| Basic Information | |
|---|---|
| Family ID | F072577 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 40 residues |
| Representative Sequence | RDLIRERLALPGAPQMLLQLGLAHTAHATARRPPADLIEP |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.69 % |
| % of genes near scaffold ends (potentially truncated) | 94.21 % |
| % of genes from short scaffolds (< 2000 bps) | 87.60 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.207 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.711 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.802 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.843 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 16.18% β-sheet: 0.00% Coil/Unstructured: 83.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF12900 | Pyridox_ox_2 | 7.44 |
| PF01734 | Patatin | 7.44 |
| PF07411 | DUF1508 | 4.13 |
| PF01472 | PUA | 4.13 |
| PF08044 | DUF1707 | 4.13 |
| PF01522 | Polysacc_deac_1 | 3.31 |
| PF01915 | Glyco_hydro_3_C | 1.65 |
| PF09363 | XFP_C | 1.65 |
| PF06689 | zf-C4_ClpX | 1.65 |
| PF00479 | G6PD_N | 1.65 |
| PF02036 | SCP2 | 1.65 |
| PF00583 | Acetyltransf_1 | 1.65 |
| PF06224 | HTH_42 | 1.65 |
| PF00582 | Usp | 1.65 |
| PF01906 | YbjQ_1 | 0.83 |
| PF07596 | SBP_bac_10 | 0.83 |
| PF08240 | ADH_N | 0.83 |
| PF07883 | Cupin_2 | 0.83 |
| PF02687 | FtsX | 0.83 |
| PF01872 | RibD_C | 0.83 |
| PF00679 | EFG_C | 0.83 |
| PF01654 | Cyt_bd_oxida_I | 0.83 |
| PF03706 | LPG_synthase_TM | 0.83 |
| PF01381 | HTH_3 | 0.83 |
| PF13631 | Cytochrom_B_N_2 | 0.83 |
| PF14031 | D-ser_dehydrat | 0.83 |
| PF08327 | AHSA1 | 0.83 |
| PF05762 | VWA_CoxE | 0.83 |
| PF08818 | DUF1801 | 0.83 |
| PF13247 | Fer4_11 | 0.83 |
| PF07992 | Pyr_redox_2 | 0.83 |
| PF04542 | Sigma70_r2 | 0.83 |
| PF00440 | TetR_N | 0.83 |
| PF00571 | CBS | 0.83 |
| PF13561 | adh_short_C2 | 0.83 |
| PF05532 | CsbD | 0.83 |
| PF02604 | PhdYeFM_antitox | 0.83 |
| PF07729 | FCD | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 7.44 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 7.44 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 7.44 |
| COG3422 | Uncharacterized conserved protein YegP, UPF0339 family | Function unknown [S] | 4.13 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 3.31 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 1.65 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 1.65 |
| COG2165 | Type II secretory pathway, pseudopilin PulG | Cell motility [N] | 1.65 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 1.65 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.83 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.83 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.83 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.83 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.83 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.83 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.83 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.83 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.83 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.83 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.83 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.83 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.83 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.83 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.83 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.21 % |
