| Basic Information | |
|---|---|
| Family ID | F072542 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ELTSGEKCWVCCQATIVRVEEEGSEFGVAAQIRRMDILPEVTV |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.48 % |
| % of genes near scaffold ends (potentially truncated) | 97.52 % |
| % of genes from short scaffolds (< 2000 bps) | 92.56 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.347 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.223 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.967 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.63% β-sheet: 32.39% Coil/Unstructured: 61.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 2.48 |
| PF00122 | E1-E2_ATPase | 1.65 |
| PF16153 | DUF4861 | 1.65 |
| PF13620 | CarboxypepD_reg | 0.83 |
| PF13548 | DUF4126 | 0.83 |
| PF00012 | HSP70 | 0.83 |
| PF05235 | CHAD | 0.83 |
| PF04956 | TrbC | 0.83 |
| PF08546 | ApbA_C | 0.83 |
| PF12704 | MacB_PCD | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.65 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 1.65 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.65 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.83 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.83 |
| COG3838 | Type IV secretory pathway, VirB2 component (pilin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.83 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.35 % |
| Unclassified | root | N/A | 1.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10106473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300004080|Ga0062385_10530275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300004635|Ga0062388_100950166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300005167|Ga0066672_10354216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300005436|Ga0070713_102280729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300005458|Ga0070681_10182366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2021 | Open in IMG/M |
| 3300005530|Ga0070679_100668034 | Not Available | 982 | Open in IMG/M |
| 3300005534|Ga0070735_10887111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300005542|Ga0070732_10550536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300005591|Ga0070761_10439183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300005607|Ga0070740_10209575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300005995|Ga0066790_10291134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300006052|Ga0075029_100350185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300006059|Ga0075017_101260055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300006086|Ga0075019_10725306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300006162|Ga0075030_100854621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300006176|Ga0070765_101362441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300006914|Ga0075436_101225068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300009639|Ga0116122_1222336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300009665|Ga0116135_1357432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300009672|Ga0116215_1152043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300009683|Ga0116224_10235842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300009759|Ga0116101_1150427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300010046|Ga0126384_11547865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300010366|Ga0126379_10472315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1320 | Open in IMG/M |
