Basic Information | |
---|---|
Family ID | F072560 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 121 |
Average Sequence Length | 42 residues |
Representative Sequence | MNTAGFIFAAILSAVIMFGTVMAAANAGMTQVATSSITTTL |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 121 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 46.28 % |
% of genes near scaffold ends (potentially truncated) | 16.53 % |
% of genes from short scaffolds (< 2000 bps) | 77.69 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.256 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.140 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.455 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (73.554 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 121 Family Scaffolds |
---|---|---|
PF00296 | Bac_luciferase | 22.31 |
PF00487 | FA_desaturase | 17.36 |
PF09286 | Pro-kuma_activ | 6.61 |
PF00202 | Aminotran_3 | 4.13 |
PF01741 | MscL | 4.13 |
PF02417 | Chromate_transp | 3.31 |
PF00248 | Aldo_ket_red | 1.65 |
PF00106 | adh_short | 0.83 |
PF12697 | Abhydrolase_6 | 0.83 |
PF02781 | G6PD_C | 0.83 |
PF02616 | SMC_ScpA | 0.83 |
PF02954 | HTH_8 | 0.83 |
PF01323 | DSBA | 0.83 |
PF00561 | Abhydrolase_1 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 22.31 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 17.36 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 17.36 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 6.61 |
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 4.13 |
COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 3.31 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.83 |
COG1354 | Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin family | Replication, recombination and repair [L] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.26 % |
Unclassified | root | N/A | 10.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10171392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1465 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100686051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
3300004080|Ga0062385_10015216 | All Organisms → cellular organisms → Bacteria | 2753 | Open in IMG/M |
3300004080|Ga0062385_10639928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300004091|Ga0062387_100244323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
3300004091|Ga0062387_100538281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
3300004091|Ga0062387_100581764 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300004092|Ga0062389_102705329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
3300004092|Ga0062389_104404656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
3300004152|Ga0062386_100085969 | All Organisms → cellular organisms → Bacteria | 2404 | Open in IMG/M |
3300005534|Ga0070735_10350382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
3300005538|Ga0070731_10007282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8639 | Open in IMG/M |
3300005538|Ga0070731_10403387 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300005538|Ga0070731_10447343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
3300005602|Ga0070762_10002298 | All Organisms → cellular organisms → Bacteria | 8989 | Open in IMG/M |
3300005602|Ga0070762_10287827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1032 | Open in IMG/M |
3300005610|Ga0070763_10185571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1103 | Open in IMG/M |
3300005712|Ga0070764_10373275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
3300005921|Ga0070766_10024988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3203 | Open in IMG/M |
