NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072516

Metagenome / Metatranscriptome Family F072516

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072516
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 54 residues
Representative Sequence MRVLNAMQMKNGAKAEGGPTFSSLTQPIQFLPYKEKTDDWAAWNLDWLELQGI
Number of Associated Samples 110
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 4.27 %
% of genes near scaffold ends (potentially truncated) 90.08 %
% of genes from short scaffolds (< 2000 bps) 85.95 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (55.372 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(26.446 % of family members)
Environment Ontology (ENVO) Unclassified
(63.636 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(66.942 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.86%    β-sheet: 0.00%    Coil/Unstructured: 69.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF00166Cpn10 4.96
PF12705PDDEXK_1 2.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 4.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A55.37 %
All OrganismsrootAll Organisms44.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2100351011|ASMM170b_contig08282__length_551___numreads_3Not Available551Open in IMG/M
3300001827|ACM21_1034231All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium780Open in IMG/M
3300001949|GOS2238_1025869Not Available1484Open in IMG/M
3300002140|M2t2FKB2_1846357All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium711Open in IMG/M
3300002408|B570J29032_109807482Not Available1407Open in IMG/M
3300004097|Ga0055584_100017060Not Available7133Open in IMG/M
3300004280|Ga0066606_10229259All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium667Open in IMG/M
3300004461|Ga0066223_1102859Not Available1664Open in IMG/M
3300005825|Ga0074476_1285901All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium770Open in IMG/M
3300006191|Ga0075447_10156828All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium763Open in IMG/M
3300006735|Ga0098038_1179430Not Available693Open in IMG/M
3300006751|Ga0098040_1195234Not Available592Open in IMG/M
3300006793|Ga0098055_1386225Not Available519Open in IMG/M
3300008050|Ga0098052_1399012Not Available511Open in IMG/M
3300008470|Ga0115371_11355173Not Available615Open in IMG/M
3300008964|Ga0102889_1177112All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium622Open in IMG/M
3300009076|Ga0115550_1239467Not Available597Open in IMG/M
3300009409|Ga0114993_10495869Not Available908Open in IMG/M
3300009409|Ga0114993_11013036All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium591Open in IMG/M
3300009447|Ga0115560_1337488Not Available572Open in IMG/M
3300009512|Ga0115003_10261484All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1029Open in IMG/M
3300009544|Ga0115006_10775685All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium844Open in IMG/M
3300009705|Ga0115000_10215744Not Available1261Open in IMG/M
3300009706|Ga0115002_10801721All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium658Open in IMG/M
3300009785|Ga0115001_10613478Not Available664Open in IMG/M
3300009790|Ga0115012_10824899Not Available753Open in IMG/M
3300009790|Ga0115012_11465531Not Available585Open in IMG/M
3300010149|Ga0098049_1255183All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium532Open in IMG/M
3300010153|Ga0098059_1226504Not Available724Open in IMG/M
3300011256|Ga0151664_1196476Not Available518Open in IMG/M
3300011261|Ga0151661_1045992Not Available1111Open in IMG/M
