| Basic Information | |
|---|---|
| Family ID | F072592 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MADANHQGLILDQFTRQATVFSTAPAITDEDALRMIVAAA |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.78 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.04 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.380 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.017 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.231 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.669 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF13602 | ADH_zinc_N_2 | 28.93 |
| PF08240 | ADH_N | 11.57 |
| PF04909 | Amidohydro_2 | 8.26 |
| PF00107 | ADH_zinc_N | 5.79 |
| PF00126 | HTH_1 | 3.31 |
| PF13561 | adh_short_C2 | 2.48 |
| PF02668 | TauD | 2.48 |
| PF00296 | Bac_luciferase | 2.48 |
| PF01169 | UPF0016 | 1.65 |
| PF03466 | LysR_substrate | 1.65 |
| PF00450 | Peptidase_S10 | 1.65 |
| PF02515 | CoA_transf_3 | 0.83 |
| PF13683 | rve_3 | 0.83 |
| PF02128 | Peptidase_M36 | 0.83 |
| PF02797 | Chal_sti_synt_C | 0.83 |
| PF03070 | TENA_THI-4 | 0.83 |
| PF12860 | PAS_7 | 0.83 |
| PF02776 | TPP_enzyme_N | 0.83 |
| PF01850 | PIN | 0.83 |
| PF13714 | PEP_mutase | 0.83 |
| PF00571 | CBS | 0.83 |
| PF01979 | Amidohydro_1 | 0.83 |
| PF02604 | PhdYeFM_antitox | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.48 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.48 |
| COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 1.65 |
| COG2939 | Carboxypeptidase C (cathepsin A) | Amino acid transport and metabolism [E] | 1.65 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.83 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.83 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.38 % |
| Unclassified | root | N/A | 25.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001537|A2065W1_11282713 | Not Available | 583 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101160837 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300004082|Ga0062384_100269658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
| 3300005434|Ga0070709_10062937 | All Organisms → cellular organisms → Bacteria | 2367 | Open in IMG/M |
| 3300005436|Ga0070713_101357274 | Not Available | 689 | Open in IMG/M |
| 3300005439|Ga0070711_100656861 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300005921|Ga0070766_11179768 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006175|Ga0070712_100981151 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300006804|Ga0079221_11419163 | Not Available | 553 | Open in IMG/M |
| 3300007258|Ga0099793_10374686 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300007788|Ga0099795_10031679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1823 | Open in IMG/M |
| 3300009012|Ga0066710_101454602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
| 3300009089|Ga0099828_10306445 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300009101|Ga0105247_10940499 | Not Available | 670 | Open in IMG/M |
| 3300009400|Ga0116854_1024785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300010048|Ga0126373_10273281 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300010359|Ga0126376_11909155 | Not Available | 634 | Open in IMG/M |
| 3300010359|Ga0126376_13226316 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010376|Ga0126381_100782854 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300010376|Ga0126381_101611220 | Not Available | 938 | Open in IMG/M |