3300005921|Ga0070766_10411575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
3300005921|Ga0070766_11013939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300006176|Ga0070765_100142454 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
3300009518|Ga0116128_1000027 | All Organisms → cellular organisms → Bacteria | 134287 | Open in IMG/M |
3300009521|Ga0116222_1175859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
3300009525|Ga0116220_10071813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1453 | Open in IMG/M |
3300009645|Ga0116106_1003179 | All Organisms → cellular organisms → Bacteria | 7211 | Open in IMG/M |
3300009645|Ga0116106_1169639 | Not Available | 696 | Open in IMG/M |
3300010048|Ga0126373_10218167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1859 | Open in IMG/M |
3300010048|Ga0126373_10254883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1729 | Open in IMG/M |
3300010339|Ga0074046_10522861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 707 | Open in IMG/M |
3300010341|Ga0074045_10022187 | All Organisms → cellular organisms → Bacteria | 4948 | Open in IMG/M |
3300010341|Ga0074045_10061378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2685 | Open in IMG/M |
3300010343|Ga0074044_10560279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
3300010379|Ga0136449_101012011 | Not Available | 1336 | Open in IMG/M |
3300010379|Ga0136449_103481173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300011120|Ga0150983_11585688 | Not Available | 851 | Open in IMG/M |
3300011120|Ga0150983_12841395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1354 | Open in IMG/M |
3300011120|Ga0150983_15365689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1248 | Open in IMG/M |
3300011120|Ga0150983_16293109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
3300011120|Ga0150983_16550212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 774 | Open in IMG/M |
3300012202|Ga0137363_10874779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
3300012924|Ga0137413_10596402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
3300014151|Ga0181539_1000003 | All Organisms → cellular organisms → Bacteria | 210784 | Open in IMG/M |
3300014155|Ga0181524_10079507 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
3300014159|Ga0181530_10037998 | All Organisms → cellular organisms → Bacteria | 3302 | Open in IMG/M |
3300014164|Ga0181532_10005679 | All Organisms → cellular organisms → Bacteria | 10535 | Open in IMG/M |
3300014501|Ga0182024_10714261 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300016750|Ga0181505_10009198 | Not Available | 772 | Open in IMG/M |
3300017823|Ga0187818_10043416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1931 | Open in IMG/M |
3300017925|Ga0187856_1006585 | All Organisms → cellular organisms → Bacteria | 7270 | Open in IMG/M |
3300017932|Ga0187814_10264247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300017946|Ga0187879_10001259 | All Organisms → cellular organisms → Bacteria | 17352 | Open in IMG/M |
3300017946|Ga0187879_10010552 | All Organisms → cellular organisms → Bacteria | 5914 | Open in IMG/M |
3300017955|Ga0187817_10014112 | All Organisms → cellular organisms → Bacteria | 4650 | Open in IMG/M |
3300018047|Ga0187859_10253243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
3300019190|Ga0184600_126386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
3300020579|Ga0210407_11123929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300020581|Ga0210399_11532068 | Not Available | 516 | Open in IMG/M |