3300012936|Ga0163109_10041795All Organisms → Viruses → Predicted Viral3370Open in IMG/M
3300014914|Ga0164311_10678715All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium588Open in IMG/M
3300017705|Ga0181372_1091616Not Available517Open in IMG/M
3300017719|Ga0181390_1087298Not Available852Open in IMG/M
3300017726|Ga0181381_1120918Not Available549Open in IMG/M
3300017730|Ga0181417_1023662All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1531Open in IMG/M
3300017743|Ga0181402_1197114Not Available500Open in IMG/M
3300017749|Ga0181392_1190050All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium593Open in IMG/M
3300017751|Ga0187219_1232971Not Available500Open in IMG/M
3300017758|Ga0181409_1218627Not Available546Open in IMG/M
3300017760|Ga0181408_1157023All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium585Open in IMG/M
3300017778|Ga0181349_1230219All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium627Open in IMG/M
3300017781|Ga0181423_1224556All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium706Open in IMG/M
3300018416|Ga0181553_10575817All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium596Open in IMG/M
3300018420|Ga0181563_10559672All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium638Open in IMG/M
3300020382|Ga0211686_10047671Not Available1730Open in IMG/M
3300020386|Ga0211582_10236325All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium679Open in IMG/M
3300020404|Ga0211659_10325702All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium673Open in IMG/M
3300021087|Ga0206683_10207093Not Available1027Open in IMG/M
3300021378|Ga0213861_10319214Not Available791Open in IMG/M
3300022068|Ga0212021_1020684All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1227Open in IMG/M
3300022407|Ga0181351_1120014Not Available987Open in IMG/M
(restricted) 3300023085|Ga0233406_10054146Not Available605Open in IMG/M
(restricted) 3300023089|Ga0233408_10117916All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium577Open in IMG/M
3300023568|Ga0228696_1016810Not Available851Open in IMG/M
(restricted) 3300024062|Ga0255039_10496497Not Available532Open in IMG/M
3300024228|Ga0228633_1009650Not Available2819Open in IMG/M
3300024244|Ga0228678_1030654All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1006Open in IMG/M
3300024294|Ga0228664_1052002All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium992Open in IMG/M
3300024296|Ga0228629_1059490Not Available1030Open in IMG/M
(restricted) 3300024340|Ga0255042_10000090Not Available8865Open in IMG/M
(restricted) 3300024518|Ga0255048_10227907Not Available907Open in IMG/M
(restricted) 3300024518|Ga0255048_10229613All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium903Open in IMG/M
(restricted) 3300024528|Ga0255045_10423959All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium547Open in IMG/M
(restricted) 3300024529|Ga0255044_10002853Not Available4051Open in IMG/M
3300025057|Ga0208018_115950Not Available942Open in IMG/M
3300025086|Ga0208157_1137393All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium550Open in IMG/M
3300025093|Ga0208794_1035486All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium958Open in IMG/M
3300025096|Ga0208011_1105223Not Available595Open in IMG/M
3300025102|Ga0208666_1113082Not Available653Open in IMG/M
3300025110|Ga0208158_1142365Not Available547Open in IMG/M
3300025128|Ga0208919_1109632All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon883Open in IMG/M
