512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 505 | Open in IMG/M |
| 3300004091|Ga0062387_100030111 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300004091|Ga0062387_101741440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 507 | Open in IMG/M |
| 3300004134|Ga0058906_1174078 | Not Available | 519 | Open in IMG/M |
| 3300004477|Ga0068971_1538380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 592 | Open in IMG/M |
| 3300005167|Ga0066672_10665264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 671 | Open in IMG/M |
| 3300005526|Ga0073909_10205464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300005535|Ga0070684_102002448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 547 | Open in IMG/M |
| 3300005542|Ga0070732_10952881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 524 | Open in IMG/M |
| 3300005602|Ga0070762_10553714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 759 | Open in IMG/M |
| 3300005610|Ga0070763_10197290 | Not Available | 1072 | Open in IMG/M |
| 3300005712|Ga0070764_10612526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 665 | Open in IMG/M |
| 3300005921|Ga0070766_10244414 | Not Available | 1136 | Open in IMG/M |
| 3300006028|Ga0070717_10987603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300006028|Ga0070717_11593341 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006162|Ga0075030_100897727 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300006175|Ga0070712_100967607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 736 | Open in IMG/M |
| 3300006806|Ga0079220_12032753 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009520|Ga0116214_1366849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 559 | Open in IMG/M |
| 3300009545|Ga0105237_10870412 | Not Available | 908 | Open in IMG/M |
| 3300009552|Ga0116138_1124813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 712 | Open in IMG/M |
| 3300009623|Ga0116133_1090207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 774 | Open in IMG/M |
| 3300009672|Ga0116215_1498577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 526 | Open in IMG/M |
| 3300009700|Ga0116217_10651402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 654 | Open in IMG/M |
| 3300009839|Ga0116223_10805200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 537 | Open in IMG/M |
| 3300010048|Ga0126373_12907109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 534 | Open in IMG/M |
| 3300010366|Ga0126379_10722837 | Not Available | 1091 | Open in IMG/M |
| 3300010379|Ga0136449_103444720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300010859|Ga0126352_1014272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 730 | Open in IMG/M |
| 3300010877|Ga0126356_10971233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 566 | Open in IMG/M |
| 3300010937|Ga0137776_1704900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 700 | Open in IMG/M |
| 3300011120|Ga0150983_12915393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 531 | Open in IMG/M |
| 3300012189|Ga0137388_10358812 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300012205|Ga0137362_10565938 | Not Available | 981 | Open in IMG/M |
| 3300012351|Ga0137386_10578275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300012918|Ga0137396_10735366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 727 | Open in IMG/M |