3300020582|Ga0210395_10078258 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
3300020583|Ga0210401_10487269 | Not Available | 1096 | Open in IMG/M |
3300021170|Ga0210400_10614746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 896 | Open in IMG/M |
3300021180|Ga0210396_10743622 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300021181|Ga0210388_10272295 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300021181|Ga0210388_10292926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1429 | Open in IMG/M |
3300021181|Ga0210388_10455781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1123 | Open in IMG/M |
3300021181|Ga0210388_10581308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
3300021403|Ga0210397_10106423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1903 | Open in IMG/M |
3300021405|Ga0210387_10534390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1043 | Open in IMG/M |
3300021405|Ga0210387_11716208 | Not Available | 531 | Open in IMG/M |
3300021420|Ga0210394_10445560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
3300021420|Ga0210394_10559800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1005 | Open in IMG/M |
3300021432|Ga0210384_11486318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
3300021477|Ga0210398_11560929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
3300021478|Ga0210402_11879273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
3300021479|Ga0210410_10278002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1503 | Open in IMG/M |
3300021479|Ga0210410_11393115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
3300021559|Ga0210409_10746419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 851 | Open in IMG/M |
3300021560|Ga0126371_10003753 | All Organisms → cellular organisms → Bacteria | 13336 | Open in IMG/M |
3300022533|Ga0242662_10052302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
3300022711|Ga0242674_1007242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1091 | Open in IMG/M |
3300025507|Ga0208188_1068958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300027698|Ga0209446_1024821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1496 | Open in IMG/M |
3300027729|Ga0209248_10024888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1869 | Open in IMG/M |
3300027767|Ga0209655_10230724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300027795|Ga0209139_10252297 | Not Available | 623 | Open in IMG/M |
3300027824|Ga0209040_10029459 | All Organisms → cellular organisms → Bacteria | 3488 | Open in IMG/M |
3300027829|Ga0209773_10406224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300027829|Ga0209773_10471120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300027853|Ga0209274_10160615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1135 | Open in IMG/M |
3300027884|Ga0209275_10201128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
3300027884|Ga0209275_10336310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 844 | Open in IMG/M |
3300027884|Ga0209275_10499505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
3300027889|Ga0209380_10102057 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
3300027889|Ga0209380_10673409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300027908|Ga0209006_10301783 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
3300028906|Ga0308309_10057788 | All Organisms → cellular organisms → Bacteria | 2831 | Open in IMG/M |
3300029636|Ga0222749_10288406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300030577|Ga0210260_10220865 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300030730|Ga0307482_1139550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 698 | Open in IMG/M |