3300025137|Ga0209336_10187584All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium518Open in IMG/M
3300025137|Ga0209336_10189575Not Available514Open in IMG/M
3300025168|Ga0209337_1173920All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium905Open in IMG/M
3300025276|Ga0208814_1096427All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium752Open in IMG/M
3300025637|Ga0209197_1026021Not Available2280Open in IMG/M
3300025879|Ga0209555_10035836All Organisms → Viruses → Predicted Viral2300Open in IMG/M
3300025895|Ga0209567_10243606Not Available854Open in IMG/M
3300027315|Ga0208949_1008813Not Available2321Open in IMG/M
3300027631|Ga0208133_1140689Not Available558Open in IMG/M
3300027780|Ga0209502_10384648All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium579Open in IMG/M
3300027813|Ga0209090_10280208Not Available833Open in IMG/M
3300027813|Ga0209090_10308084All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium784Open in IMG/M
3300027828|Ga0209692_10488721Not Available514Open in IMG/M
(restricted) 3300027837|Ga0255041_10320898All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium562Open in IMG/M
3300027838|Ga0209089_10424288All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium732Open in IMG/M
3300027847|Ga0209402_10197708All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1313Open in IMG/M
3300027852|Ga0209345_10017184Not Available5570Open in IMG/M
3300027852|Ga0209345_10489331Not Available707Open in IMG/M
(restricted) 3300027881|Ga0255055_10035458Not Available2817Open in IMG/M
(restricted) 3300027881|Ga0255055_10192911Not Available1110Open in IMG/M
(restricted) 3300027881|Ga0255055_10682047All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium548Open in IMG/M
3300027971|Ga0209401_1271351Not Available601Open in IMG/M
(restricted) 3300027996|Ga0233413_10002415Not Available7853Open in IMG/M
(restricted) 3300027996|Ga0233413_10021200Not Available2424Open in IMG/M
(restricted) 3300028045|Ga0233414_10171327All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium966Open in IMG/M
(restricted) 3300028045|Ga0233414_10543892All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium548Open in IMG/M
3300028111|Ga0233397_1079989All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium858Open in IMG/M
3300028128|Ga0228645_1003376Not Available3216Open in IMG/M
3300028129|Ga0228634_1068292All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium851Open in IMG/M
3300028133|Ga0228609_1036973All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1366Open in IMG/M
3300028396|Ga0228643_1132939Not Available568Open in IMG/M
3300029753|Ga0135224_1021698All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium642Open in IMG/M
3300031519|Ga0307488_10695761Not Available576Open in IMG/M
3300031566|Ga0307378_11177184All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium609Open in IMG/M
3300031601|Ga0307992_1142920Not Available932Open in IMG/M
3300031628|Ga0308014_1084373All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium749Open in IMG/M
3300031659|Ga0307986_10348010Not Available607Open in IMG/M
3300031669|Ga0307375_10516657All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium717Open in IMG/M
3300031673|Ga0307377_10243329All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1382Open in IMG/M
3300031673|Ga0307377_10720907Not Available699Open in IMG/M
3300032011|Ga0315316_10800574All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium777Open in IMG/M