| 3300012923|Ga0137359_11215648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 642 | Open in IMG/M |
| 3300012955|Ga0164298_11079534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 599 | Open in IMG/M |
| 3300012971|Ga0126369_11105183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300014165|Ga0181523_10340599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300014169|Ga0181531_10312912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 961 | Open in IMG/M |
| 3300014501|Ga0182024_10000790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 83232 | Open in IMG/M |
| 3300014501|Ga0182024_10069521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5345 | Open in IMG/M |
| 3300014657|Ga0181522_10824547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 570 | Open in IMG/M |
| 3300017930|Ga0187825_10270566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 627 | Open in IMG/M |
| 3300017933|Ga0187801_10284573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 670 | Open in IMG/M |
| 3300017934|Ga0187803_10427004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 539 | Open in IMG/M |
| 3300017975|Ga0187782_11378352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 554 | Open in IMG/M |
| 3300018006|Ga0187804_10046441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1688 | Open in IMG/M |
| 3300018017|Ga0187872_10397082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 584 | Open in IMG/M |
| 3300018040|Ga0187862_10603919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 649 | Open in IMG/M |
| 3300018062|Ga0187784_10256047 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300018085|Ga0187772_10486791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300018085|Ga0187772_10878150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 651 | Open in IMG/M |
| 3300018088|Ga0187771_10476953 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300018088|Ga0187771_11553071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 562 | Open in IMG/M |
| 3300020022|Ga0193733_1052708 | Not Available | 1148 | Open in IMG/M |
| 3300021088|Ga0210404_10273029 | Not Available | 924 | Open in IMG/M |
| 3300021168|Ga0210406_10729159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300021171|Ga0210405_10643596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300021181|Ga0210388_11483687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 567 | Open in IMG/M |
| 3300021401|Ga0210393_11102537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 641 | Open in IMG/M |
| 3300021405|Ga0210387_10623378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300021420|Ga0210394_11540108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 561 | Open in IMG/M |
| 3300021478|Ga0210402_11000115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 763 | Open in IMG/M |
| 3300021559|Ga0210409_11072636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 680 | Open in IMG/M |
| 3300022557|Ga0212123_10078392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2803 | Open in IMG/M |
| 3300025922|Ga0207646_11016682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 732 | Open in IMG/M |
| 3300025928|Ga0207700_11022067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300025929|Ga0207664_10585527 | Not Available | 1002 | Open in IMG/M |
| 3300026467|Ga0257154_1024072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300026890|Ga0207781_1028375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 545 | Open in IMG/M |