3300030741|Ga0265459_10006545 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
3300030741|Ga0265459_12461835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300030743|Ga0265461_13847771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
3300031057|Ga0170834_109909839 | Not Available | 533 | Open in IMG/M |
3300031057|Ga0170834_113744612 | Not Available | 558 | Open in IMG/M |
3300031708|Ga0310686_102316962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300031708|Ga0310686_109528785 | Not Available | 1457 | Open in IMG/M |
3300031708|Ga0310686_111770746 | All Organisms → cellular organisms → Bacteria | 5320 | Open in IMG/M |
3300031708|Ga0310686_114869158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1948 | Open in IMG/M |
3300031715|Ga0307476_11366526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
3300031718|Ga0307474_11081831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300031753|Ga0307477_10446539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 883 | Open in IMG/M |
3300031753|Ga0307477_10755237 | Not Available | 648 | Open in IMG/M |
3300031823|Ga0307478_10197206 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
3300031962|Ga0307479_11773251 | Not Available | 570 | Open in IMG/M |
3300032028|Ga0316052_113373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
3300032160|Ga0311301_10000545 | All Organisms → cellular organisms → Bacteria | 141627 | Open in IMG/M |
3300032160|Ga0311301_10012809 | All Organisms → cellular organisms → Bacteria | 25921 | Open in IMG/M |
3300032160|Ga0311301_10784576 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
3300032515|Ga0348332_10065305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 638 | Open in IMG/M |
3300032515|Ga0348332_12291101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2124 | Open in IMG/M |
3300033887|Ga0334790_000393 | All Organisms → cellular organisms → Bacteria | 42537 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.14% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 12.40% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 12.40% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.61% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.13% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.31% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.31% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.31% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 3.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.48% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.65% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.65% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.65% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.83% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030577 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032028 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_101713922 | 3300001593 | Forest Soil | MKTAGFIFAAVLCAAIMFGTVMAAANAGMMTRVASSSATTTL* |
JGIcombinedJ26739_1006860512 | 3300002245 | Forest Soil | MHMKTAGFVFAAILSAMIMFGTVVAAANAGMTRVTTSSHATTR* |
Ga0062385_100152164 | 3300004080 | Bog Forest Soil | MKTAGFIFAAALSAVIMFGTVLAAANAGMTQIAATSVAPTR* |
Ga0062385_106399282 | 3300004080 | Bog Forest Soil | MYMKTAGFIFAAVLCAAIMFGTVMAAANAGMMTRVASSSATTTL* |
Ga0062387_1002443232 | 3300004091 | Bog Forest Soil | MKTAGFIFAAILSAAIMFGTVMAAANAGMTQVASSSATTTL* |
Ga0062387_1005382812 | 3300004091 | Bog Forest Soil | MKTAGFIFAALLCAAIMFGTVMAVANAGMTQVATLSAVTTL* |
Ga0062387_1005817642 | 3300004091 | Bog Forest Soil | MYMKTAGFVFAAVLCAAIMFGTVMAAANAGMMTRVASSSAATTL* |