| Unclassified | root | N/A | 24.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_101866566 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300005440|Ga0070705_101345853 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005468|Ga0070707_101054623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
| 3300005538|Ga0070731_10372634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 949 | Open in IMG/M |
| 3300006175|Ga0070712_101807383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300006806|Ga0079220_10154193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1271 | Open in IMG/M |
| 3300009792|Ga0126374_10558656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 837 | Open in IMG/M |
| 3300010120|Ga0127451_1026037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300010120|Ga0127451_1079421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 668 | Open in IMG/M |
| 3300010358|Ga0126370_12354775 | Not Available | 528 | Open in IMG/M |
| 3300010360|Ga0126372_12178124 | Not Available | 603 | Open in IMG/M |
| 3300010361|Ga0126378_12390706 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300010366|Ga0126379_11282811 | Not Available | 839 | Open in IMG/M |
| 3300010366|Ga0126379_11412955 | Not Available | 802 | Open in IMG/M |
| 3300010379|Ga0136449_100848439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1499 | Open in IMG/M |
| 3300010868|Ga0124844_1140894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 915 | Open in IMG/M |
| 3300012201|Ga0137365_10015128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6051 | Open in IMG/M |
| 3300012209|Ga0137379_11018134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300012285|Ga0137370_10778821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300012353|Ga0137367_10645968 | Not Available | 739 | Open in IMG/M |
| 3300012354|Ga0137366_10193487 | Not Available | 1521 | Open in IMG/M |
| 3300012354|Ga0137366_11200118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300012362|Ga0137361_11445116 | Not Available | 610 | Open in IMG/M |
| 3300012363|Ga0137390_10391697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1369 | Open in IMG/M |
| 3300012384|Ga0134036_1155426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300012389|Ga0134040_1086105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300012971|Ga0126369_10305682 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300014495|Ga0182015_10508001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300016294|Ga0182041_11954146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 546 | Open in IMG/M |
| 3300016387|Ga0182040_10189332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1503 | Open in IMG/M |
| 3300017926|Ga0187807_1055152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Labedaea → Labedaea rhizosphaerae | 1233 | Open in IMG/M |
| 3300017926|Ga0187807_1160038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300017926|Ga0187807_1168874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300017932|Ga0187814_10216903 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300017937|Ga0187809_10361225 | Not Available | 546 | Open in IMG/M |