| 3300027568|Ga0208042_1013908 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300027604|Ga0208324_1000095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 53352 | Open in IMG/M |
| 3300027696|Ga0208696_1282614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 510 | Open in IMG/M |
| 3300027824|Ga0209040_10241093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300027842|Ga0209580_10453016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 639 | Open in IMG/M |
| 3300027842|Ga0209580_10700735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 500 | Open in IMG/M |
| 3300027884|Ga0209275_10055687 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300027884|Ga0209275_10658281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 602 | Open in IMG/M |
| 3300027889|Ga0209380_10216253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 1126 | Open in IMG/M |
| 3300027889|Ga0209380_10747476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 558 | Open in IMG/M |
| 3300027905|Ga0209415_11060392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 532 | Open in IMG/M |
| 3300028016|Ga0265354_1004808 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300028047|Ga0209526_10681089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 650 | Open in IMG/M |
| 3300028795|Ga0302227_10054713 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300029907|Ga0311329_10817466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 593 | Open in IMG/M |
| 3300029910|Ga0311369_11130418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 610 | Open in IMG/M |
| 3300029953|Ga0311343_11041771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 639 | Open in IMG/M |
| 3300030042|Ga0302300_1072592 | Not Available | 1069 | Open in IMG/M |
| 3300030056|Ga0302181_10504899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 509 | Open in IMG/M |
| 3300030399|Ga0311353_10030120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5767 | Open in IMG/M |
| 3300030509|Ga0302183_10301778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 619 | Open in IMG/M |
| 3300030737|Ga0302310_10451008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 697 | Open in IMG/M |
| 3300030746|Ga0302312_10334473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 567 | Open in IMG/M |
| 3300030862|Ga0265753_1141839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 515 | Open in IMG/M |
| 3300031057|Ga0170834_111103625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300031236|Ga0302324_102021713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 722 | Open in IMG/M |
| 3300031236|Ga0302324_103561062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 504 | Open in IMG/M |
| 3300031344|Ga0265316_10362333 | Not Available | 1048 | Open in IMG/M |
| 3300031718|Ga0307474_10512216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300031720|Ga0307469_11161163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 728 | Open in IMG/M |
| 3300031753|Ga0307477_10451136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300031823|Ga0307478_10709962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300031912|Ga0306921_10227782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2184 | Open in IMG/M |
| 3300031941|Ga0310912_10729430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 767 | Open in IMG/M |