Ga0062389_1027053292 | 3300004092 | Bog Forest Soil | MNTAGFVFAAILSGLIMLGTVMAVANAGMTQVASSSIAQTL* |
Ga0062389_1044046561 | 3300004092 | Bog Forest Soil | MKTTGFIFAAFLTALVMFGTVMAVANAGMTQIASSSTSASL* |
Ga0062386_1000859693 | 3300004152 | Bog Forest Soil | MKTAGFFFAAILSAIIMFGTVMAVANAGMPQVAPSSRAATL* |
Ga0070735_103503822 | 3300005534 | Surface Soil | MKTAVFFFAAILSAVIMFGTVRAVANAGMNEIAPQSHAVAL* |
Ga0070731_100072822 | 3300005538 | Surface Soil | MKTAGFVFAAILSAAIMLGTVVAAANAGMPRVATSSSETIR* |
Ga0070731_104033873 | 3300005538 | Surface Soil | MKTTGFVLAAMLTAVIMFGTLVAESNAGMSGAVSTPAARAY* |
Ga0070731_104473432 | 3300005538 | Surface Soil | MKTAGFFFAAILSAVIMFGTVRAVANAGMNEVAPVSHAVTL* |
Ga0070762_1000229811 | 3300005602 | Soil | MNTAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTTL* |
Ga0070762_102878272 | 3300005602 | Soil | VRIPYQRMHMKTAGFFFAAILSAVIMFGTVRAVADAGMTRVASQTHAATL* |
Ga0070763_101855713 | 3300005610 | Soil | MRILIRGMHMKTAGFVFAAILSAMIMFGTVVAAANAGMPHLAPASRVTTL* |
Ga0070764_103732752 | 3300005712 | Soil | MYMNTAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTTL* |
Ga0070766_100249882 | 3300005921 | Soil | MNTAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTTP* |
Ga0070766_104115751 | 3300005921 | Soil | MHMKTAGFVFAAILSAMIMFGTVVAAANAGMPHLAPASHVTTL* |
Ga0070766_110139391 | 3300005921 | Soil | VRIPYQRMHMKTAGFFFAAILSAVIMFGTVRAVADAGMTRVAPVSHVTTL* |
Ga0070765_1001424544 | 3300006176 | Soil | MKTAGFVFAAILSAMIMFGTVVAAANAGMPHLAPASRVTTL* |
Ga0116128_100002764 | 3300009518 | Peatland | MKTAGFIFAAILCAVIMLGTVMAAANAGMTQIASSSIVTIL* |
Ga0116222_11758592 | 3300009521 | Peatlands Soil | MYMKTAGFIFAAILSAVIMFGTVMAVANAGMTEIASSSATATL* |
Ga0116220_100718132 | 3300009525 | Peatlands Soil | MYMKTAGFIFAAILSAVIMFGTIVAVANAGMTEIASSSATATL* |
Ga0116106_10031797 | 3300009645 | Peatland | MKTAGFIFTAILCAVIMLGTVMAAVNAGITQVASSSVVTTL* |
Ga0116106_11696392 | 3300009645 | Peatland | MHMKTAGFIFAAILSAVIMLGTVMAAANAGMAQTASSSIVKTL* |
Ga0126373_102181671 | 3300010048 | Tropical Forest Soil | MHMNTAGFIFAAILCAAIMFGTVVAAANAGMTPVVTSSSSTTR* |
Ga0126373_102548833 | 3300010048 | Tropical Forest Soil | MHMNTAGFIFAAILCAAIMFGTVVAAANAGMTQVVTSSSSTTR* |
Ga0074046_105228612 | 3300010339 | Bog Forest Soil | MYMNTAGFIFAAILSAVIMFGTVMAVANAGMTQIATSSITTTL* |
Ga0074045_100221875 | 3300010341 | Bog Forest Soil | MYMNTAGFIFAAILSVVIMFGTVMAVANAGMTQIATSSITTTL* |
Ga0074045_100613783 | 3300010341 | Bog Forest Soil | MKTAGFIFAAILSAVIMFGTVMAAANAGMTQIASSSTVTTL* |
Ga0074044_105602791 | 3300010343 | Bog Forest Soil | TAGFIFAALLCAAIMFGTVMAVANAGMTQVATLSAVTTL* |
Ga0136449_1010120112 | 3300010379 | Peatlands Soil | MNMKTAGFIFAAILCAAVMLGTVMAAANAGMAQIASSSVVTTL* |
Ga0136449_1034811732 | 3300010379 | Peatlands Soil | MHMKTAGFVFAAILSAVIMFGTVMAAANAGMAAGASSSVVTTR* |
Ga0150983_115856881 | 3300011120 | Forest Soil | MKTTGFVLAAMLTAVIMFGTLVAESNAGMSGAVSSSAAKAH* |
Ga0150983_128413952 | 3300011120 | Forest Soil | MYMNTAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTTP* |
Ga0150983_153656892 | 3300011120 | Forest Soil | MYMNTAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTIL* |
Ga0150983_162931091 | 3300011120 | Forest Soil | MHMKTAGFVFAAILSVAIMFGTVMAVANAGMTHVVPASVVTTL* |
Ga0150983_165502122 | 3300011120 | Forest Soil | MRIPERGMHMNTAGFVFAAILSAAIMFGTVIAAANAGMTHVATSSVVTNL* |
Ga0137363_108747792 | 3300012202 | Vadose Zone Soil | MHMKTAGFVFAAILSAAIMFGTVVAAANAGMSRVAPASVVTIL* |
Ga0137413_105964021 | 3300012924 | Vadose Zone Soil | MHMKTTGFVFAAILSAVIMFGTVMAVANAGMPQSVSSSHA |
Ga0181539_100000311 | 3300014151 | Bog | MKTAGFIFASILCAVIMLGTVMAAANAGMNQIPPSSVVTTL* |