| 3300017943|Ga0187819_10074507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2022 | Open in IMG/M |
| 3300017955|Ga0187817_10937508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
| 3300017959|Ga0187779_10073248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2026 | Open in IMG/M |
| 3300017959|Ga0187779_10887840 | Not Available | 613 | Open in IMG/M |
| 3300017970|Ga0187783_10102966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2105 | Open in IMG/M |
| 3300017970|Ga0187783_10679275 | Not Available | 744 | Open in IMG/M |
| 3300017974|Ga0187777_11203331 | Not Available | 554 | Open in IMG/M |
| 3300017995|Ga0187816_10560490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300018007|Ga0187805_10425144 | Not Available | 618 | Open in IMG/M |
| 3300018030|Ga0187869_10620001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300018033|Ga0187867_10694451 | Not Available | 554 | Open in IMG/M |
| 3300018058|Ga0187766_10823698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
| 3300018058|Ga0187766_11444373 | Not Available | 506 | Open in IMG/M |
| 3300018060|Ga0187765_10429848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300018064|Ga0187773_10432007 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300018482|Ga0066669_12272500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300019245|Ga0187791_1490512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300025922|Ga0207646_10321052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1399 | Open in IMG/M |
| 3300025929|Ga0207664_10284151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1452 | Open in IMG/M |
| 3300025929|Ga0207664_11617449 | Not Available | 570 | Open in IMG/M |
| 3300026908|Ga0207787_1026103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium helvum | 575 | Open in IMG/M |
| 3300027662|Ga0208565_1001043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17499 | Open in IMG/M |
| 3300027676|Ga0209333_1000055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 61240 | Open in IMG/M |
| 3300027905|Ga0209415_10086596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3552 | Open in IMG/M |
| 3300027905|Ga0209415_10761328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 682 | Open in IMG/M |
| 3300027905|Ga0209415_11023788 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031543|Ga0318516_10404848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 786 | Open in IMG/M |
| 3300031543|Ga0318516_10710814 | Not Available | 570 | Open in IMG/M |
| 3300031544|Ga0318534_10113679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1554 | Open in IMG/M |
| 3300031544|Ga0318534_10153149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1330 | Open in IMG/M |
| 3300031572|Ga0318515_10182641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1122 | Open in IMG/M |
| 3300031573|Ga0310915_10707123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
| 3300031640|Ga0318555_10184269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1123 | Open in IMG/M |
| 3300031681|Ga0318572_10806810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300031682|Ga0318560_10063128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1853 | Open in IMG/M |