| 3300031962|Ga0307479_12146305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 506 | Open in IMG/M |
| 3300032160|Ga0311301_12248966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 623 | Open in IMG/M |
| 3300032205|Ga0307472_102082126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 570 | Open in IMG/M |
| 3300032782|Ga0335082_11560357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 532 | Open in IMG/M |
| 3300032783|Ga0335079_11326886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 717 | Open in IMG/M |
| 3300032828|Ga0335080_10900544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300032892|Ga0335081_11121439 | Not Available | 904 | Open in IMG/M |
| 3300032893|Ga0335069_10811103 | Not Available | 1053 | Open in IMG/M |
| 3300032955|Ga0335076_10550420 | Not Available | 1036 | Open in IMG/M |
| 3300033405|Ga0326727_10296225 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.09% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.13% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.31% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.31% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.65% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.65% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.65% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.65% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.83% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004134 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF248 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100073918 | 3300000567 | Peatlands Soil | IYIPSMTTEERQRLAEYLRPAGEALNAALAELAKAGQ* |
| JGI12649J13570_10221882 | 3300001175 | Forest Soil | ICIYIPSMNSDERQRLAEALRAAGAAINAAVADLEKVST* |
| JGI12635J15846_102631182 | 3300001593 | Forest Soil | VDDITATLRRLCLYIPNMSAEERKRLAEYLRAAGGALNSALADLEKAA* |
| JGIcombinedJ26739_1014951651 | 3300002245 | Forest Soil | NYVEDITTTLRRICISIPAMNVEERKRLADSLRAAGGALNDAIKDLEKEKVMAQ* |
| JGI25613J43889_101891522 | 3300002907 | Grasslands Soil | LRRICISIPPMTTEERKRLAESLRTAVGAINAAIADLDKAGPQ* |
| Ga0062384_1014605122 | 3300004082 | Bog Forest Soil | ITTTLRRICIYIPNMSTEERLRLAESLRTAGGAINAAITDLEKVGP* |
| Ga0062387_1000301111 | 3300004091 | Bog Forest Soil | RISIYIPAMNTEERKRLAESLRATGVAINTAIADLEKVGP* |
| Ga0062387_1017414401 | 3300004091 | Bog Forest Soil | RSMNYVDDITTTLRRICISIPAMDAEERKRLADSLRTAGGALNDAIKDLEKEKVEAQ* |
| Ga0058906_11740782 | 3300004134 | Forest Soil | TATLRRICIYIPAMGAEERKRLADSLRAAGGAINAAIADLEKAEK* |
| Ga0068971_15383802 | 3300004477 | Peatlands Soil | VEDITATLRRICIYIPGMGAEERKRLADSLRAAGGAIDAAITDLEKAEK* |
| Ga0066672_106652641 | 3300005167 | Soil | MNYVEDITTTLRRICLSIAPMNTEERKRLADSLRAAAVAINAAITDLEKAGPQ* |
| Ga0073909_102054642 | 3300005526 | Surface Soil | ITATLRRICIYIPGMSAEERKRLAESLRGTVTAVNAAIADLERAEK* |
| Ga0070684_1020024481 | 3300005535 | Corn Rhizosphere | TTLRRIAIYIPGMGADERKRLAESMRGAATAINSVIADLEKAEK* |
| Ga0070732_109528811 | 3300005542 | Surface Soil | EDITATLRRICIYIPGMSAEERKRLAESLRTTVVAVNSAIADLEKADK* |
| Ga0070762_105537142 | 3300005602 | Soil | YVEDITTTLRRICISIPAMSTEERKRLADSLRVAGGALNEAIGDLEKARP* |
| Ga0070763_101972901 | 3300005610 | Soil | MNYVEDITATLRRICIYIPNMNAEERKRLAESLRATGGAVNAAIADLEKVGP* |
| Ga0070764_106125261 | 3300005712 | Soil | PNMSTEERLRLAQVLRATGGAINEAIADLEKVGP* |
| Ga0070766_102444142 | 3300005921 | Soil | IYIPAMNTEERKRLAESLRATSGAINTAIADLEKVGP* |