Ga0181524_100795073 | 3300014155 | Bog | VFLVRGMHMKTAGFIFAAILCAVIMLGTVMAAANAGMTQIASSSIVTIL* |
Ga0181530_100379981 | 3300014159 | Bog | MKTAGFIFTAILCAAVMLGTVMAAANAGMSQVASSSVVTTL* |
Ga0181532_100056796 | 3300014164 | Bog | MKTAGFIFTAILCAAVMLGTVMAAANAGITQVASSSVVTTL* |
Ga0182024_107142612 | 3300014501 | Permafrost | MHMKTAGFFFAAILSAVIMFGTVMAVANAGMTQVTTSHSVSL* |
Ga0181505_100091981 | 3300016750 | Peatland | TAGFIFTAILCAAVMLGTVMAAANAGITQVASSSVVTTL |
Ga0187818_100434162 | 3300017823 | Freshwater Sediment | MYMKTAGFIFAAILSAVIMFGTVMAVANAGMTEIASSSATATL |
Ga0187856_10065853 | 3300017925 | Peatland | MKTAGFIFAAILCAVIMLGTVMAAANAGMTQIASSSIVTIL |
Ga0187814_102642472 | 3300017932 | Freshwater Sediment | MYMKTDGFIFAAILSAVIMFGTVMAVANAGMTEIASSSATATL |
Ga0187879_100012599 | 3300017946 | Peatland | MKTAGFIFAAILSAVIMLGTVMAAANAGMAQTASSSIVKTL |
Ga0187879_100105524 | 3300017946 | Peatland | MKTAGFIFTAILCAVIMLGTVMAAVNAGITQVASSSVVTTL |
Ga0187817_100141122 | 3300017955 | Freshwater Sediment | MYVKTAGFIFAAILSAVIMFGTVMAVANAGMTEIASSSATATL |
Ga0187859_102532432 | 3300018047 | Peatland | MHMKTAGFIFAAILSAVIMLGTVMAAANAGMAQTASSSIVKTL |
Ga0184600_1263861 | 3300019190 | Soil | AGFIFAAILSAVIMFGTVMAVANAGMTQVATSSITTTL |
Ga0210407_111239292 | 3300020579 | Soil | MHMKTAGFFFAAILSAVIMFGTVMAAANAGMTTQVAAPHAVRL |
Ga0210399_115320682 | 3300020581 | Soil | MNTAGFIFAAVLSAFIMLGTVMAAANAGMTHVVASSAIVTR |
Ga0210395_100782582 | 3300020582 | Soil | MNTAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTTL |
Ga0210401_104872692 | 3300020583 | Soil | MKTAGFVFAAILSAFIMLGTVMAAGNAGMTSVATSSTVKSR |
Ga0210400_106147461 | 3300021170 | Soil | MHMKTAGFVFAAILSAMIMFGTVVAAANAGMPHVTTSSQASTL |
Ga0210396_107436222 | 3300021180 | Soil | MHMKTAGFVFAAILSAMIMFGTVVAAANAGMPHVTTSSHASTL |
Ga0210388_102722952 | 3300021181 | Soil | MNTAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTTP |
Ga0210388_102929262 | 3300021181 | Soil | MNTAGFIFAAILSAVIMFGTVMAAANAGMTQVATSSITTTL |
Ga0210388_104557812 | 3300021181 | Soil | MYMNTAGFIFAAIISGVIMFGTVMAAANAGMTQVATSSITTTL |
Ga0210388_105813082 | 3300021181 | Soil | MYMNTAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTTL |
Ga0210397_101064232 | 3300021403 | Soil | MHMKTAGFVFAAILSAMIMFGTVVAAANAGIPHVATASRATTL |
Ga0210387_105343902 | 3300021405 | Soil | MNTAGFIFAAIISGVIMFGTVMAAANAGMTQVATSSITTTL |
Ga0210387_117162082 | 3300021405 | Soil | MKTAGFVFAAILSAAIMFGTVVAVANAGMSRVAPVSVVTTL |
Ga0210394_104455602 | 3300021420 | Soil | MHMNTAGFVFAVILSAAIMFGTVIAAANAGMTHVATSLS |
Ga0210394_105598001 | 3300021420 | Soil | MNTAGFIFAAILSAVIMFGTVMAVANAGMTQVATSSITTTL |
Ga0210384_114863182 | 3300021432 | Soil | VFLIRGMHMKTAGFVFAAILSAMIMFGTVVAAANAGIPHVATASRATTL |
Ga0210398_115609292 | 3300021477 | Soil | MYMNTAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTTP |
Ga0210402_118792731 | 3300021478 | Soil | AVPSCVFLVRGMHMNTAGFVFAAILSAIIMFGTVVAAANAGMGHVTTTSSAATL |
Ga0210410_102780022 | 3300021479 | Soil | MKTAGFFFAAILSAVIMFGTVMAVANAGMNEVAPQSHAVTL |
Ga0210410_113931152 | 3300021479 | Soil | VRIPFYRGTHMNTAGFIFAAVLSAVIMLGTVMAAANAGMTHVAASSSVARL |
Ga0210409_107464192 | 3300021559 | Soil | MHMKTAGFFFAAILSAVIMFGTVMAVANAGMNEVAPISHAVTL |
Ga0126371_1000375313 | 3300021560 | Tropical Forest Soil | MNTAGFIFAAILCAAIMFGTVVAAANAGMTPVVTSSSSTTR |
Ga0242662_100523023 | 3300022533 | Soil | MKTAGFVFAAILSVAIMFGTIMAVANAGMTHVVPASVVTAL |
Ga0242674_10072422 | 3300022711 | Soil | NTAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTTL |
Ga0208188_10689582 | 3300025507 | Peatland | MKTAGFIFTAILCAVIMLGTVMAAVNAGITQVASSSV |
Ga0209446_10248212 | 3300027698 | Bog Forest Soil | MNTAGFIFAAILSAVIMFGTVMAVANAGMTQIATSSITTTL |