| 3300010366|Ga0126379_13517164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300010376|Ga0126381_103091931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300010376|Ga0126381_104429460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300010379|Ga0136449_104688667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300010398|Ga0126383_13679223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300010880|Ga0126350_11993377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300012203|Ga0137399_10808832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300012354|Ga0137366_10803196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300012361|Ga0137360_10679669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300012361|Ga0137360_11133230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300012971|Ga0126369_13141231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300012988|Ga0164306_10495994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300014156|Ga0181518_10217447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300014501|Ga0182024_10305774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2099 | Open in IMG/M |
| 3300014654|Ga0181525_10364743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300014654|Ga0181525_10791503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300015373|Ga0132257_103595145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300017924|Ga0187820_1258653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300017934|Ga0187803_10320150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300017942|Ga0187808_10059799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1623 | Open in IMG/M |
| 3300017943|Ga0187819_10109475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1650 | Open in IMG/M |
| 3300017961|Ga0187778_10480987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300017970|Ga0187783_10417463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300017970|Ga0187783_10508840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300017973|Ga0187780_10994327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300017975|Ga0187782_10280398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1256 | Open in IMG/M |
| 3300018006|Ga0187804_10588035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300018024|Ga0187881_10463355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300018026|Ga0187857_10432998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300018034|Ga0187863_10536353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300018038|Ga0187855_10021460 | All Organisms → cellular organisms → Bacteria | 4214 | Open in IMG/M |
| 3300018038|Ga0187855_10543339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300018042|Ga0187871_10013735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5426 | Open in IMG/M |
| 3300018042|Ga0187871_10183916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1172 | Open in IMG/M |
| 3300018062|Ga0187784_10439410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300018062|Ga0187784_10955633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300019786|Ga0182025_1276043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2049 | Open in IMG/M |