| 3300010376|Ga0126381_103316070 | Not Available | 635 | Open in IMG/M |
| 3300010376|Ga0126381_104687272 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010397|Ga0134124_11104655 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300011271|Ga0137393_10054776 | Not Available | 3132 | Open in IMG/M |
| 3300011271|Ga0137393_11160827 | Not Available | 656 | Open in IMG/M |
| 3300011271|Ga0137393_11406785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300012180|Ga0153974_1107447 | Not Available | 636 | Open in IMG/M |
| 3300012198|Ga0137364_10637781 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012205|Ga0137362_11202195 | Not Available | 642 | Open in IMG/M |
| 3300012208|Ga0137376_10254861 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300012361|Ga0137360_10338532 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300012362|Ga0137361_10409473 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300012683|Ga0137398_10269326 | Not Available | 1139 | Open in IMG/M |
| 3300012925|Ga0137419_10895536 | Not Available | 730 | Open in IMG/M |
| 3300012927|Ga0137416_11275269 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012929|Ga0137404_12228985 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012944|Ga0137410_10477981 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300012961|Ga0164302_11027310 | Not Available | 645 | Open in IMG/M |
| 3300012975|Ga0134110_10556933 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300013294|Ga0120150_1022487 | Not Available | 1280 | Open in IMG/M |
| 3300013307|Ga0157372_12854143 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300014872|Ga0180087_1086877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha12_Bin1 | 600 | Open in IMG/M |
| 3300015245|Ga0137409_10233398 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300016357|Ga0182032_10949439 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300016387|Ga0182040_10220916 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300016387|Ga0182040_10423190 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300016404|Ga0182037_11591316 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300017961|Ga0187778_11286150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 514 | Open in IMG/M |
| 3300017975|Ga0187782_11188417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300017975|Ga0187782_11499478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300018088|Ga0187771_11081943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300019888|Ga0193751_1087392 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300020170|Ga0179594_10418237 | Not Available | 509 | Open in IMG/M |
| 3300020199|Ga0179592_10105381 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300020581|Ga0210399_11475569 | Not Available | 529 | Open in IMG/M |
| 3300021088|Ga0210404_10902543 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021178|Ga0210408_11032711 | Not Available | 635 | Open in IMG/M |
| 3300021402|Ga0210385_11258786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300021403|Ga0210397_10214756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1381 | Open in IMG/M |