| 3300031682|Ga0318560_10328060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 826 | Open in IMG/M |
| 3300031708|Ga0310686_105335799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300031713|Ga0318496_10123360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1403 | Open in IMG/M |
| 3300031719|Ga0306917_10251688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1354 | Open in IMG/M |
| 3300031723|Ga0318493_10780845 | Not Available | 537 | Open in IMG/M |
| 3300031736|Ga0318501_10016541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3004 | Open in IMG/M |
| 3300031769|Ga0318526_10475820 | Not Available | 510 | Open in IMG/M |
| 3300031770|Ga0318521_10166611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1258 | Open in IMG/M |
| 3300031770|Ga0318521_10640601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
| 3300031771|Ga0318546_10695899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300031777|Ga0318543_10405215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300031782|Ga0318552_10452122 | Not Available | 655 | Open in IMG/M |
| 3300031796|Ga0318576_10103385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1302 | Open in IMG/M |
| 3300031799|Ga0318565_10142673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1160 | Open in IMG/M |
| 3300031799|Ga0318565_10660545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 501 | Open in IMG/M |
| 3300031805|Ga0318497_10474193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
| 3300031819|Ga0318568_10025821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3235 | Open in IMG/M |
| 3300031833|Ga0310917_10886166 | Not Available | 601 | Open in IMG/M |
| 3300031845|Ga0318511_10112938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. CF8 | 1164 | Open in IMG/M |
| 3300031859|Ga0318527_10255187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300031860|Ga0318495_10152601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1041 | Open in IMG/M |
| 3300031879|Ga0306919_10369570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1097 | Open in IMG/M |
| 3300031890|Ga0306925_10018329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6933 | Open in IMG/M |
| 3300031890|Ga0306925_11756987 | Not Available | 596 | Open in IMG/M |
| 3300031894|Ga0318522_10083478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1169 | Open in IMG/M |
| 3300031897|Ga0318520_10351891 | Not Available | 894 | Open in IMG/M |
| 3300031910|Ga0306923_10315843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1784 | Open in IMG/M |
| 3300031910|Ga0306923_10671479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. CF8 | 1156 | Open in IMG/M |
| 3300031910|Ga0306923_11942025 | Not Available | 599 | Open in IMG/M |
| 3300031912|Ga0306921_12277617 | Not Available | 569 | Open in IMG/M |
| 3300031947|Ga0310909_10319152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1303 | Open in IMG/M |
| 3300031954|Ga0306926_12011188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 649 | Open in IMG/M |
| 3300032008|Ga0318562_10216530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1110 | Open in IMG/M |
| 3300032009|Ga0318563_10575305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