3300032092|Ga0315905_11098185All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium659Open in IMG/M
3300032252|Ga0316196_10436725All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium559Open in IMG/M
3300032254|Ga0316208_1043750Not Available1405Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine26.45%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater12.40%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater9.09%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.09%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.13%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil3.31%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.48%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.65%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.65%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.65%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.65%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.65%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.65%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine1.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.83%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.83%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.83%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.83%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.83%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.83%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment0.83%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.83%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.83%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.83%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.83%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.83%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.83%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.83%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.83%
Coastal Water And SedimentEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment0.83%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.83%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.83%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.83%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.83%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.83%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2100351011Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cmEnvironmentalOpen in IMG/M
3300000127Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45mEnvironmentalOpen in IMG/M
3300001827Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23kEnvironmentalOpen in IMG/M
3300001949Marine microbial communities from Panama City, Panama - GS022EnvironmentalOpen in IMG/M
3300002140Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2FKB2 (112f)EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004280Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100mEnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005825Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBBEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006335Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_2_0500mEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006751Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300011256Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, totalEnvironmentalOpen in IMG/M
3300011261Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02EnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300014914Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cmEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020386Marine microbial communities from Tara Oceans - TARA_B100000609 (ERX555990-ERR599038)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300023085 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MGEnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300023568Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300024244Seawater microbial communities from Monterey Bay, California, United States - 125D_rEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300024296Seawater microbial communities from Monterey Bay, California, United States - 36DEnvironmentalOpen in IMG/M
3300024340 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5EnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025093Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025096Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025637Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025895Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027315Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_03_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027828Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027838Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027852Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes)EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028111Seawater microbial communities from Monterey Bay, California, United States - 35DEnvironmentalOpen in IMG/M
3300028128Seawater microbial communities from Monterey Bay, California, United States - 57DEnvironmentalOpen in IMG/M
3300028129Seawater microbial communities from Monterey Bay, California, United States - 42DEnvironmentalOpen in IMG/M
3300028133Seawater microbial communities from Monterey Bay, California, United States - 10DEnvironmentalOpen in IMG/M
3300028396Seawater microbial communities from Monterey Bay, California, United States - 55DEnvironmentalOpen in IMG/M
3300029753Marine harbor viral communities from the Indian Ocean - SRH3EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031601Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133EnvironmentalOpen in IMG/M
3300031628Marine microbial communities from water near the shore, Antarctic Ocean - #229EnvironmentalOpen in IMG/M
3300031659Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032252Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cmEnvironmentalOpen in IMG/M
3300032254Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyriteEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ASMM170b_021843802100351011Coastal Water And SedimentMRVLNAMQLKKGAKAEGGPTYSSLTQPIQFLPTSEKLMIGQHGI
SA_S1_NOR05_45mDRAFT_1006115723300000127MarineMKVFNAMQLKNGAKAESGYNGSTSLTQPIQFIGAKKKDDNWAA
ACM21_103423123300001827Marine PlanktonMKVFNAMQLKNGAKADSGYPTTSSLTQPMQFLAAKKKDQNWAAWNLDWLELQGIQFLRQNAR
GOS2238_102586923300001949MarineMRVFNAMQTKAGARKEGGPTSSSLTQPIQFLPASKKNDDWSAWNLDWLELQGMGVLA*
M2t2FKB2_184635713300002140MarineMKVFNAMQLKNGAKAKSGFNGSTNLTQPIQFIPAKEKDQDWAAWNLDWLEVQGMNFLKQNSRKMLKNY
B570J29032_10980748223300002408FreshwaterMQVFNAMQLKAGAKAESGYPSTTSLTQPIQFLPAKEKDNDWVAWNLDWLE
Ga0055584_10001706013300004097Pelagic MarineMRVLNAMQMKNGAKAEGGPTFSSLTQPVQFLPYKEKTDDWAAW
Ga0066606_1022925923300004280MarineMRVLNAMQLKSGAKAEGGPTYSSLTQPIQFLPYSEKTDDWAAWNLDWLELQGV
Ga0066223_110285913300004461MarineMKVLNAMQLKNGAKAESSSTYSSLTQPVQFLPASEKTDDWSAWNLDWLELQ
Ga0074476_128590113300005825Sediment (Intertidal)MRVLNAMQLKNGAKAEAGPTFSSLTQPVQFLPYKKKDDDWAAWNLDW