| 3300021170|Ga0210400_11664211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300021171|Ga0210405_10921425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300021171|Ga0210405_11283464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300021180|Ga0210396_11053157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300021401|Ga0210393_11281046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300021403|Ga0210397_10190506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
| 3300021406|Ga0210386_10178703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1788 | Open in IMG/M |
| 3300021406|Ga0210386_10796314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300021406|Ga0210386_10955301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300021407|Ga0210383_10215842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1642 | Open in IMG/M |
| 3300021407|Ga0210383_10861715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300021420|Ga0210394_11861183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300021478|Ga0210402_10288816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1517 | Open in IMG/M |
| 3300021479|Ga0210410_10936721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300021560|Ga0126371_10706216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300021860|Ga0213851_1740117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300025916|Ga0207663_11058173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300025921|Ga0207652_10745581 | Not Available | 872 | Open in IMG/M |
| 3300025929|Ga0207664_11503612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300027629|Ga0209422_1104106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300027662|Ga0208565_1223373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300027729|Ga0209248_10137074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300027745|Ga0209908_10041839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300027821|Ga0209811_10437183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300027825|Ga0209039_10109445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300027842|Ga0209580_10425567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300027853|Ga0209274_10368106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300027879|Ga0209169_10686967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300027895|Ga0209624_10421284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300027898|Ga0209067_10559715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300027905|Ga0209415_11129889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300027908|Ga0209006_10508736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300028906|Ga0308309_10201277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1641 | Open in IMG/M |
| 3300028906|Ga0308309_10536212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300028906|Ga0308309_11571534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300029636|Ga0222749_10091808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1413 | Open in IMG/M |
| 3300029952|Ga0311346_10653810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300029999|Ga0311339_10948664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300030057|Ga0302176_10071256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
| 3300030058|Ga0302179_10019092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3347 | Open in IMG/M |