| 3300032039|Ga0318559_10607986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 510 | Open in IMG/M |
| 3300032060|Ga0318505_10309738 | Not Available | 745 | Open in IMG/M |
| 3300032066|Ga0318514_10140034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1250 | Open in IMG/M |
| 3300032089|Ga0318525_10224425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 966 | Open in IMG/M |
| 3300032089|Ga0318525_10360931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 745 | Open in IMG/M |
| 3300032091|Ga0318577_10398946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium helvum | 657 | Open in IMG/M |
| 3300032094|Ga0318540_10103848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1338 | Open in IMG/M |
| 3300032094|Ga0318540_10107830 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300032160|Ga0311301_10078001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6852 | Open in IMG/M |
| 3300032205|Ga0307472_100108766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1929 | Open in IMG/M |
| 3300032892|Ga0335081_10030903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus sabuli | 8604 | Open in IMG/M |
| 3300032896|Ga0335075_11514962 | Not Available | 557 | Open in IMG/M |
| 3300032955|Ga0335076_11679987 | Not Available | 523 | Open in IMG/M |
| 3300034644|Ga0370548_111766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.09% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.44% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.83% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066388_1018665663 | 3300005332 | Tropical Forest Soil | LEAEPIRALIRDRLALPGSPQILLQLGLAHTTRATARRPPADLTES* |
| Ga0070705_1013458532 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LEAAAIRALIRDRLALPGAPQMLLQLGLAHTAHATARRPPDDLIEL* |
| Ga0070707_1010546231 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSVRAQVRSGLALPGPPQMLLQLGVARTTHPTARRPAEELAEPSAR* |
| Ga0070699_1021181842 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPRGLALPGPPQMLLQLGVARTTHPTARRPAEELAEPSAR* |
| Ga0070731_103726342 | 3300005538 | Surface Soil | IRALIRDRLSLPGAPQMLLQLGVAHATHATARRPPGELIEP* |
| Ga0070712_1018073832 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ATEIRALIRGRLALPGAPQLLLQLGIAHTTLATARRPPADLIEP* |
| Ga0079220_101541933 | 3300006806 | Agricultural Soil | IRALIRARLALPGAPQMLLQLGPARTTQATARRPSAELTEP* |
| Ga0126374_105586562 | 3300009792 | Tropical Forest Soil | EAAEIRALIRGRLALPGAPQLLLQLGIAHSTLATARRPPADLIEP* |
| Ga0127451_10260372 | 3300010120 | Grasslands Soil | RDRLALPGAPQMLLQLGLAHTAQATARRPASDLIEP* |
| Ga0127451_10794211 | 3300010120 | Grasslands Soil | RDRLALPGAPQMLLQLGLAHTAQATARRPASDLIALTT* |
| Ga0126370_123547752 | 3300010358 | Tropical Forest Soil | AAPIRALIRGRLALPGNPQILLQLGPAHTTRATARRPPADLTEP* |
| Ga0126372_121781241 | 3300010360 | Tropical Forest Soil | AAIRDLIRTRLALPGSPQMLLQLGLARTAQATARRPPAELMEP* |
| Ga0126378_123907062 | 3300010361 | Tropical Forest Soil | IRDLIRAGMGLPGAPQMLLQLGRARTTQATARRPPTDLMEP* |
| Ga0126379_112828112 | 3300010366 | Tropical Forest Soil | ERLALPGAPQMLLQLGLAHTAHATARRPPTELIEP* |
| Ga0126379_114129552 | 3300010366 | Tropical Forest Soil | RDRLALPGPPQMLLQLGLAHTTHATARRSPADLTEP* |
| Ga0136449_1008484391 | 3300010379 | Peatlands Soil | IRDRLSLPGAPQMVMQLGVSHSARSTARRAPEELIEN* |