Ga0075447_1015682823300006191MarineMRVLNAMQLKNGAKAESGDTFSSLTQPVQFISYKEKTDDWAAWNLDWLELQGIE
Ga0068480_104407733300006335MarineMKVLSAMQLKNGAKAKKSALNASLTQPLQFISSKEKDDDWSAWNLDWLEERGM
Ga0098038_117943033300006735MarineMKIFNALQLKNGAKAKEAKYPATSSLTQPIQFLSAKRKTKDWAAWNLDWLEQQGMNFLKGNSRKI
Ga0098040_119523423300006751MarineMKVLNALQLKNGAKAKESKYPATSSLTQPIQFLSSKKKNKDWAAWNLDWLEEQGMNFLK
Ga0098055_138622513300006793MarineMQIFNALQLKNGAKAKKSKYPATSSLTQPIQFLSAKKKNADWAAWNLDWL
Ga0098052_139901223300008050MarineMQVLNALQLKNGAKAKQSKYPATSSLTQPIQFLSAKKKNLDWAAWNLDWLEE
Ga0115371_1135517333300008470SedimentMRVLNAMQIKKGAKTKGSALNSSLSQPIQFISSKEKDEDWAAWNLDWLEERGM
Ga0102889_117711223300008964EstuarineMKVYNALDLKKGAKGEGYPTTASLTQPIQFLPAKEKDDDWAAWNIDWLE
Ga0115550_123946713300009076Pelagic MarineMQMKNGAKAESGPTFSSLTQPTQFLPYSKKTDDWAAWNLDWLELQGIEFLRINSRRLLKN
Ga0114993_1049586913300009409MarineMKVLNAMDLKGGAKADSGYPSTSSLTQPIQFLSAKKKDDDWFAWNLDWLELQGLEFLR
Ga0114993_1101303613300009409MarineMKVLNAMQLKNGAKAEGGPTYSSLTQPTQFLPYAKKTDDWAAWNLDWLELQGIEFLRINARR
Ga0115560_133748823300009447Pelagic MarineMRVLNAMQMKNGAKAEGGPTFSSLTQPVQFLPYKEKTDDWAAWNLDWLELQGIE
Ga0115003_1026148423300009512MarineMKVLNAMQLKKGAKAESGPTYSSLTQPIQFIPFSEKTDDWA
Ga0115006_1077568513300009544MarineMRVLNAMQMKNGAKAEGGPTFSSLTQPIQFLPYKEKTDDWAAWNLDWLELQGIEFLRVNARRLLKNYKL
Ga0114933_1092400423300009703Deep SubsurfaceMKVYNALQLKNGAKADSKSYPTNATLTQPVQFLPAKKKNDDWAAWNI
Ga0115000_1021574423300009705MarineMRVLNAMQLKNGQKAKEGPTYSSLTQPVQFIPSSEKTDDWAAWNLDW
Ga0115002_1080172123300009706MarineMKVLNAMQLKNGAKAEGGPTYSSLTQPIQFLPYKQKDDDWAAWNLDWLELQGLEFLRINSRRLLKNY
Ga0115001_1061347813300009785MarineMRVLNAMQLKNGAKAEGGPTFSSLTQPTQFLPYAKKTDDWAAWNLDWLELQ
Ga0115012_1082489923300009790MarineMKVLNALQLKKGAKAKSNGYPSGLSLTQPVQFISHKQKDDNWAAWNLDWLE
Ga0115012_1146553113300009790MarineMRVLNALQMKKGAKADSKDYPSSASLTQPVQFLPAKKKDDDWAAWNLDWLELEGMEYLKKTSRKL
Ga0098049_125518323300010149MarineMRVLNAMQLKNGAKAESGPTFSSLTQPVQFLPFSKKTDDWAAWNLDWLE
Ga0098059_122650413300010153MarineMKVFNALQLKNGAKAKTGSSSASSSLTQPVQFLSAKQKNEDWAAWNLDWLEVQGMN
Ga0151664_119647623300011256MarineMRVLNAMQMKNGAKAESGPTFSSLTQPVQFLPYKKKDDDWAAWNLDWLELQGIEFLRINSRRLT*
Ga0151661_104599223300011261MarineMKVLNAMQLKNGAKAESGPTFSSLTQPVQFISSKQKTDDWAAWNLDWLEFQGIEFLRFNSRRFLKEL*
Ga0163109_1004179553300012936Surface SeawaterMKVLNAMQMKNGARAESGPTFSNLTQPVQFLPYKKKTDDWAAWNLDWLEMQGIEFLRINSRRLLKNYK
Ga0164311_1067871513300014914Marine SedimentMRVLNAMQMKNGAKAESGPTFSSLTQPVQFLPYKKKDDDWAAWNLDWLE
Ga0181372_109161613300017705MarineMRVLNALQMKKGAKADSKDYPASASLTQPVQFLPAKKKTDDWAAWNLDWLELQGMEYLKHNARKISFS
Ga0181412_109859213300017714SeawaterMKVYNALQLKKGAKVKKDLKFANLNQPLQFIPSKEKDDDWAAWNLDWLETRGMDQLKKNS
Ga0181390_108729813300017719SeawaterMRVLNAMQLKNGAKAESGPTFSSLTQPVQFLPYKDKTDDW
Ga0181381_112091813300017726SeawaterMRVLNAMQMKNGATAESGPTFSSLTQPVQFLPYSKKTDDWAAWNLDWLESS
Ga0181417_102366213300017730SeawaterMRVLNAMQMKNGATAESGPTFSSLTQPVQFLPYSKKTDDW
Ga0181402_119711423300017743SeawaterMRVLNAMQMKNGAKAESGPTFSSSTQPTQFLPYSKKTDDWA
Ga0181392_119005013300017749SeawaterMRVLNAMQLKNGAKAESGPTFSSLTQPTQFLPFSKKTDDWA
Ga0187219_123297123300017751SeawaterMRVLNAMQMKNGAKAESGPTFSSLTQPTQFLPYSKK
Ga0181409_121862723300017758SeawaterMRVLNAMQMKNGAKAESGPTFSSLTQPTQFLPYSKKTDDWAAWNLDWLELQGIEFLRINARRLLKN
Ga0181408_115702313300017760SeawaterMRVLNAMQMKNGATAESGPTFSSLTQPVQFLPYSKKTDDWAAWNLDWLELQGIEF
Ga0181349_123021923300017778Freshwater LakeMKVLNAMQLKAGARKEQGASFSNLTQPIQFLPYAEKTDDWAS
Ga0181423_122455613300017781SeawaterMRVLNAMQLKNGAKAESGDTFSSLTQPIQFLPYSKKTDDWAAWNLDWLELQG