| 3300021420|Ga0210394_10907533 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300021420|Ga0210394_11406600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300021433|Ga0210391_10817234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300021478|Ga0210402_11365465 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300021478|Ga0210402_11781835 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300021560|Ga0126371_11604322 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 777 | Open in IMG/M |
| 3300022528|Ga0242669_1083445 | Not Available | 596 | Open in IMG/M |
| 3300022726|Ga0242654_10340182 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300023046|Ga0233356_1045268 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300025916|Ga0207663_11157606 | Not Available | 622 | Open in IMG/M |
| 3300025927|Ga0207687_11480298 | Not Available | 583 | Open in IMG/M |
| 3300026078|Ga0207702_10540446 | Not Available | 1139 | Open in IMG/M |
| 3300026116|Ga0207674_11260087 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300026330|Ga0209473_1271226 | Not Available | 574 | Open in IMG/M |
| 3300026557|Ga0179587_10141116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1495 | Open in IMG/M |
| 3300027029|Ga0208731_1040401 | Not Available | 513 | Open in IMG/M |
| 3300027575|Ga0209525_1119018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300027619|Ga0209330_1155939 | Not Available | 514 | Open in IMG/M |
| 3300027824|Ga0209040_10458374 | Not Available | 578 | Open in IMG/M |
| 3300030524|Ga0311357_11707878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300030730|Ga0307482_1037861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis | 1115 | Open in IMG/M |
| 3300030740|Ga0265460_10020827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1858 | Open in IMG/M |
| 3300031091|Ga0308201_10285689 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031236|Ga0302324_101358960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 933 | Open in IMG/M |
| 3300031543|Ga0318516_10074503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1887 | Open in IMG/M |
| 3300031543|Ga0318516_10531492 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031544|Ga0318534_10360235 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031561|Ga0318528_10196346 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300031561|Ga0318528_10484533 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300031561|Ga0318528_10638514 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031679|Ga0318561_10605446 | Not Available | 603 | Open in IMG/M |
| 3300031680|Ga0318574_10230630 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300031682|Ga0318560_10415058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300031682|Ga0318560_10654944 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300031718|Ga0307474_10045448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 3240 | Open in IMG/M |
| 3300031719|Ga0306917_10937990 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031724|Ga0318500_10062217 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300031744|Ga0306918_10415628 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300031765|Ga0318554_10649076 | Not Available | 593 | Open in IMG/M |