| Ga0124844_11408941 | 3300010868 | Tropical Forest Soil | RLVLPGAPQMLLQLGRAQTTRATARRPPADLTGP* |
| Ga0137365_100151281 | 3300012201 | Vadose Zone Soil | RRPLIRDRLALPGAPQMLLQLGPAHATHATARRPPDDLIEP* |
| Ga0137379_110181341 | 3300012209 | Vadose Zone Soil | PLEAAAIRALIRDRLALPGAPQMLLQLGLAHTTHATARRPPADRIEP* |
| Ga0137370_107788212 | 3300012285 | Vadose Zone Soil | RAVIRDRLALPGAPQMLLQLGLAHTAHTTARRQPDDLIEP* |
| Ga0137367_106459681 | 3300012353 | Vadose Zone Soil | AAAIRSLIQARLALPGAPQMLLQLGLARATQATARRPPAELIEP* |
| Ga0137366_101934871 | 3300012354 | Vadose Zone Soil | IRDRLALPGAPQMLLQLGPAHTTHTTARRPPDDLTEP* |
| Ga0137366_112001181 | 3300012354 | Vadose Zone Soil | IRDRLALPGAPQMLLQLGPAHTTHTTARRPPDDLIEP* |
| Ga0137371_102913762 | 3300012356 | Vadose Zone Soil | RAGLALPGAPQMLLQLGRADAAPVTARRPASELLSPV* |
| Ga0137361_114451161 | 3300012362 | Vadose Zone Soil | IRARLALPGFPQMLLQLGRAATAAATARRPAEALLPWQ* |
| Ga0137390_103916973 | 3300012363 | Vadose Zone Soil | EAAAIRDLIRDRLALPGAPQMLLQLGLADTSHATARRPPDDLIEP* |
| Ga0134036_11554262 | 3300012384 | Grasslands Soil | RDLIRDRLALPGAPQMLLQLGLAHTAQATARRPASDLIEP* |
| Ga0134040_10861051 | 3300012389 | Grasslands Soil | LIRDRLALPGAPQMLLQLGLAHTAQATARRPASDLIEP* |
| Ga0126369_103056821 | 3300012971 | Tropical Forest Soil | LIRDRLALPGRPQILLQLGLAHTTHSTARRPPADLTEP* |
| Ga0182015_105080012 | 3300014495 | Palsa | MEAVAIRDLIRTRLSLPGSPQMLLQLGPARTTQATARRPPAELVEPR* |
| Ga0182041_119541462 | 3300016294 | Soil | LIRGRLALPGAPQLLLQLGIAHSTLATARRPPADLMEP |
| Ga0182040_101893323 | 3300016387 | Soil | ALIKDRLALPGAPQMLMQLGLAHTTRSTARRPPREVTDP |
| Ga0187807_10551522 | 3300017926 | Freshwater Sediment | TRALIQDRLALPGAPQMLLQLGVAHATHATARRPPEDVTG |
| Ga0187807_11600381 | 3300017926 | Freshwater Sediment | IRDRLALPGAPQMLLQLGVADTTHPTGRRPPDELIEA |
| Ga0187807_11688741 | 3300017926 | Freshwater Sediment | HPIIRALIQDRLALPGPPQMLLQLGVAHTTQATPRRPPQDVTV |
| Ga0187814_102169033 | 3300017932 | Freshwater Sediment | ELLEITVIRALIRDRLALPGAPQMLLQLGVADTTHPTGRRPPDELIEP |
| Ga0187809_103612251 | 3300017937 | Freshwater Sediment | LIQDRLDLPGYPQILLQLGPAHTTRVTARRPPDDLLAP |
| Ga0187819_100745074 | 3300017943 | Freshwater Sediment | LEHDLTRALIQDRLALPGAPQMLLQLGVADTTHATARRPPEDVIG |
| Ga0187817_109375082 | 3300017955 | Freshwater Sediment | ALIEDRLALPGAVQMVLQLGSAGTTHATARRPPADLIEP |
| Ga0187779_100732481 | 3300017959 | Tropical Peatland | NLIRTLIRDRLALPGIPQMLLQLGLAHTTHATARRSPADLTEP |
| Ga0187779_108878401 | 3300017959 | Tropical Peatland | LEHELVRAVIQDRLALPGAPQMMLQLGVAHTTNVTARRPPEDVIG |
| Ga0187783_101029661 | 3300017970 | Tropical Peatland | LIRDRLSLHGAPQMILQLGMAHSTRVTARRPPSDLLDG |
| Ga0187783_106792752 | 3300017970 | Tropical Peatland | LIRERLALPGAPQMLLQLGLARTTHATARRAPGDLIDP |
| Ga0187777_112033312 | 3300017974 | Tropical Peatland | RALIRDRLALPGAPQMLLQLGLVDTTHPTGRRPPEELIEP |
| Ga0187816_105604901 | 3300017995 | Freshwater Sediment | LIRTRLALPGAPQMLLQLGPARTTQATARRSPAELIKP |
| Ga0187805_104251442 | 3300018007 | Freshwater Sediment | TRLRLPGAPQMLLQLGRARTTLATARRPPAELMEP |
| Ga0187869_106200011 | 3300018030 | Peatland | TLIRDRLSLPGTPHMVMQLGVSHSAHSTARRAPEELIEP |
| Ga0187867_106944512 | 3300018033 | Peatland | ASIRALIRDRLSLPGAPQMVMQLGVSHTARSTARRGPDELIEPC |
| Ga0187766_108236981 | 3300018058 | Tropical Peatland | RDLIRERLALPGAPQMLLQLGLAHTAHATARRPPADLIEP |