| 3300030058|Ga0302179_10121477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300030509|Ga0302183_10169312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300030509|Ga0302183_10258504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300030518|Ga0302275_10259613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300030760|Ga0265762_1143928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300030879|Ga0265765_1003550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1569 | Open in IMG/M |
| 3300031233|Ga0302307_10003944 | All Organisms → cellular organisms → Bacteria | 8949 | Open in IMG/M |
| 3300031708|Ga0310686_113257267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300031708|Ga0310686_114377043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300031708|Ga0310686_116431662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300031720|Ga0307469_11023196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300031740|Ga0307468_100954033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300031962|Ga0307479_11183977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300032828|Ga0335080_10017422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7704 | Open in IMG/M |
| 3300032829|Ga0335070_11905883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300032954|Ga0335083_10055057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4175 | Open in IMG/M |
| 3300033158|Ga0335077_12067273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300033290|Ga0318519_11056384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300034125|Ga0370484_0083839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.79% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.13% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.13% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.13% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.31% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.48% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.48% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.65% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.83% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101064731 | 3300000567 | Peatlands Soil | ELTSGEKCWVCCQATIVRVEEEGSEFGVAAQIRRMDILPEVTV* |
| Ga0062385_105302751 | 3300004080 | Bog Forest Soil | ELTDGQKCWVCCQATIVRAEQVGSEFGVAAKIKRMDILPEAAI* |
| Ga0062388_1009501662 | 3300004635 | Bog Forest Soil | ELTSGEKCWVCCHATIVRVEEQGSEFGVAAQISRMDILPELTV* |
| Ga0066672_103542163 | 3300005167 | Soil | PELTSGEKCWVCCHARVLRVEQGPGKDFGVAAEIRRMDILPEIPA* |
| Ga0070713_1022807291 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LILPPELTSGEKCWVCCQATIVRVEEEGTEFGVAAKINRMDILPEVTA* |
| Ga0070681_101823661 | 3300005458 | Corn Rhizosphere | PELTSGEKCWVCCQATVVRVEDEGSEFGVAAQIRRMDILPELGI* |
| Ga0070679_1006680342 | 3300005530 | Corn Rhizosphere | VLILPPELTSGEKCWVCCQATVVRVEDQGTEFGVAAQIRRMDILPEIGI* |
| Ga0070735_108871111 | 3300005534 | Surface Soil | LPPELTSGEKCWVCCQATIVRVEEKGSDYGVAAQIRRMDILPELAV* |
| Ga0070732_105505361 | 3300005542 | Surface Soil | EKCWVCCQATVVRVEDGPQFGVAAQIRRMDILPEVAV* |
| Ga0070761_104391831 | 3300005591 | Soil | LTSGEKYWVCCHARVLRVEQGPGTDFGVAAEIRRMDILPEIPA* |
| Ga0070740_102095751 | 3300005607 | Surface Soil | EMTSGEKCWVCCQATIVRVEEGPQFGVAAQIRRMDILPEVSV* |
| Ga0066790_102911341 | 3300005995 | Soil | PELTSGEKRWVCCQATVVRVEDNAEGNIHGVAAEIRDMQFLPELVG* |
| Ga0075029_1003501851 | 3300006052 | Watersheds | PELTSGEKCWVCCQATIVRVEEQGSDFGVAAQIRRMDILPEVAV* |
| Ga0075017_1012600551 | 3300006059 | Watersheds | GEKCWVCCQATIVRVEEEGSEFGVAAQIRRMDILPEISV* |