| 3300031768|Ga0318509_10461357 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031770|Ga0318521_10885626 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031777|Ga0318543_10526297 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031781|Ga0318547_10266234 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300031792|Ga0318529_10107777 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300031797|Ga0318550_10342280 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300031797|Ga0318550_10579446 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031819|Ga0318568_10277366 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300031821|Ga0318567_10424487 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300031835|Ga0318517_10426071 | Not Available | 599 | Open in IMG/M |
| 3300031846|Ga0318512_10169343 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300031893|Ga0318536_10649134 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031894|Ga0318522_10016066 | All Organisms → cellular organisms → Bacteria | 2357 | Open in IMG/M |
| 3300031896|Ga0318551_10020450 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
| 3300031897|Ga0318520_10449977 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031942|Ga0310916_10291668 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300031942|Ga0310916_11191652 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031954|Ga0306926_10085387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3848 | Open in IMG/M |
| 3300032063|Ga0318504_10652397 | Not Available | 506 | Open in IMG/M |
| 3300032090|Ga0318518_10351507 | Not Available | 757 | Open in IMG/M |
| 3300032091|Ga0318577_10382295 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300032174|Ga0307470_11934943 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300032892|Ga0335081_12321216 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.02% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.48% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.65% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009400 | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2065W1_112827131 | 3300001537 | Permafrost | MTEDAHQSLIRDQFTRQATPFSTAAPIADAGALKMIVAAAEAGPA |
| JGIcombinedJ26739_1011608372 | 3300002245 | Forest Soil | MTEAAHSNLIRDQFTRQATPFSTAAPIANEAALKLIVE |
| Ga0062384_1002696581 | 3300004082 | Bog Forest Soil | MTNQAHSSLIRDKFTRQATPFSTATPITDAGALKMIIDVAAPGPDDTL |
| Ga0070709_100629374 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDTSHKGLILDQFTRQATVFSTAAPITNADALRMIIEAA |
| Ga0070713_1013572741 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDISHQDRILDQFSRQAMPFSTAAPITDGNALRMIVEAAAPKPNDTLLDVA |
| Ga0070711_1006568611 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDAAHQNLIREQFTRQATPFSTAAPIANEAALKLIIDAAR |
| Ga0070766_111797681 | 3300005921 | Soil | MTDAAHSSLIRDQFTRQATPFSTAAPIANEAALKLIVDAAGAGP |
| Ga0070712_1009811512 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDAAHQDLIRDQFTRQATPFSTAAPIANEAALKLIIDAAR |
| Ga0079221_114191631 | 3300006804 | Agricultural Soil | MTDASHQGLILDQFTRQAALFSTAAPITNADALQMI |
| Ga0099793_103746861 | 3300007258 | Vadose Zone Soil | MADANHQELILDQFTRQATVFSTAPAITDEEALGMIIRAAR |
| Ga0099795_100316794 | 3300007788 | Vadose Zone Soil | MADANHQGLILDQFTRQATLFSTAPAITDEGALRMIVEAGRPG |
| Ga0066710_1014546022 | 3300009012 | Grasslands Soil | MTEVSHSSLIRDQFTRQATPFSTAAPIADPATEPSPPRT |
| Ga0099828_103064453 | 3300009089 | Vadose Zone Soil | MTDAAHNSLIRDQFTRQATPFSTAAPIADAGALTLIVEAAE |