| Ga0187766_114443732 | 3300018058 | Tropical Peatland | IRALIRDRLALPGAPQMLLQLGLVDTTHPTGRRPPEELIEP |
| Ga0187765_104298482 | 3300018060 | Tropical Peatland | IRALIQDRLGLPGAPQMLLQLGVAHTAHATARRPTQDVIG |
| Ga0187773_104320072 | 3300018064 | Tropical Peatland | LIQDQLALPGVPQMLLQLGPAHTTRATARRPPSDLIDP |
| Ga0066669_122725001 | 3300018482 | Grasslands Soil | AAGIRALIRDRLALPGAPQMLLQLGLAHTAHATARRPPDDLIEP |
| Ga0187791_14905121 | 3300019245 | Peatland | ALPGAPQLLLQLGPAHSAHATARRPAADVIEPTGPEAAG |
| Ga0207646_103210522 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSVRAQVRSGLALPGPPQMLLQLGVARTTHPTARRPAEELAEPSAR |
| Ga0207664_102841511 | 3300025929 | Agricultural Soil | LIQRCLALPGAPQMLLQLGLAHAAHATARRPPADLIEP |
| Ga0207664_116174493 | 3300025929 | Agricultural Soil | AAAIRALIQDRLALLGAPQMLLQLGLAHTTQATARRPPADLIDP |
| Ga0207787_10261031 | 3300026908 | Tropical Forest Soil | RALIRDRLALPGAPQMLLQLGVVDTTHPTGRRPPDELIEP |
| Ga0208565_10010431 | 3300027662 | Peatlands Soil | SVRELIRSRLALSGAPQLLLQLGVAKTAQATARRPPRELIEPERAR |
| Ga0209333_100005550 | 3300027676 | Forest Soil | MEAVAIRDLIRTRLSLPGSPQMLLQLGPARTTQATAHRPPAKLGEPR |
| Ga0209415_100865961 | 3300027905 | Peatlands Soil | IRDRLALPGFPQMLLQLGPAHTTHATARRPPADLTEP |
| Ga0209415_107613281 | 3300027905 | Peatlands Soil | QPLESGPIRALIRERLSLPGAPQMLLQLGVAHTSHATARRAPGDLIEP |
| Ga0209415_110237881 | 3300027905 | Peatlands Soil | ALIRALIRDRLSLPGDPQLLLQLGVAHTTHATARRPPGDLIEP |
| Ga0318516_104048481 | 3300031543 | Soil | LIKDRLGLPGAPQMVLQLGLARTTRSTARRPPAEVTDP |
| Ga0318516_107108142 | 3300031543 | Soil | AGPIRALIRDRLVLPGSPQILLQLGLAHTTRATARRPPADLTEP |
| Ga0318534_101136794 | 3300031544 | Soil | DRLALPGAPQMLMQLGLAHTTRSTARRPPREITDP |
| Ga0318534_101531491 | 3300031544 | Soil | IQDRLALPGHPQILLQLGLAHTARATARRSPADMIEP |
| Ga0318515_101826411 | 3300031572 | Soil | TLIRALIRDRLALPGAPQMLLQLGVVDTTHPTGRRPPDELIEP |
| Ga0310915_107071231 | 3300031573 | Soil | DRLALPGAPQMLLQLGAVDTTHPTGRRPPDDLIEP |
| Ga0318555_101842691 | 3300031640 | Soil | RTLIQDRLALPGHPQILLQLGLAHTARATARRSPADMIEP |
| Ga0318572_108068101 | 3300031681 | Soil | RALIRDRLGLPSPPQMLLQLGVAHTAHATARRPPDEVIEL |
| Ga0318560_100631284 | 3300031682 | Soil | DRLALPGAPQMLLQLGVVDTTHPTGRRPPDELIEP |
| Ga0318560_103280603 | 3300031682 | Soil | TLIRDRLALPGFPQILLQIGLAHTTRATARRAPADLIES |
| Ga0310686_1053357992 | 3300031708 | Soil | QPLEAAPIRAVIRDRLALPGAPQMLLQLGVAHTTHATARRPPDELIEP |
| Ga0318496_101233603 | 3300031713 | Soil | LIRDRLGLPSAPQMLLQLGVAHTAHATARRPPDELIEP |
| Ga0306917_102516881 | 3300031719 | Soil | IQDRLALPGPPQMVLQLGLARTTRSTARRPPTEITEP |
| Ga0318493_107808453 | 3300031723 | Soil | IKERLALPGAPQMVLQLGLARTTRSTARRPPAEVTDP |
| Ga0318501_100165411 | 3300031736 | Soil | TLIRALVRDRLALPGAPQMLLQLGAVDTTHPTGRRPPDDLIEP |
| Ga0318526_104758201 | 3300031769 | Soil | ARLGLPGAPQMLLQLGRARTTQATARRPPAELMEP |
| Ga0318521_101666113 | 3300031770 | Soil | LIQDRLALPGHPQILLQLGLAHTARATARRSPADMIEP |
| Ga0318521_106406011 | 3300031770 | Soil | LEAAAIRALIRARLTLPGTPQMLLQLGPARTTQTTARRPPAELIEP |
| Ga0318546_106958992 | 3300031771 | Soil | DLIRDRLGLPSPPQMLLQLGVAHTAHATARRPPDEVIEL |
| Ga0318543_104052152 | 3300031777 | Soil | LESEAIRALIRDRLALPGFPQILLQIGLAHTTRATARRAPADLIES |
| Ga0318552_104521222 | 3300031782 | Soil | IRTLIQDRLALPGHPQILLQLGLAHNTCATARRSPADMIEP |