| Ga0075019_107253061 | 3300006086 | Watersheds | PPELTSGEKCWVCCQATIVRVEEEGPEFGVAAQIRRMDILPEAAV* |
| Ga0075030_1008546211 | 3300006162 | Watersheds | LILPPELTSGEKCWVCCQATIVRVEEEGNEFGVAAQIRRMDIMPEVTV* |
| Ga0070765_1013624411 | 3300006176 | Soil | GQKCWVCCQATIVRAEQVGSEFGVAAKIQRMDILPEAAI* |
| Ga0075436_1012250682 | 3300006914 | Populus Rhizosphere | LVLILPPELTSGEKCWVCCQATVVRVEDGPQFGVAAQIRRMDILPEAAV* |
| Ga0116122_12223361 | 3300009639 | Peatland | KCWVCCQATIVRVEEEGKEFGVAAQIRRMDILPEVTV* |
| Ga0116135_13574322 | 3300009665 | Peatland | DGQKCWVCCQATIVRAEQVGSEFGVAAKIKRMDVLPEAAI* |
| Ga0116215_11520431 | 3300009672 | Peatlands Soil | KCWVCCQATIVRVEEEGKEFGVAAQIRRMDILPEATA* |
| Ga0116224_102358423 | 3300009683 | Peatlands Soil | EKCWVCCQATIVRVEEEGSEFGVAAQIRRMDILPEVTV* |
| Ga0116101_11504271 | 3300009759 | Peatland | GEKCWVCCHARVLRVEQGSGTDFGVAAEILRMDMLPEIPI* |
| Ga0126384_115478652 | 3300010046 | Tropical Forest Soil | ILLLELTFGEKCWVCCQATIVWVEEQGKDWGVAAQIRRMDILLEMAV* |
| Ga0126379_104723153 | 3300010366 | Tropical Forest Soil | VLILPPELTSGEKCWVCCQATVVRVEEKGSDYGVAAQIRRMDILPEVAV* |
| Ga0126379_135171642 | 3300010366 | Tropical Forest Soil | GEKCWVCCQAKVVRVEESGQEFGVAAQIQRMDLMPEMTI* |
| Ga0126381_1030919312 | 3300010376 | Tropical Forest Soil | VLILPPELTSGERCWVCCQATVVRVEEGPEFGVAAQIRRMDILPEAAV* |
| Ga0126381_1044294601 | 3300010376 | Tropical Forest Soil | LTSGEKCWVCCQATVVRVEEKGSDYGVAAQIRRMDILPELTV* |
| Ga0136449_1046886672 | 3300010379 | Peatlands Soil | CWVCCQATIVRVEEDGTEFGVAAQIRRMDILPEVTA* |
| Ga0126383_136792231 | 3300010398 | Tropical Forest Soil | TSGEKCWVCCQATIVRVEEKGSDYGVAAQIRRMDILPELAV* |
| Ga0126350_119933772 | 3300010880 | Boreal Forest Soil | ELTSGEKCWVCCHARVLRVEQGPGKDFGVAAEIQRMDILPEIPA* |
| Ga0137399_108088322 | 3300012203 | Vadose Zone Soil | VMLLPAELTGEKCWVCCHATVVRVEKSSGPRFGVAAAIKKMDFLPEVGL* |
| Ga0137366_108031962 | 3300012354 | Vadose Zone Soil | GEKCWVCCQATIVRVEEDGSEFGVAAQIRRMDILPEATI* |
| Ga0137360_106796691 | 3300012361 | Vadose Zone Soil | LTGEKCWVCCHATVVRVEESPGPRFGVAAAIKKMDFLPEIGL* |
| Ga0137360_111332302 | 3300012361 | Vadose Zone Soil | PPELTSGEKCWVCCHARVLRVEQGPGKDFGVAAEIRRMDILPEIPA* |
| Ga0126369_131412312 | 3300012971 | Tropical Forest Soil | GEKCWVCCQATIVRVEDQGSNFGVAAQIRRMDILPEVTI* |
| Ga0164306_104959941 | 3300012988 | Soil | PPELTSGEKCWVCCQATIVRVEEKGSDFGVAAQIRRMDILPEVAV* |
| Ga0181518_102174471 | 3300014156 | Bog | ELTSGEKCWVCCQATIVRVEEQGKDFGVAAQIRRMDILPEVTI* |
| Ga0182024_103057741 | 3300014501 | Permafrost | GEKCWVCCQATIVRVEEEGSEFGVAAQIRRIDILPEVAI* |
| Ga0181525_103647432 | 3300014654 | Bog | LILPPELTDGQKCWVCCQATIVRAEQVGSEFGVAATIKRMDILPEAAI* |
| Ga0181525_107915032 | 3300014654 | Bog | LTSGEKCWVCCHARVLRVERGSGKDFGVAAEIQRMDVLPEITDLK* |
| Ga0132257_1035951452 | 3300015373 | Arabidopsis Rhizosphere | ILPPELTAGEKCWVCCQATIVRVEEKGTDFGVAAQIRRMDLLPEAII* |
| Ga0187820_12586532 | 3300017924 | Freshwater Sediment | PELTSGQKYWVCCQATIVRVEEGPEFGVAAQIRRMDILPEVTA |
| Ga0187803_103201501 | 3300017934 | Freshwater Sediment | LTSGEKCWVCCQATIVRVEEGPEFGVAAQIRRMDILPEATV |
| Ga0187808_100597993 | 3300017942 | Freshwater Sediment | LILPPELTSGEKCWVCCQATIVRVEEEGSEFGVAAQIRRMDLLPEATV |
| Ga0187819_101094751 | 3300017943 | Freshwater Sediment | LVLILPPELTSGEKCWVCCQATIVRVEEKGSDFGVAAQIRRMDILPEVTI |
| Ga0187778_104809871 | 3300017961 | Tropical Peatland | YWVCCQATIVRVEEEGSEFGVAAQIRRMDILPEVAV |
| Ga0187783_104174631 | 3300017970 | Tropical Peatland | TSGEKCWVCCQATIIRVEENGSDFGVAAQIRRMDILPEVAV |