| Ga0105247_109404991 | 3300009101 | Switchgrass Rhizosphere | MKRTMSDTTHQQRILDQFTRQATPFSTAQTITDANALR |
| Ga0116854_10247851 | 3300009400 | Soil | MTDASHDALIRDQFTRQATVFNTAAPIKNEDALRAIV |
| Ga0126373_102732811 | 3300010048 | Tropical Forest Soil | MSDTAHQDLILDQFTRQATVFNTAAPIANADALKVIVDAAA |
| Ga0126376_119091552 | 3300010359 | Tropical Forest Soil | MSDADHQDLILDQFTRQATVFSTAPSITDEDALRR |
| Ga0126376_132263161 | 3300010359 | Tropical Forest Soil | MADADHQGLILDQFTRQATVFSTAPSITDERALQMIV |
| Ga0126381_1007828541 | 3300010376 | Tropical Forest Soil | MTDVNHQDLILDQFTRQATVFSTAPTITDQEALKMIVEAARPTSDDRL |
| Ga0126381_1016112201 | 3300010376 | Tropical Forest Soil | MSDTSHHDLILDQFTRQATVFSTAPTITDEDALRMIVDAA |
| Ga0126381_1033160701 | 3300010376 | Tropical Forest Soil | MSDTAHQARILDQFTRQATPFSTAQTITDTNALQMVVEAVA |
| Ga0126381_1046872721 | 3300010376 | Tropical Forest Soil | MTTTDHQDLILDQFTRQATLFSTAAPITNEGALRMIVEAAR |
| Ga0134124_111046552 | 3300010397 | Terrestrial Soil | MTDTSHQGLILDQFTRQATLFSSAAPITNADALQMVVEAARPEP |
| Ga0137393_100547764 | 3300011271 | Vadose Zone Soil | MTDANHQDLILDQFTRQATVFSTAPAITDEEALGMIVR |
| Ga0137393_111608271 | 3300011271 | Vadose Zone Soil | MSDDLHQSLIRDQFTRQATPFSTAAPIADAGALWMI |
| Ga0137393_114067851 | 3300011271 | Vadose Zone Soil | MTDTTHDALIRDQFTRQATVFNAAAPIAAEDALQKI |
| Ga0153974_11074472 | 3300012180 | Attine Ant Fungus Gardens | MTEATHQDLILDQFTRQATIFSSAPAITDERALRMIVEA |
| Ga0137364_106377812 | 3300012198 | Vadose Zone Soil | MTGTNHQGLILDQFTRQATVFSTAPAITDQDALRM |
| Ga0137362_112021951 | 3300012205 | Vadose Zone Soil | MTDAAHNSLIRGQFTRQASPFSTAAPIADAGALTL |
| Ga0137376_102548613 | 3300012208 | Vadose Zone Soil | MTDAAHQSLIRDQFTRQATPFSTAAPIASEAALRMIIDAARPGLDD |
| Ga0137360_103385322 | 3300012361 | Vadose Zone Soil | MADANHQDLILDQFTRQATAFSTAPAITDEEAPGMII |
| Ga0137361_104094732 | 3300012362 | Vadose Zone Soil | MADANHQELILDQLTRQATVFSTAPAITDEEALGMIIRAARPTPGDRLLD |
| Ga0137398_102693261 | 3300012683 | Vadose Zone Soil | MTDAAHQSLIRDQFTRQATPFSTAAPIASEATLRMI |
| Ga0137419_108955361 | 3300012925 | Vadose Zone Soil | MTDAAHQSLIRDQFTRQATPFSTAAPIASEAALQLIIDAAQPGPD |
| Ga0137416_112752691 | 3300012927 | Vadose Zone Soil | MADANHQGLILDQFTRQATVFSTAPAITDEDALKVIVEAARPGA |
| Ga0137404_122289852 | 3300012929 | Vadose Zone Soil | MTATDHQSLILDQFTRQATLFSTAAPITNEDALLKIVEAARPS |
| Ga0137410_104779812 | 3300012944 | Vadose Zone Soil | MTDATHQGLILDQFTRQATVFSTAAPITNESALRM |
| Ga0164302_110273101 | 3300012961 | Soil | MKRTMSDTTHQQRILDQFTRQATPFSTAQTITDANALRMIVEAAAPR |
| Ga0134110_105569331 | 3300012975 | Grasslands Soil | MTDAAHQDLIRDQFTRQATPFSTAAPIANEAALKLIIDAA |
| Ga0120150_10224871 | 3300013294 | Permafrost | MTEDAHQSLIRDQFTRQATPFSTAAPMADAGALKMIVPAA |
| Ga0157372_128541431 | 3300013307 | Corn Rhizosphere | MSDAGHQERILDQFTRQATPFSTANTITDANALRMI |
| Ga0180087_10868772 | 3300014872 | Soil | MTDDAHSGLIRDQFTRQATPFSTAAPIADAGALRMIVEAAEAGP |
| Ga0137409_102333984 | 3300015245 | Vadose Zone Soil | MTDATHQGLILDQFTRQATVFSTAAPITNESALRMVIEAAEADR |
| Ga0182032_109494392 | 3300016357 | Soil | MTNEPAIAKNAHDRLIRDQFTRQAVPFSTAGPITDPGALQAIVAAAAPGR |
| Ga0182040_102209163 | 3300016387 | Soil | MSDTSHQDLILDQFTRQATVFSTASTITDEDALRMIVE |
| Ga0182040_104231902 | 3300016387 | Soil | MTDPKHQDLILDQFTRQASPFSAAAMITDEAALGMIVEAAHA |
| Ga0182037_115913161 | 3300016404 | Soil | MTEAGHQDLIRDQFTRQATVFSTAAPITDEHALQMIVAAAK |