Ga0209248_100248883 | 3300027729 | Bog Forest Soil | MKTAGFIFAALLCAAIMFGTVMAVANAGMTQVATSSAVTTL |
Ga0209655_102307241 | 3300027767 | Bog Forest Soil | MYMNTAGFIFAAILSAVIMFGTVMAVANAGMTQIATSSITTTL |
Ga0209139_102522972 | 3300027795 | Bog Forest Soil | MKTAGFIFAAILSAAIMFGTVMAAANAGMTQVASSSATTTL |
Ga0209040_100294592 | 3300027824 | Bog Forest Soil | MNTAGFIFAAILSAVIMFGTVMAAANAGMTQVARSSITTTL |
Ga0209773_104062241 | 3300027829 | Bog Forest Soil | TAGFIFAALLCAAIMFGTVMAVANAGMTQVATLSAVTTL |
Ga0209773_104711202 | 3300027829 | Bog Forest Soil | MHMNTAGFIVAAILSAVIMFGTVMAVANAGMTQVATSSITTTL |
Ga0209274_101606152 | 3300027853 | Soil | TAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTTL |
Ga0209275_102011281 | 3300027884 | Soil | MNTAGFIFAAIISAVIMFGTVMAAANAGMTQVATSSI |
Ga0209275_103363102 | 3300027884 | Soil | MHMKTAGFFFAAILSAVIMFGTVRAVADAGMTRVASQTHAATL |
Ga0209275_104995052 | 3300027884 | Soil | MHMKTAGFVFAAILSAMIMFGTVVAAANAGMSHLAPASRVTTL |
Ga0209380_101020572 | 3300027889 | Soil | MKTAGFFFAAILSAVIMFGTVRAVADAGMTRVASQTHAATL |
Ga0209380_106734091 | 3300027889 | Soil | MHMKTAGFVFAAILSAMIMFGTVVAAANAGMPHLAPASHVTTL |
Ga0209006_103017832 | 3300027908 | Forest Soil | MHMKTAGFFFAAILSAAIMFGTVMAVANAGMTQVTTSHSVSL |
Ga0308309_100577882 | 3300028906 | Soil | MKTAGFVFAAILSAMIMFGTVVAAANAGMPHLAPASRVTTL |
Ga0222749_102884062 | 3300029636 | Soil | MKTAGFFFAAILSAVIMFGTVMAVANAGMNEVAPVS |
Ga0210260_102208652 | 3300030577 | Soil | FIFAAILSAVIMLGTVVAVANSGMTAGAMPSHVVATS |
Ga0307482_11395501 | 3300030730 | Hardwood Forest Soil | MKTAGFFFAAILSAVIMFGTVMAAANAGMTSQVAAPHAVEL |
Ga0265459_100065455 | 3300030741 | Soil | GKYMNTAGFIFAAILSAVIMFGTVMAVANAGMTQVATSSITTTL |
Ga0265459_124618352 | 3300030741 | Soil | MYMNTAGFIFAAILSAVIMFGTVMAVANAGMTQVATSSITTTL |
Ga0265461_138477712 | 3300030743 | Soil | AGFIFAAILSAVIMFGTVMAAANAGMTQVATSSITTTL |
Ga0170834_1099098391 | 3300031057 | Forest Soil | MHMNTAGFFFAAILSAVIMFGTVRAVADAGMTRIAPQSHVTTL |
Ga0170834_1137446122 | 3300031057 | Forest Soil | MKTAGFVFAAILSAVIMFGTVMAATNAGMTRVAPVAHATTR |
Ga0310686_1023169621 | 3300031708 | Soil | MHMKTAGFVFAAILSAMIMFGTVVAAANAGMPHLAPASRVTTL |
Ga0310686_1095287852 | 3300031708 | Soil | MHMKTAGFVFAAILSAFIMLGTVMAAGNAGMTQVATSSTLKSR |
Ga0310686_1117707465 | 3300031708 | Soil | MNTAGFIFAAILSAVIMLGTVMAAANAGMTQVASSSSATTL |
Ga0310686_1148691582 | 3300031708 | Soil | MHMKTAGFFFAAILSAVIMFGTVRAVADAGMTRVAPVSHVTTL |
Ga0307476_113665261 | 3300031715 | Hardwood Forest Soil | AGFVFAAILSAMIMFGTVVAAANAGMPHVTTSSHASTL |
Ga0307474_110818312 | 3300031718 | Hardwood Forest Soil | MHMKTAGFFFAAILSAVIMFGTVMAAANAGMTSQVAAPHAVEL |
Ga0307477_104465391 | 3300031753 | Hardwood Forest Soil | MQMKTAGFFFAAILSAVIMFGTVRAVADAGMTRIAPQSHAVTL |
Ga0307477_107552372 | 3300031753 | Hardwood Forest Soil | MQMKTAGFIFAAILSAVIMFGTVMAAANAGMTRVAPVSRVPTL |
Ga0307478_101972062 | 3300031823 | Hardwood Forest Soil | MHMKTAGFFFAAILSAVIMFSTVMAAANAGMTTQVAAPHVVEL |
Ga0307479_117732512 | 3300031962 | Hardwood Forest Soil | MHMKTAGFFFAAILSAAIMFSTVMAVANAGMTRIAPVSHAVTL |
Ga0316052_1133731 | 3300032028 | Soil | AGFIFAAIISAVIMFGTVMAAANAGMTQVATSSITTTP |
Ga0311301_10000545140 | 3300032160 | Peatlands Soil | MKTAGFIFAAILSAVIMFGTVMAVANAGMTEIASSSATATL |
Ga0311301_1001280918 | 3300032160 | Peatlands Soil | MRTAGFIFAAILTGLIMFGTVMAAANAGMTRVASSSASTTL |
Ga0311301_107845762 | 3300032160 | Peatlands Soil | MNMKTAGFIFAAILCAAVMLGTVMAAANAGMTQIASSSVVTTL |
Ga0348332_100653051 | 3300032515 | Plant Litter | MNTAGFVFAAILSAVIMFGTVIAAANAGMGRVTPSVVTTL |
Ga0348332_122911012 | 3300032515 | Plant Litter | MKTAGFIFAAILSAVIMLGTVVAVANSGMTANTTPSHVVATS |
Ga0334790_000393_10410_10541 | 3300033887 | Soil | MHMKTAGFIFTAILCAAVMLGTVMAAANAGMTQIASSSVVTTL |
⦗Top⦘ |