| Ga0070717_109876032 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TLRRICIYIPNMSPEERKRLAESLRGAAAAVNAAVADLEKAEK* |
| Ga0070717_115933412 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VEDITATLRRICIYIPAMSPDERKRLAEVMRGAAAQVNAAIADLEKVEK* |
| Ga0075030_1008977271 | 3300006162 | Watersheds | DITATLRRICIYIPSMNAEERKRLAEYLRAADGAVNAAIADLEKAEK* |
| Ga0070712_1009676072 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RRIAIYIPSMGADERKRLAEVMRGAATAVNSVIADLEKAEK* |
| Ga0079220_120327531 | 3300006806 | Agricultural Soil | YVEDITATLRRICIYIPAMSPEERKRLAESLRGAANSVNAAIADLEKVEK* |
| Ga0116214_13668492 | 3300009520 | Peatlands Soil | RRICIYIPNMNTEERQRLAESLRTTGGAINAAIADLEKVGP* |
| Ga0105237_108704122 | 3300009545 | Corn Rhizosphere | RIAIYIPSMGADERKRLAEAMRGAATAVNSVIADLEKAEK* |
| Ga0116138_11248131 | 3300009552 | Peatland | LRRICIYIPAMNTEERQRLAESLRATGGAINAAIADLEKVGP* |
| Ga0116133_10902071 | 3300009623 | Peatland | VEDITATLRRICIYIPGMGADERKRLAESLREAGGAINAAIADLEKAEK* |
| Ga0116215_14985771 | 3300009672 | Peatlands Soil | TLRRICIYIPAMSSDERKRLAEAMRGAAASVNAAIADLEKVEK* |
| Ga0116217_106514021 | 3300009700 | Peatlands Soil | MNYVEDITATLRRICIYIPAMNAEERKRLAESLRATGGAINAAIADLEKVGP* |
| Ga0116223_108052001 | 3300009839 | Peatlands Soil | ICIYIPAMSPDERKRLAEAMRGAAASVNAAIADLEKVEK* |
| Ga0126373_129071091 | 3300010048 | Tropical Forest Soil | IPSMSADERKRLAEAIRGASAAMNSALADLEKADK* |
| Ga0126379_107228372 | 3300010366 | Tropical Forest Soil | LRRICIYIPSMNPEERKRLAEVMHKAADSFNAAIADLEKADK* |
| Ga0136449_1034447201 | 3300010379 | Peatlands Soil | VDDITATLRRICIYIPNMNAEERKRLAESLRGAGGSITAAIADLEKADK* |
| Ga0126352_10142722 | 3300010859 | Boreal Forest Soil | IRSMNYVEDITTTLRRICIAIPAMNVEERKRLADSLRTAGVALSDAIKDLEKERVVAQ* |
| Ga0126356_109712331 | 3300010877 | Boreal Forest Soil | TLRRICISIPPMTTEERKRLAESLRTAVGAINAAIADLDKAGPQ* |
| Ga0137776_17049001 | 3300010937 | Sediment | AIYIPGMTADERKRLAEAMRGAANSLNATLADLEKADK* |
| Ga0150983_129153931 | 3300011120 | Forest Soil | MNYVEDITNTLRRISISIPPMNTEERKRLADCLRTAGSAINAAVAELEKEGK* |
| Ga0137388_103588123 | 3300012189 | Vadose Zone Soil | SIPAMHPDERQRLADSLRAAGAAIAAAVADLEKAGK* |
| Ga0137362_105659381 | 3300012205 | Vadose Zone Soil | ITTTLRRICISIPAMPPDERQRLAESLRAAGAAIAAAVADLEKVGK* |
| Ga0137386_105782752 | 3300012351 | Vadose Zone Soil | TLRRMCLYIPSMNAEERKRLAEYLRAAGSAVNAAIADLEKVEK* |
| Ga0137396_107353661 | 3300012918 | Vadose Zone Soil | RRICISIPAMTTEERQRLAQYLRVAGEAINSALGDLEKAGK* |
| Ga0137359_112156482 | 3300012923 | Vadose Zone Soil | LRRMCLYIPSMNAEERKRLAEYLRAAGGAVNAAIADLEKAEK* |
| Ga0164298_110795342 | 3300012955 | Soil | ATLRRIAIYIPSMGADERKRLAEVMRGAATAVNSVIADLEKPEK* |
| Ga0126369_111051832 | 3300012971 | Tropical Forest Soil | YVEDITATLRRICIYIPSMNAEERKRLAEAMRKAAESVNAAIADLEKAEK* |
| Ga0181523_103405992 | 3300014165 | Bog | TLRRICIAIPAMNVEERKRLADSLRAAGSALNDAIKDLEKERVVAQ* |
| Ga0181531_103129122 | 3300014169 | Bog | MNYVEDITTTLRRICIYIPNMSTEERKRLAESLRTAGGAINAAIGDLEKAGS* |
| Ga0182024_1000079054 | 3300014501 | Permafrost | MNYVEDITNTLRRICITIPAMNNEERKRLADSLRAAGGAINAAIADLEKAAQ* |
| Ga0182024_100695213 | 3300014501 | Permafrost | MNYVEDITTTLRRICISIPAMNVEERKRLADSLRAAGNALNDAIKDLEKERVVAQ* |
| Ga0181522_108245471 | 3300014657 | Bog | DITTTLRRICIYIPNMSTEERKRLAESLRTAGGAINAAIGDLEKAGS* |
| Ga0187825_102705661 | 3300017930 | Freshwater Sediment | VEDITATLRRICIYIPSMNSEERKRLAEAMHKAADSFNAAIADLEKAEK |
| Ga0187801_102845732 | 3300017933 | Freshwater Sediment | VEDITATLRRICIYIPAMSDDERKRLAESLRGAASQVNAAIADLEKAEK |