Ga0181553_1057581713300018416Salt MarshMKVLNAMQLKNGAKSTEGPTFSNLTQPVQFLPYKQKNEEWAAWNL
Ga0181563_1055967213300018420Salt MarshMRVLNAMQLKNGAKAEEGPTFSSLTQPVQFLPYSKKTDDWAAWNLDWLELQGIE
Ga0211686_1004767123300020382MarineMRVLNAMQLKKGAKAEGGPTYSSLTQPIQFLPTSEKTDDWAAWN
Ga0211582_1023632523300020386MarineMRVFNAMQLKAGAKKEGGHVSSSLTQPIQFLPAKKKDDDWSAWNLDWLELQGMEFLRRN
Ga0211659_1032570223300020404MarineMRVLNAMQLKNGAKAESGPTFSSLTQPTQFLPFSKKTDDWAAWNLDWLELQGIEFLRLNARRLLKNY
Ga0206683_1020709313300021087SeawaterMRVLNAMQMKNGAKAESGPTFSSLTQPVQFLPYKQKDDNWSAWNLDWLELQGIEFLR
Ga0213861_1031921423300021378SeawaterMKVFNAMQLKAGAKSEGTTTSASLTQPMQFLPSKKKDDDWYAWNIDWLELQG
Ga0212021_102068423300022068AqueousMKVFNAMQLKNGAKAESGYPTTASLTQPIQFLPAKKKDDNWAAWNLDWLELQGMQFLRQ
Ga0181351_112001423300022407Freshwater LakeMKVLNAMQLKAGAKKTEGPTFSSLTQPIQFLPYSEKTDDWAAWNLDWLEDQGIQFLKLNA
(restricted) Ga0233406_1005414613300023085SeawaterMRVLNAMQMKNGAKAEGGPTFSSLTQPIQFLPYKEKTDDWAAWNLDWLELQGIEF
(restricted) Ga0233408_1011791623300023089SeawaterMRVLNAMQMKNGAKAEGGPTFSSLTQPIQFLPYKEKTDDWAAWNLDWLELQGI
Ga0228696_101681013300023568SeawaterMRVLNAMQLKGGAKSDGGPTFSSLTQPVQFLPYKEKTDDWAAWNLDWLELQGIE
(restricted) Ga0255039_1049649713300024062SeawaterMRVLNAMQLKNGAKAEAGPTFSSLTQPVQFLPYKKKDDDWAAWNLDWLELQGIEFLRIN
Ga0228633_100965043300024228SeawaterMRVLNAMQMKSGATAESGPTFSSLTQPIQFLPYSKKTDDWAAWNLDWLELQGIEFLRVNSRRLLKNY
Ga0228678_103065433300024244SeawaterMRVLNAMQMKSGATAESGPTFSSLTQPIQFLPYSKKTDDWAAWNLDWL
Ga0228664_105200213300024294SeawaterMRVLNAMQMKNGAKAESGPTFSSLTQPVQFLPYKQKDDNWSAWNLDWLELQGIEFLRQNSRRLLKNYKL
Ga0228629_105949023300024296SeawaterMRVLNAMQMKSGATAESGPTFSSLTQPIQFLPYSKKTDDWAAWNLDWLELQGIEFLRVNSRMLL
(restricted) Ga0255042_1000009073300024340SeawaterMKVLNAMQLKNGAKAESGPTFSSLTQPVQFISSKQKTDEWAAWNLDWLEVQ
(restricted) Ga0255048_1022790713300024518SeawaterMKNGAKAESGPTFSSLTQPVQFLSYKEKTEDWAAWNLDWL
(restricted) Ga0255048_1022961313300024518SeawaterMKVFNALQLKNGAKGEGQAASSSLTQPIQFLPAKKKNDDWFAWNIDWLELQGIEFLRY
(restricted) Ga0255045_1042395923300024528SeawaterMRVLNAMQLKNGAKADGVSTFSSLTQPVQFLPSKEKTDDWAAWNLDWLELQGVEFLRINA
(restricted) Ga0255044_1000285363300024529SeawaterMKVFNAMQLKAGAKTEGTTTSASLTQPMQFLSSKKKDDDWFAWNIDWLELQGIEFIRQ
Ga0208018_11595013300025057MarineMRVLNAMQMKNGAKAESGPTFSSLTQPTQFLPYSKKTDDWA
Ga0208157_113739313300025086MarineMKVFNAMQLKAGAKGEGYPTSSSLTQPIQFLPAKKKDNDWYAWNIDWLELQGI
Ga0208794_103548613300025093MarineMRVVNALQLKKGAKTEGKYPTTSSLTQPIQFLPEKKKDDDWSAWNLDWLELQG
Ga0208011_110522323300025096MarineMKVLNALQLKNGAKAKESKYPATSSLTQPIQFLSSKKKNKDWAAWNLDWLEEQGMNFLKK
Ga0208666_111308213300025102MarineMKIFNALQLKNGAKAKEAKYPATSSLTQPIQFLSAKRKTKDWAAWNLDWLEQQGM
Ga0208158_114236523300025110MarineMQLYNALQLKNGAKTKGKGITSSSLTQPLQFITAKKKDDDWAAWNLDWLEVQGLEYL
Ga0208919_110963233300025128MarineMRVYNAMQLKKGAKADKGYPTTSSLTQPIQFLPAKDKDDDWTAWNLD
Ga0209336_1018758413300025137MarineMRVLNAMQLKNGAKAEDGPTFSSLTQPIQFLPYKDKTDDWAAWNLDWLELQGIEFLRNNA
Ga0209336_1018957523300025137MarineMRVLNAMQMKNGATAESGPTFSSLTQPVQFLPYSKKTDDWAAWNLDWLELQGIEFLR
Ga0209337_117392023300025168MarineMRVLNAMQLKNGAKAESGPTFSSLTQPTQFLSYSKKTDDWAAWNLDWLELQGIEFLRINA
Ga0208814_109642713300025276Deep OceanMRVLNAMQLKNGAKAEEGASYSSLTQPTQFLPYRKKTDDWAAWNLDWLELQGIE
Ga0209197_102602113300025637Pelagic MarineMRVLNAMQMKNGAKAEGGPTFSSLTQPVQFLPYKEKTDDWAAWNLDWLELQ
Ga0209555_1003583613300025879MarineMKVLNAMQLKNGAKSTEGPTFSNLTQPVQFLPYKQKNEEWAAWNLDWLELQGIEFLKINARRLL
Ga0209567_1024360613300025895Pelagic MarineMRVLNAMQMKNGAKAESGPTFSSLTQPTQFLPYSKKTDDWAAWN