| Ga0187783_105088403 | 3300017970 | Tropical Peatland | LPPEITAGEKCWVCCHARVLRVEGAGQDFGVASEIRRMDILPEIPA |
| Ga0187780_109943272 | 3300017973 | Tropical Peatland | WVCCQATIVRVEEEGSEFGVAAQIRRMDIMPEVTV |
| Ga0187782_102803981 | 3300017975 | Tropical Peatland | KCWVCCQETVVRVEEDGSEFGVAAQIRRMDILPEVSA |
| Ga0187804_105880352 | 3300018006 | Freshwater Sediment | GEKCWVCCQATIVRVEEQGKDFGVAAQIRRMDILPEVTI |
| Ga0187881_104633552 | 3300018024 | Peatland | TSGEKCWVCCHARVLRVERGSGKDFGVAAEIQRMDVLPEITDLK |
| Ga0187857_104329982 | 3300018026 | Peatland | SGEKCWVCCQATIVRVEEQGKDFGVAAQIRRMDIMPEVTI |
| Ga0187863_105363532 | 3300018034 | Peatland | VCCHARVLRVERGTGREFGVAAEIRRMDILPEIPV |
| Ga0187855_100214601 | 3300018038 | Peatland | ILPPEITLGEKCWVCCHARVLRVEPGAGQAFGVAAEIRRIEVLPELAG |
| Ga0187855_105433391 | 3300018038 | Peatland | PELTAGQKCWVCCQATIVRAEQVGSEFGVAAKIKRMDVLPEAAI |
| Ga0187871_100137358 | 3300018042 | Peatland | CWVCCQATIVRVEEEGSEFGVAAQIRRMDILPEVTA |
| Ga0187871_101839163 | 3300018042 | Peatland | PELTGGKKCWVCCHARILRVERAPGERFGVAAEIQRMNFLPEISA |
| Ga0187784_104394104 | 3300018062 | Tropical Peatland | CWVCCQATVVRVEEEGNEFGVAAQIRRMDILPEVAI |
| Ga0187784_109556331 | 3300018062 | Tropical Peatland | ELTSGEKCWVCCQATVVRVEEEGSEFGVAAQIRRMDILPEATV |
| Ga0182025_12760434 | 3300019786 | Permafrost | VCCHARVLRVEQGPGKDFGVAAEIRRIDILPEIPVSS |
| Ga0210400_116642112 | 3300021170 | Soil | AGEKCWVCCQATIVRVEEEGDEFGIAAKIQRMDIMPEAI |
| Ga0210405_109214251 | 3300021171 | Soil | LPPELTSGEKCWVCCQATIVRVEEEGTEFGVAAQIRRMDILPELAI |
| Ga0210405_112834642 | 3300021171 | Soil | ELTSGEKCWVCCQATIVRVEEQGSDFGVAAQIRRMDILPEMAV |
| Ga0210396_110531571 | 3300021180 | Soil | KCWVCCHARVLRVEQGPGNDFGVAAAIQRMDILPEIPA |
| Ga0210393_112810461 | 3300021401 | Soil | ELTSGEKCWVCCHARIVRVEAGLGKEFGVAAEIQRMDILPEIPA |
| Ga0210397_101905061 | 3300021403 | Soil | KCWVCCHARVLRVEQGPGKDFGVAAEIRRMDILPEIPA |
| Ga0210386_101787031 | 3300021406 | Soil | LILPPELTAGEKCWVCCHAQVVRVEQGPGNDFGVAAQIQRMNILPEIPN |
| Ga0210386_107963141 | 3300021406 | Soil | PPELTSGEKCWVCCHARVLRVEQGPGKDFGVAAEIRRMDILPEIPA |
| Ga0210386_109553012 | 3300021406 | Soil | LTSGEKCWVCCHARIVRVEAGLGKEFGVAAEIQRMDILPEIPA |
| Ga0210383_102158421 | 3300021407 | Soil | KCWVCCQATIVRVEEEGSEFGVAAQIRHMDILPELTV |
| Ga0210383_108617151 | 3300021407 | Soil | ILPPELTSGEKCWVCCQATIVRVEEEGTEFGVAAQIRRMDILPELAI |
| Ga0210394_118611832 | 3300021420 | Soil | TSGEKCWVCCQATIVRVEEEGSEFGVAAQIRRIDILPEVAI |
| Ga0210402_102888164 | 3300021478 | Soil | CWVCCQATIVRAEQVGSEFGVAAKIQRIDILPEAAI |
| Ga0210410_109367211 | 3300021479 | Soil | WVCCHATVVRVEESSGPRLGVAAAIKKMDFLPEISL |
| Ga0126371_107062163 | 3300021560 | Tropical Forest Soil | ILPPELTSGERCWVCCQATVVRVEEGPEFGVAAQIRRMDILPEAAV |
| Ga0213851_17401172 | 3300021860 | Watersheds | WVCCQATIVRVEEQGSDFGVAAQIRRMDILPEATV |
| Ga0207663_110581731 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | KCWVCCQATVVRVEEKGSDYGVAAQIRRMDILPELAV |
| Ga0207652_107455811 | 3300025921 | Corn Rhizosphere | LILPPELTSGEKCWVCCQATVVRVEDQGTEFGVAAQIRRMDILPEIGI |
| Ga0207664_115036121 | 3300025929 | Agricultural Soil | VLILPPELTSGEKCWVCCQATIVRVEEKGSDFGVAAQIRRMDILPEMAV |
| Ga0209422_11041061 | 3300027629 | Forest Soil | GEKCWVCCQATIVRVEEEGTEFGVAAQIRRMDILPELAI |
| Ga0208565_12233732 | 3300027662 | Peatlands Soil | KCWVCCQATIVRVEEEGKEFGVAAQIRRMDILPEATA |
| Ga0209248_101370741 | 3300027729 | Bog Forest Soil | ELTDGQKCWVCCQATIVRAEQVGSEFGVAAKIKRMDILPEAAI |
| Ga0209908_100418393 | 3300027745 | Thawing Permafrost | EKCWVCCQATIVRVEEEGSEFGVAAQIRRIDILPEVAI |