| Ga0187778_112861502 | 3300017961 | Tropical Peatland | MTDTHSELIRDQFTRQATAFSTAAPITDAGALEMIAAAAAA |
| Ga0187782_111884171 | 3300017975 | Tropical Peatland | MNDPNHQELILDQFTRQATVFSTAAAITDEQALRMVVE |
| Ga0187782_114994781 | 3300017975 | Tropical Peatland | MTEAAHRDLIRDQFTRQASVFNAAAPLAAEDALKLIVD |
| Ga0187771_110819431 | 3300018088 | Tropical Peatland | MSEIAHQDLILDQFTRQAVVFNAAASVANADALQLIVEA |
| Ga0193751_10873921 | 3300019888 | Soil | MSDDLHQSLIRDQFTRQATPFSTAAPIADVSALKMIVEAAEA |
| Ga0179594_104182371 | 3300020170 | Vadose Zone Soil | MTEANHQDLILDQFTRQATVFSTAPAITDEEALGMIVRA |
| Ga0179592_101053811 | 3300020199 | Vadose Zone Soil | MADANHQGLILDQFTRQATLFSTAPAITDEDALRMIVEAGRP |
| Ga0210399_114755691 | 3300020581 | Soil | MADANHQGLILDQFTRQATVFSTAPAITDEDALRMIVAAARPG |
| Ga0210404_109025431 | 3300021088 | Soil | MTDASHQGLILDQFTRQATLFSTAAPITNADAVRMIVEAARP |
| Ga0210408_110327112 | 3300021178 | Soil | MTNTAHNERILDQFTRQATPFSTAATITDAAALRLIV |
| Ga0210385_112587861 | 3300021402 | Soil | MTDSAHDELIRDQFTRQSQVFNAAAPIANEDQLKLIVD |
| Ga0210397_102147561 | 3300021403 | Soil | MSDTHQDLIRDQFTRQATVFNAAAPIAAEDALSKIVAA |
| Ga0210394_109075331 | 3300021420 | Soil | MSDKAHSSLILDQFTRQATPFSTASPITDAGALRMIVDAAAP |
| Ga0210394_114066003 | 3300021420 | Soil | MTDAVHQDLIRDQFTRQASVFNAAAPIANADALQLIVDA |
| Ga0210391_108172343 | 3300021433 | Soil | MSDTTHQDLIRDQFTRQATVFNAAAPIAAEDALAMIVAAA |
| Ga0210402_113654651 | 3300021478 | Soil | MADANHQELILDQFTRQATVFSTAPAITDEEALGMIIRAARPT |
| Ga0210402_117818352 | 3300021478 | Soil | MADANHQGLILDQFTRQATVFSTAPAITDEDALRMIVAAA |
| Ga0126371_116043222 | 3300021560 | Tropical Forest Soil | MPTSRPSEHQHEILDQFTRQATPFATAPGIRDEAA |
| Ga0242669_10834451 | 3300022528 | Soil | MTDTGHQGLILDQFTRQAALFSTAAPITNAGALRMIVDA |
| Ga0242654_103401821 | 3300022726 | Soil | MADANHQDLILDQFTRQATVFSTAAAITDEDALRMIVEAARP |
| Ga0233356_10452682 | 3300023046 | Soil | MTDTGHQGLILDQFTRQAALFSTAAPITNADAVRMIVEAARPGP |
| Ga0207663_111576061 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQTITHQDRILDQFTRQATPFSTAGTITDTNALRMIVEAAA |
| Ga0207687_114802981 | 3300025927 | Miscanthus Rhizosphere | MSDPTMSDAGHQARILDQFTRQAMPFSTASPITDAGALSM |
| Ga0207702_105404462 | 3300026078 | Corn Rhizosphere | MSDTSHQDRILDQFSRQAMPFSTAAPITDANALRMTV |
| Ga0207674_112600873 | 3300026116 | Corn Rhizosphere | MTDAAHQNLIREQFTRQATPFSTAAPIANEAALKLII |
| Ga0209473_12712261 | 3300026330 | Soil | MTGASHQGLILDQFTRQAALFSTAAPITNADTLHMIVEAARP |
| Ga0179587_101411161 | 3300026557 | Vadose Zone Soil | MADANHQGLILDQFTRQATLFSTAPAITDEGALRMI |
| Ga0208731_10404012 | 3300027029 | Forest Soil | MPNDTHSRLIRDQFTRQATPFSTASPITDVGALQMI |
| Ga0209525_11190181 | 3300027575 | Forest Soil | MTDTTHDALIRDQFTRQAGVFNAAAPIANEDALKLIVAA |
| Ga0209330_11559391 | 3300027619 | Forest Soil | MSDTAHQDLILDQFTRQATPFSTADTITDANALRMIVAAA |
| Ga0209040_104583741 | 3300027824 | Bog Forest Soil | MTDASHHDLILDQFTRQATVFSSAAAITDEDALRMIVDAARPAA |
| Ga0311357_117078782 | 3300030524 | Palsa | MTDTAHQDLIRDQFTRQATVFNAAAPIAAEDALKLIVESGRPGPDDG |
| Ga0307482_10378611 | 3300030730 | Hardwood Forest Soil | MTEASHQGLILDQFTRQAAVFSTAAPITNADALRMIV |
| Ga0265460_100208271 | 3300030740 | Soil | MTNEAHGSLIRDQFTRQATPFSTAMPITDAGALRMIVDAAAPEP |
| Ga0308201_102856891 | 3300031091 | Soil | MSGISHDDLIRDQFTRQAIPFNTAAPISDERALAMVVAAAKPRTSDDV |
| Ga0302324_1013589601 | 3300031236 | Palsa | MTDAMHDTLIRDQFTRQAEVFNAAAPIANKDALQLI |