Ga0208949_100881313300027315MarineMRVLNAMQMKNGAKAESGPTFSSLTQPVQFLPYKQKDDNWSAWNLDWLELQGIEFLRQNSRRLLKNYK
Ga0208133_114068923300027631EstuarineMKVLNAMQLKAGAKKTEGPTFSSLTQPIQFLPYSEK
Ga0209502_1038464823300027780MarineMRVLNAMQLKNGAKAEGGPTYSSLTQPVQFLPYSEKTDDWAAWNLDWLELQGVEFLRTNARRLLKNYK
Ga0209090_1028020823300027813MarineMRVFNALQLKKGAKVEASKYPATSSLTQPVQFLSAKKKDENWAAWNLDWLEVQGMNF
Ga0209090_1030808413300027813MarineMRVLNAMQMKNGAKAEGGPTFSSLTQPIQFLPYKEKTDD
Ga0209692_1048872113300027828Marine SedimentMRVLNAMQMKNGAKAESGPTFSSLTQPTQFLPYKKKTDDWAAWNLDWLELQGIEFLRV
(restricted) Ga0255041_1032089813300027837SeawaterMRVLNAMQMKNGAKAEGGPTFSSLTQPVQFFPYKEK
Ga0209089_1042428823300027838MarineMKVLNAMQLKNGAKAEGGPTYSSLTQPIQFLPYKQKDDDWAA
Ga0209402_1019770813300027847MarineMKVLNAMQLKNGAKAEGGPTYSSLTQPIQFLPYKQKDDDWAAW
Ga0209345_10017184103300027852MarineMRVLNAMQMKNGAKAESGPTFSSLTQPVQFLPYKQKDDNW
Ga0209345_1048933123300027852MarineMRVLNAMQLKNGAKAESGPTFSSLTQPTQFLTYKKKTDDWAAWNLDWLELQG
(restricted) Ga0255055_1003545813300027881SeawaterMRVLNAMQLKNGAKAEGGPTFSSLTQPVQFLPYKKKDDDWAAWNLDW
(restricted) Ga0255055_1019291113300027881SeawaterMRVLNAMQMKNGAKAEGGPTFSSLTQPVQFLPYKEKTDDWAAWNLDWLELQGIEFLRV
(restricted) Ga0255055_1068204723300027881SeawaterMKVYNALQLKNGAKGEGYPTSSSLTQPIQFLSSKKKDNDWYAWNIDWLELQGLEFL
Ga0209401_127135113300027971Freshwater LakeMKVLNAMQLKAGAKKTEGPTFSSLTQPIQFLPYSEKTDDWAAWNLDWLEDQGVQFLKLNARRL
(restricted) Ga0233413_1000241513300027996SeawaterMRVLNAMQMKNGAKAESGPTFSSLTQPTQFLPFREKTDDWAAWNLDWLELQGIEFLRVNSRRLLK
(restricted) Ga0233413_1002120013300027996SeawaterMKVFNALQIKKGAKGEGAPTSSSLTQPIQFLPSKKKNDDWKAWNIDWLELQGLEFLRLNSRRLLKNYKL
(restricted) Ga0233414_1017132723300028045SeawaterMKVYNAMQLKNGAKAESGSGASSSLTQPIQFLPAKKKDDDWAA
(restricted) Ga0233414_1054389223300028045SeawaterMKVFNAMQLKNGAKAESGYNGSTSLTQPIQFIGAKKKDDNWAAWNLDWLEVQGMNFLKEN
Ga0233397_107998923300028111SeawaterMKVLNAMQLKNGAKAESGPTFSSLTQPVQFISSKQ
Ga0228645_100337643300028128SeawaterMRVLNAMQMKSGATAESGPTFSSLTQPIQFLPYSKKTDDWAAWNLDWLELQGIEFLRVNSRR
Ga0228634_106829213300028129SeawaterMRVLNAMQMKNGAKAESGPTFSSLTQPVQFLPYKQKDDNWSAW
Ga0228609_103697313300028133SeawaterMRVLNAMQMKNGAKAESGPTFSSLTQPVQFLPYKQKDDNWSAWNLDWLELQGIEFLRQNSRR
Ga0228643_113293923300028396SeawaterMKVLNAMQLKNGAKAESGPTFSSLTQPVQFISSKQKTDEWAAWNLDWLEVQGIEFLRLNARRLLKNIN
Ga0135224_102169813300029753Marine HarborMKVFNALQLKNGAKGEGYPTSSSLTQPIQFLPSKKKNDDWYAWNIDWLELQGIEFLRHNARKLLKNYKLTKGS
Ga0307488_1069576123300031519Sackhole BrineMRVLNAMQMKNGARAESGPTFSSLTQPTQFLPYVQKTDDWAAWNLDWLETQGVEFLRVNARR
Ga0307378_1117718413300031566SoilMRVLNAMQLKNGAKAESGPTFSSLTQPIQFLPSSEKTDDWAAWNLDWLELQGIEFLRIN
Ga0307992_114292013300031601MarineMRVLNAMQLKNGAKADGGPTYSSLTQPIQFLPSSEKTPDWAAWNLDWLETQGVEFS
Ga0308014_108437323300031628MarineMRVLNAMQLKKGAKAEGGPTYSSLTQPIQFLPTSE
Ga0307986_1034801013300031659MarineMRVLNAMQLKNGAKAKDGPTYSSLTQPVQFLPYSEKTDDWAAWNLDWLETQGVEFLRSNARRLLKNYK
Ga0307375_1051665713300031669SoilMRVLNAMQLKSGAKGKGYPTTSSLTQPIQFLPAKAKDDDWRAWN
Ga0307377_1024332923300031673SoilMRVLNAMQLKNGAKAEGGPTFSSLTQPIQFLPASEKNDDWA
Ga0307377_1072090723300031673SoilMKVFNAMQLKAGAKSEDTTTSASLTQPMQFLPSKKKDDDWYAWNIDWLELQGIEFIRQ
Ga0315316_1080057413300032011SeawaterMRVLNAMQLKNGAKAEEGPTFSSLTQPVQFLPYSKKTDDWAAWNLDWLELQGIEFLRINARRLL
Ga0315905_1109818513300032092FreshwaterMKVYNALDLKKGAKGEGYPTTASLTQPIQFLSAKEKDDDWAAWNIDWLELQGMEFLRLNARKLLKN
Ga0316196_1043672523300032252SedimentMKVFNAMQLKNGAQADSGYPTTSSLTQPVQFLPSKKKDENWAAWNL
Ga0316208_104375013300032254Microbial MatMRVLNAMQLKNGAKAESGPTFSSLTQPTQFLTYKKKTD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.