| Ga0187803_104270042 | 3300017934 | Freshwater Sediment | YIPSMNTDERKRLAEHLRAAGASVNAAIADLEKAGQ |
| Ga0187782_113783521 | 3300017975 | Tropical Peatland | IPSMTAEERKRLAEHLRAAGASINAAIADLEKAAQ |
| Ga0187804_100464411 | 3300018006 | Freshwater Sediment | ICIYIPSMSTDERKRLAEHLRAAGASVNAAIADLEKAGQ |
| Ga0187872_103970822 | 3300018017 | Peatland | YVDDITTTLRRICIAIPAMNVEERKRLADSLRAAGGALNDAIKDLEKERVVAQ |
| Ga0187862_106039192 | 3300018040 | Peatland | EDITATLRRICIYIPGMGADERKRLAESLRAAGGAIDAAVADLEKAEK |
| Ga0187784_102560473 | 3300018062 | Tropical Peatland | YVDDITATLRRISIYIPSMNTEERKRLAEHLRVASAAINAALADLEKAGQ |
| Ga0187772_104867912 | 3300018085 | Tropical Peatland | ICIAIPSMTAEERRRLAEHLRAAGASINAAIADLEKAGQ |
| Ga0187772_108781502 | 3300018085 | Tropical Peatland | YVEDITATLRRISTTIPGMTAEEKKRLAEALRAASGLILAAIGDLEKAEK |
| Ga0187771_104769532 | 3300018088 | Tropical Peatland | YVDDITATLRRIRVSIPSMTADERKRLAEHLRAADASINEAIADLEKAGQ |
| Ga0187771_115530712 | 3300018088 | Tropical Peatland | ICIAIPSMTAEERQRLAEHLRAAGDAINAAIADLEKAGQ |
| Ga0193733_10527082 | 3300020022 | Soil | DITTTLRRICISIPAMPPDERQRLAESLRAAGAAIAAAVADLEKAGK |
| Ga0210404_102730291 | 3300021088 | Soil | TLRRICIYIPAMSPDERKRLAEVMRGAAAQVNAAIADLEKVEK |
| Ga0210406_107291592 | 3300021168 | Soil | LRRICIYIPAMNTEERKRLAESLRATGGAINAAIVDLEKVGP |
| Ga0210405_106435962 | 3300021171 | Soil | YIPGMGPDERKRLAESLRAAGGAIDAAVADLEKAEK |
| Ga0210388_114836871 | 3300021181 | Soil | RRICISIPAMNTDERKRLAESLRTATSAINAAVADLEKAGPQ |
| Ga0210393_111025371 | 3300021401 | Soil | TVRRMCLYIPSMNAEERKRLAEYLRAAGGAVNAAIADLEKVEK |
| Ga0210387_106233781 | 3300021405 | Soil | LRRISIYIPAMNTEERKRLAESLRATAVAVNAAIADLEKVGP |
| Ga0210394_115401081 | 3300021420 | Soil | EDITATLRRICIYIPAMSPDERKRLAEVMRGAAAQVNAAIADLEKVEK |
| Ga0210402_110001152 | 3300021478 | Soil | DITATLRRICISIPAMNTEERLRLAESLRGVTAAINAAMIDLEKAGK |
| Ga0210409_110726361 | 3300021559 | Soil | LRRISISIPPMNTEERKRLADCLRTAGSAINAAVAELEKEGK |
| Ga0212123_100783924 | 3300022557 | Iron-Sulfur Acid Spring | YVEDITTTLRRICIYIPNMSPEERKRLAESLRGAAAAVNAAVADLEKVEK |
| Ga0207646_110166821 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RRICIYIPGMSAEERKRLAESLRTTVTAVNSAIADLEKVEK |
| Ga0207700_110220672 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IPNMSPEERKRLAESLRGAAAAVNAAVADLEKAEK |
| Ga0207664_105855272 | 3300025929 | Agricultural Soil | SIYIPGMSAEERKRLAEAMRGAADGINSTLAELEKAAK |
| Ga0257154_10240722 | 3300026467 | Soil | TTLRRMCLYIPSMNAEERKRLAEYLRAAGGAINAAIADLEKVEK |
| Ga0207781_10283752 | 3300026890 | Tropical Forest Soil | TLRRICIYIPSMNAEERKRLAEALRAAGTSVNAAIADLEKADK |
| Ga0208042_10139081 | 3300027568 | Peatlands Soil | RICIYIPAMSSDERKRLAEAMRGAAASVNAAIADLEKVEK |
| Ga0208324_100009522 | 3300027604 | Peatlands Soil | MNYVEDITNTLRRICISIPPMSTEERKRLAESLRTAGAAINAAIVDLEKVGQQ |
| Ga0208696_12826142 | 3300027696 | Peatlands Soil | TLRRIVIYIPTMTAEERKRLAEYLRVANQSIVEAVAQLEKGGQ |
| Ga0209040_102410931 | 3300027824 | Bog Forest Soil | TTLRRICIAIPAMNAEERKRLAESLRTAGIALNDAIKDLEKEKVAQ |
| Ga0209580_104530161 | 3300027842 | Surface Soil | EDITATLRRICIYIPGMSAEERKRLAESLRTTVVAVNSAIADLEKADK |
| Ga0209580_107007351 | 3300027842 | Surface Soil | ITATLRRICIYIPGMSPEERKRLAESLRTTVVAVNSAIADLEKADK |
| Ga0209275_100556873 | 3300027884 | Soil | IYIPNMNTEERKRLAESLRATGGAINAAIVDLEKVGP |
| Ga0209275_106582812 | 3300027884 | Soil | YIPAMNTEERKRLAESLRATSGAINTAIADLEKVGP |
| Ga0209380_102162532 | 3300027889 | Soil | IYIPAMNTEERKRLAESLRATSGAINTAIADLEKVGP |