| Ga0209811_104371831 | 3300027821 | Surface Soil | GEKCWVCCQATIVRVEEKGTDYGVAAQIRRMDILPELAV |
| Ga0209039_101094451 | 3300027825 | Bog Forest Soil | PELTSGEKCWVCCHARVLRVEQGPGKDFGVAAEIRRMDILPEIPA |
| Ga0209580_104255671 | 3300027842 | Surface Soil | PPELTSGEKCWVCCQATVVRVEDGPQFGVAAQIRRMDILPEVAV |
| Ga0209274_103681062 | 3300027853 | Soil | LTSGEKYWVCCHARVLRVEQGPGTDFGVAAEIRRMDILPEIPA |
| Ga0209169_106869672 | 3300027879 | Soil | KKCWVCCHAQVVRVEEGNGLRFGVAAEIKRMDVLPEIPA |
| Ga0209624_104212841 | 3300027895 | Forest Soil | LILPPELTSGEKCWVCCHARVLRVEQGPGKNFGVAAEIRRMDILPEIPA |
| Ga0209067_105597151 | 3300027898 | Watersheds | PPELTSGEKCWVCCQATIVRVEEEGPEFGVAAQIRRMDILPEAAV |
| Ga0209415_111298892 | 3300027905 | Peatlands Soil | HELTSGEKCWVCCQATIVRVEEEGSEFGVAAQIRRMDILPEVAI |
| Ga0209006_105087361 | 3300027908 | Forest Soil | ELTDGQKCWVCCQATIVRAEQVGSEFGVAATIKRMDILPEAAI |
| Ga0308309_102012774 | 3300028906 | Soil | TSGEKCWVCCHARVLRVEQGPGKDFGVAAEIRRMDILPEIPA |
| Ga0308309_105362123 | 3300028906 | Soil | LPPELTSGEKCWVCCHARILRVEQGPGKDFGVAAEIRRMDILPEIPA |
| Ga0308309_115715342 | 3300028906 | Soil | LILPPELTDGQKCWVCCQATIVRAEQVGSEFGVAAKIQRMDILPEAAI |
| Ga0222749_100918081 | 3300029636 | Soil | VLILPPELTSGEKCWVCCQATIVRVEEEGSEFGVAAQINRMDILPEATV |
| Ga0311346_106538101 | 3300029952 | Bog | ELTSGEKCWVCCHARVLRVEQGPGKDFGVAAEIRRMDILPEIHG |
| Ga0311339_109486641 | 3300029999 | Palsa | ELTSGERCWVCCQATVVRVEESGTRFGVAAQIRRMDLLPEMTA |
| Ga0302176_100712563 | 3300030057 | Palsa | LILPPELTSGEKCWVCCHAQILRVEQGPGKSFGVAAAIRRMDVLPEILG |
| Ga0302179_100190921 | 3300030058 | Palsa | EKCWVCCHAQILRVEQGPGKSFGVAAAIRRMDVLPEILG |
| Ga0302179_101214771 | 3300030058 | Palsa | EKHWVCCHARVLRVEKGPGTDFGVAAEIRRMDILPEIPA |
| Ga0302183_101693122 | 3300030509 | Palsa | GEKCWVCCHARVLRVEQGHGNDFGVAAEIQRMDILPEIPT |
| Ga0302183_102585042 | 3300030509 | Palsa | CWVCCQATIVRAEQVGSEFGVAATIKRMDILPEAAI |
| Ga0302275_102596133 | 3300030518 | Bog | TFGEKCWVCCHARILRVEQGPGTDFGVAAEIKRMDILPEIPA |
| Ga0265762_11439282 | 3300030760 | Soil | LPPELTSGEKCWVCCQATIVRVEEEGSEFGVAAQIRRMDILPEVTV |
| Ga0265765_10035501 | 3300030879 | Soil | PELTSGEKCWVCCHARVLRVEQSPGKDFGVAAEIRRMDLLPEIPMPS |
| Ga0302307_100039447 | 3300031233 | Palsa | ILPPELTSGEKCWVCCHARVLRVEQGPDKQFGVAAEIKRMDIIPEIPA |
| Ga0310686_1132572672 | 3300031708 | Soil | ELTSGEKCWVCCQATIVRVEEEGSEFGVAAQIRRMDILPEATA |
| Ga0310686_1143770432 | 3300031708 | Soil | SGEKCWVCCHARIVRVEEGVDKQFGVAAEIQRMDILPEIPA |
| Ga0310686_1164316621 | 3300031708 | Soil | GEKCWVCCQARVLRVEQGPGKDFGVAAEIERMDILPEIPA |
| Ga0307469_110231962 | 3300031720 | Hardwood Forest Soil | EKCWVCCHARILRVEQGTGNDFGVAAEIKRMEVLPEIPA |
| Ga0307468_1009540331 | 3300031740 | Hardwood Forest Soil | LILPPELTSGEKCWVCCQATIVRVEEQGSDFGVAAQIRRMDILPEMAV |
| Ga0307479_111839771 | 3300031962 | Hardwood Forest Soil | ELTGEKCWVCCHATVVRVEESPGPRFGVAAAIKKMDFLPEIGL |
| Ga0335080_100174221 | 3300032828 | Soil | KCWVCCQATVVRVEDGPQFGVAAQIRRMDILPEMAV |
| Ga0335070_119058832 | 3300032829 | Soil | SELTSGEKYWVCCQATVVRVENEAGSDFGVAAQIRRMDILPEVVA |
| Ga0335083_100550573 | 3300032954 | Soil | CWVCCQATIVRVEENGSEFGVAAQIQRMDILPEVTV |
| Ga0335077_120672731 | 3300033158 | Soil | ELTAGEKCWVCCQATVVRVEEGPEFGVAAQIRRMDLLPEVAI |
| Ga0318519_110563842 | 3300033290 | Soil | WVCCQATIVRVEENGGDFGVAAKIRRMDILPEALA |
| Ga0370484_0083839_585_731 | 3300034125 | Untreated Peat Soil | MLPPELTAGEKCWVCCQARVVRVEEGPGPELGVAAEIRRLEALPEIAL |
| ⦗Top⦘ |