| Ga0318516_100745034 | 3300031543 | Soil | MTEAGHQDLIRDQFTRQATVFSTAAPITDEHALQMIVA |
| Ga0318516_105314922 | 3300031543 | Soil | MTDATHQDLILDQFTRQATVFSTAPAITDEDALQM |
| Ga0318534_103602351 | 3300031544 | Soil | MTDATHQDLILDQFTRQATVFSTAPAITDEDVLQMIVQAARPTPN |
| Ga0318528_101963462 | 3300031561 | Soil | MTEAGHQDLIRDQFTRQATVFSTAAPITDEHALQMIVAAA |
| Ga0318528_104845331 | 3300031561 | Soil | MANEAHSDLIRDQFTRQATPFSTANPITDAGALDMIVA |
| Ga0318528_106385141 | 3300031561 | Soil | MTDATHQDLILDQFTRQATVFSTAPAITDEDVLQMIVQA |
| Ga0318561_106054461 | 3300031679 | Soil | MGDSTHQERILDQFTRQATPFSTASPITDANALRM |
| Ga0318574_102306302 | 3300031680 | Soil | MTDVTHQDLILDQFTRQAAVFGTAPAITDEAGTAGY |
| Ga0318560_104150583 | 3300031682 | Soil | MTNANHGDLILDQFTRQATVFSTAPTITDEDALQMIVE |
| Ga0318560_106549441 | 3300031682 | Soil | MSDTSHQDLILDQFTRQATVFSTASTITDEDALRMIVEAARP |
| Ga0307474_100454481 | 3300031718 | Hardwood Forest Soil | MSQTTHQDRILDQFTRQATPFSTAGTITDANALRMIVEAAAPRPG |
| Ga0306917_109379902 | 3300031719 | Soil | MTDATHQDLILDQFTRQATVFSTAPAITDEDAPQMIVQATRP |
| Ga0318500_100622171 | 3300031724 | Soil | MTDTSHQNLILDQFTRQATVFSTAPTITDEDALRMIVEAARPTSD |
| Ga0306918_104156282 | 3300031744 | Soil | MTTANHEDLILDQFTRQATVFSTAPSITDEGALQMLVAAARPG |
| Ga0318554_106490762 | 3300031765 | Soil | MTNANHGDLILDQFTRQATVFSTAPTITDEDAMQMI |
| Ga0318509_104613571 | 3300031768 | Soil | MTDATHQDLILDQFTRQATVFSTAPTITDEDALQM |
| Ga0318521_108856261 | 3300031770 | Soil | MANEAHSDLIRDQFTRQATPFSTANPITDAGELDMIVA |
| Ga0318543_105262972 | 3300031777 | Soil | VSQPSHNDLILDQFTRQATPFSTASTITDAAALKLIVET |
| Ga0318547_102662342 | 3300031781 | Soil | MTDATHQDLILDQFTRQATVFSTAPAITDEDVLQMIVQAARPTPND |
| Ga0318529_101077771 | 3300031792 | Soil | MTDATHQDLILDQFTRQARVFSTATAITDEDALRMIV |
| Ga0318550_103422801 | 3300031797 | Soil | MMDANHEDLILDQFTRQATVFSTAPTITDEDALQMIVEAARPG |
| Ga0318550_105794462 | 3300031797 | Soil | MADANHQELILDQFTRQATLFSTAAAITNESALRMI |
| Ga0318568_102773661 | 3300031819 | Soil | MTDTDHQELILDQFTRQATVFSTAPAITDEDALKM |
| Ga0318567_104244872 | 3300031821 | Soil | MTEAGHQDLIRDQFTRQATVFSTAAPITDEHALQM |
| Ga0318517_104260711 | 3300031835 | Soil | MTDATHQDLILDQFTRQATVFSTATAITDEDALRM |
| Ga0318512_101693431 | 3300031846 | Soil | MADANHQELILDQFTRQATLFSTAAAITNESALRM |
| Ga0318536_106491342 | 3300031893 | Soil | MTDATHQDLILDQFTRQATVFSIAPAITDEDALQMIVQAARPTLNDRLLDV |
| Ga0318522_100160664 | 3300031894 | Soil | MTNANHGDLILDQFTRQATVFSTAPTITDEDALQMIVEAARPG |
| Ga0318551_100204501 | 3300031896 | Soil | MTDATHQDLILDQFTRQATVFSTAPTITDEDALQMIVEAARPG |
| Ga0318520_104499771 | 3300031897 | Soil | MSDTSHQDLILDQFTRQATVFSTASTITDEDALRMIV |
| Ga0310916_102916683 | 3300031942 | Soil | MTEAGHQDLIRDQFTRQATVFSTAAPITDERALQMIVG |
| Ga0310916_111916521 | 3300031942 | Soil | MTNANHGDLILVQFTRQATVFSTAPTITDEDALQM |
| Ga0306926_100853871 | 3300031954 | Soil | VTDATHQDLILDQFTRQATVFSTAPAITDEEALTMIVEAA |
| Ga0318504_106523972 | 3300032063 | Soil | MTDTNHQNLILDQFTRQATVFSTATTITDEGALRM |
| Ga0318518_103515071 | 3300032090 | Soil | MTDTDHQELILDQFTRQATVFSTAPAITDEDALKMIVAAA |
| Ga0318577_103822951 | 3300032091 | Soil | MTDTNHQNLILDQFTRQATVFSTAPTITDEGALRMIVEAA |
| Ga0307470_119349432 | 3300032174 | Hardwood Forest Soil | MADANHQDLILDQFTRQATVFSTAPAITDEEALGMIIRAARPSP |
| Ga0335081_123212161 | 3300032892 | Soil | MTGDTHSSLIRDQFTRQATPFSTAAPIADERALRLIVEAAG |
| ⦗Top⦘ |