| Ga0318576_101033851 | 3300031796 | Soil | KDRLALPGAPQMLMQLGLAHTTRSTARRPPREITDP |
| Ga0318565_101426731 | 3300031799 | Soil | IRALVRDRLALPGAPQMLLQLGAVDTTHPTGRRPPDDLIEP |
| Ga0318565_106605451 | 3300031799 | Soil | IKDRLALPGTPQMLLQLGLAHTTHATARRSPADLIEP |
| Ga0318497_104741932 | 3300031805 | Soil | LEATAIRALIQDRLALPGPPQMMLQLGLAHTTRSTARRPPGELTEP |
| Ga0318568_100258213 | 3300031819 | Soil | LIRDRLALPGSPQMLLQIGLAHTTRATARRPPAELTES |
| Ga0310917_108861661 | 3300031833 | Soil | LIRDRQTLPGFPQMLLQLGLAHTTRATARRPPPDLTEP |
| Ga0318511_101129382 | 3300031845 | Soil | AEVSRELIRERLALPGEPQMLLQLGLAHTAHATARRPPTDLIEP |
| Ga0318527_102551871 | 3300031859 | Soil | STLIRALVRDRLALPGAPQMLLQLGAVDTTHPTGRRPPDDLIEP |
| Ga0318495_101526011 | 3300031860 | Soil | LIRDRLALPGAPQMLLQLGVVDTTHPTGRRPPDELIEP |
| Ga0306919_103695703 | 3300031879 | Soil | RALIKDRLALPGAPQMVLQLGLARTTRSTARRPPAEVTDP |
| Ga0306925_100183298 | 3300031890 | Soil | LEAAAIRALIKDRLALPGAPQMVLQLGLARTTRSTARRPPAEVTDP |
| Ga0306925_117569871 | 3300031890 | Soil | AAIRGLIQDRLDLPGHPQILLQLGLAHNTPVTARRSPDTLLEP |
| Ga0318522_100834781 | 3300031894 | Soil | TLIQDRLALPGHPQILLQLGLAHTARATARRSPADMIEP |
| Ga0318520_103518911 | 3300031897 | Soil | AAAIRTLIQDRLALPGHPQILLQLGLAHNTCATARRSPADMIEP |
| Ga0306923_103158431 | 3300031910 | Soil | LIRRQLTLPGWPQMLLQLGLARTTHPTARRPPADLIDP |
| Ga0306923_106714792 | 3300031910 | Soil | EAVVSRDLIRERLALPGDPQMLLQLGLAHTAHATARRPPTDLIEP |
| Ga0306923_119420251 | 3300031910 | Soil | DRLALPGHPQILLQLGLAHTARATARRSPADMIEP |
| Ga0306921_122776172 | 3300031912 | Soil | AAIRALIKDRLALPGAPQMLMQLGLARTTRSTARRPPAEVTDP |
| Ga0310909_103191523 | 3300031947 | Soil | IRALIKDRLALPGAPQMVLQLGLARTTRSTARRPPAEVTDP |
| Ga0306926_120111881 | 3300031954 | Soil | GLPGTPQMLMQLGVAHTTRATARRPPEDVIDKPGS |
| Ga0318562_102165302 | 3300032008 | Soil | IKDRLALPGSPQIVLQLGLARTTQATARRPPTDLAEP |
| Ga0318563_105753051 | 3300032009 | Soil | IRDRLGLPSAPQMLLQLGVARTAHATARRPPDELIEP |
| Ga0318559_106079862 | 3300032039 | Soil | IRALIGDRLGLLSAPQMLLQLGVAHTAHATARRPPDELIEP |
| Ga0318505_103097381 | 3300032060 | Soil | SLEAAAIRTLIQDRLALPGHPQILLQLGLAHNTCATARRSPADMIEP |
| Ga0318513_100004951 | 3300032065 | Soil | TRGLIQARLALPGCPQMLLQLGLARTTHPTARRPVSELAGPR |
| Ga0318514_101400344 | 3300032066 | Soil | RSLIKDRLALPGAPQMLMQLGLARTTRSTARRPPREVTDP |
| Ga0318525_102244251 | 3300032089 | Soil | ALIRDRLTLPGFPQMLLQLGLAHTTRATARRPPPDLTEP |
| Ga0318525_103609312 | 3300032089 | Soil | IKVRLALPGAPQMLMQLGLARTTRSTARRPPAEVTDP |
| Ga0318577_103989462 | 3300032091 | Soil | VTLIRALIRDRLALPGAPQMLLQLGVVDTTHPTGRRPPDELIEP |
| Ga0318540_101038481 | 3300032094 | Soil | LIKDRLALPGAPQMLMQLGLAHTTRSTARRPPREITDP |
| Ga0318540_101078303 | 3300032094 | Soil | VRDRLALPGAPQMLLQLGAVDTTHPTGRRPPDDLIEP |
| Ga0311301_100780011 | 3300032160 | Peatlands Soil | ACAAASLPGFPQMLLQLGPAHTTHATARRPPADLTEP |
| Ga0307472_1001087664 | 3300032205 | Hardwood Forest Soil | ADAIRVLIQRCLALPGAPQMLLQLGLAHAAHATARRPPADLIEP |
| Ga0335081_1003090310 | 3300032892 | Soil | VRAAIREELTLPGWPQMLLQLGLARSTHSTARRPPAELIDPW |
| Ga0335075_115149622 | 3300032896 | Soil | KERLALPGEPQMLLQLGVARTTRTTARRPPEELIEPWPRYRDT |
| Ga0335076_116799871 | 3300032955 | Soil | RALIRERLALPGTPQVLLQLGPAHTTHATARRPPADLIDP |
| Ga0370548_111766_2_133 | 3300034644 | Soil | AAIRALIRDRLALPGAPQMLLQLGLAHTTHVTARRSPADLIEP |
| ⦗Top⦘ |