| Ga0209380_107474761 | 3300027889 | Soil | NYVEDITTTLRRICISIPAMSTEERKRLADSLRVAGGALNEAIGDLEKARP |
| Ga0209415_110603922 | 3300027905 | Peatlands Soil | ITATLRRICIYIPAMSSDERKRLAEAMRGAAASVNAAIADLEKVEK |
| Ga0265354_10048081 | 3300028016 | Rhizosphere | TVRRLCLYIPSMNTEERQRLAEYLRAAGGALNAAIADLDKVGP |
| Ga0209526_106810892 | 3300028047 | Forest Soil | TLRRICISIPPMTTEERKRLAESLRTAVGAINAAIADLDKAGPQ |
| Ga0302227_100547131 | 3300028795 | Palsa | VDDITATLRRLCLYIPNMSAEERKRLAEYLRTAGGALNAALADLEKAG |
| Ga0311329_108174661 | 3300029907 | Bog | CISIPPMNTEERKRLADSLRAAGIALNAAIADLEKAGPQ |
| Ga0311369_111304182 | 3300029910 | Palsa | ITATLRRICIYIPNMSTEERLRLAEVLRSTGGAINAAIADLEKVGP |
| Ga0311343_110417711 | 3300029953 | Bog | IYIPNMSTEERLRLAESLRAAGVAINAAIGDLEKAAQ |
| Ga0302300_10725921 | 3300030042 | Palsa | RRICIYIPSMTPEERTRLAEYLRAAGSAITAAVADLEKVTP |
| Ga0302181_105048991 | 3300030056 | Palsa | YIPNMTTEERQRLAESLRATGGAINAAIADLEKVGP |
| Ga0311353_100301201 | 3300030399 | Palsa | ITTTLRRICISIPAMSVEERKRLADSLRAAGVALNDAIKDLEKEKVMAQ |
| Ga0302183_103017781 | 3300030509 | Palsa | EDITTTLRRICISIPAMSVEERKRLADSLRAAGVALNDAIKDLEKEKVMAQ |
| Ga0302310_104510082 | 3300030737 | Palsa | NYVEDITTTLRRICIYIPNMSTEERLRLAESLRAAGVAINAAIGDLEKAAQ |
| Ga0302312_103344731 | 3300030746 | Palsa | DITTTLRRICISIPAMNVEERKRLADSLRAAGGALNDAIKDLEKEKVAAQ |
| Ga0265753_11418392 | 3300030862 | Soil | RMCLYIPSMNAEERKRLAEYLRVAGTSVNSAIADLEKVEK |
| Ga0170834_1111036252 | 3300031057 | Forest Soil | NYVDDITTTLRRMCLYIPSMNAEERKRLAEYLRAAGGAVNAAIADLEKVDK |
| Ga0302324_1020217132 | 3300031236 | Palsa | TTLRRICISIPPMNTEERKRLADSLRAAGIALNAAIADLEKAGPQ |
| Ga0302324_1035610621 | 3300031236 | Palsa | SMNYVEDITTTLRRICISIPAMNVEERKRLADSLRAAGGALNDAIKDLEKEKVAAQ |
| Ga0265316_103623331 | 3300031344 | Rhizosphere | LRRMCLYIPSMNAEERKRLAEYLRAAGASINAAIGDLEKVEK |
| Ga0307474_105122161 | 3300031718 | Hardwood Forest Soil | RRICISIPAMNAEQRKRLADSLRAAGGALNSAIADLEKAGH |
| Ga0307469_111611632 | 3300031720 | Hardwood Forest Soil | MNYVEDITTTLRRISISIPAMNAEERKRLADSLRAAGSALNSAISELEKAGH |
| Ga0307477_104511361 | 3300031753 | Hardwood Forest Soil | TLRRICIYIPAMNAEERKRLAGSLREAGAAVNAAVADLEKVEK |
| Ga0307478_107099622 | 3300031823 | Hardwood Forest Soil | ITTTLRRMCLYIPSMNAEERKRLAEYLRAAGGAVNAAIADLEKTEK |
| Ga0306921_102277821 | 3300031912 | Soil | RICIYIPSMNSEERKRLAEAMRKAAESVNAAIADLEKADK |
| Ga0310912_107294301 | 3300031941 | Soil | DITATLRRICIYIPSMSPDERKRLAEAMHKASDSFNACIADLEKADK |
| Ga0307479_121463051 | 3300031962 | Hardwood Forest Soil | LRRICIYIPSMNTEERQRLAESLRAAGGAINAAIADLGKPQ |
| Ga0311301_122489661 | 3300032160 | Peatlands Soil | VDDITATLRRICIYIPNMNAEERKRLAESLRGAGGSITAAIADLEKADK |
| Ga0307472_1020821261 | 3300032205 | Hardwood Forest Soil | RMCLYIPSMNPEERKRLAEYLRAAGGAVDAAIADLEKADK |
| Ga0335082_115603572 | 3300032782 | Soil | ITATLRRISIYIPSMNPEERKRLAEAMRGAAAGINATLAELEKAEK |
| Ga0335079_113268862 | 3300032783 | Soil | ISSMTPEERQRLAAHLKTAGESINATIADLEKAGK |
| Ga0335080_109005442 | 3300032828 | Soil | TLRRITIYIPGMTPEERKRLAESMRGAANALNATLADLEKADK |
| Ga0335081_111214391 | 3300032892 | Soil | ATLRRICIYIPSMNPDERKRLAEAMHKAADSFNAAIADLEKAEK |
| Ga0335069_108111032 | 3300032893 | Soil | DITATLRRICIAIPSMTPEERQRLAEHLRAAGTAINSALADLEKAGK |
| Ga0335076_105504201 | 3300032955 | Soil | DISATLRRICIYIPAMSGDERKRLADALRVAQTALTAAIADAEKAEK |
| Ga0326727_102962253 | 3300033405 | Peat Soil | TLRRISIYIPSMNTEERKRLAEYLSPAGEALNAAIADLKKAGQ |
| ⦗Top⦘ |