NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072514

Metagenome / Metatranscriptome Family F072514

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072514
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 65 residues
Representative Sequence VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYYDAKSDRESRHKKRP
Number of Associated Samples 109
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 65.04 %
% of genes near scaffold ends (potentially truncated) 96.69 %
% of genes from short scaffolds (< 2000 bps) 91.74 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (49.587 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(42.149 % of family members)
Environment Ontology (ENVO) Unclassified
(80.165 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.298 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.30%    β-sheet: 15.22%    Coil/Unstructured: 68.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF01555N6_N4_Mtase 6.61
PF16778Phage_tail_APC 3.31
PF05345He_PIG 3.31
PF08291Peptidase_M15_3 1.65
PF13385Laminin_G_3 1.65
PF02493MORN 0.83
PF05199GMC_oxred_C 0.83
PF13884Peptidase_S74 0.83
PF04055Radical_SAM 0.83
PF09636XkdW 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG0863DNA modification methylaseReplication, recombination and repair [L] 6.61
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 6.61
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 6.61
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.83
COG2849Antitoxin component YwqK of the YwqJK toxin-antitoxin moduleDefense mechanisms [V] 0.83
COG4642Uncharacterized conserved proteinFunction unknown [S] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.12 %
UnclassifiedrootN/A14.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10186764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria586Open in IMG/M
3300000116|DelMOSpr2010_c10219450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria597Open in IMG/M
3300000756|JGI12421J11937_10001259Not Available10257Open in IMG/M
3300001460|JGI24003J15210_10160142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium566Open in IMG/M
3300001472|JGI24004J15324_10134329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria590Open in IMG/M
3300001731|JGI24514J20073_1021331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria579Open in IMG/M
3300002033|GOS24894_10458156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175808Open in IMG/M
3300005400|Ga0066867_10347711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium528Open in IMG/M
3300005426|Ga0066847_10193875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium622Open in IMG/M
3300005509|Ga0066827_10074656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium1274Open in IMG/M
3300005603|Ga0066853_10295608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium531Open in IMG/M
3300006029|Ga0075466_1024938All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1905Open in IMG/M
3300006193|Ga0075445_10181384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae743Open in IMG/M
3300006340|Ga0068503_10533058All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae665Open in IMG/M
3300006403|Ga0075514_1017353All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales947Open in IMG/M
3300006736|Ga0098033_1140679Not Available678Open in IMG/M
3300006738|Ga0098035_1240012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium598Open in IMG/M
3300006752|Ga0098048_1078390All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1011Open in IMG/M
3300006752|Ga0098048_1255638All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales511Open in IMG/M
3300006753|Ga0098039_1103900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium978Open in IMG/M
3300006753|Ga0098039_1251559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae594Open in IMG/M
3300006754|Ga0098044_1085416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1305Open in IMG/M
3300006789|Ga0098054_1251103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales638Open in IMG/M
3300006803|Ga0075467_10518142All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales612Open in IMG/M
3300006900|Ga0066376_10495713All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales689Open in IMG/M
3300006919|Ga0070746_10103419All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1418Open in IMG/M
3300006920|Ga0070748_1366258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae506Open in IMG/M
3300006925|Ga0098050_1103578All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales727Open in IMG/M
3300006927|Ga0098034_1091381All Organisms → Viruses875Open in IMG/M
3300006927|Ga0098034_1228175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae516Open in IMG/M
3300006928|Ga0098041_1192916All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales652Open in IMG/M
3300006928|Ga0098041_1300467All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales510Open in IMG/M
3300006990|Ga0098046_1027717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1398Open in IMG/M
3300007229|Ga0075468_10217366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria552Open in IMG/M
3300007541|Ga0099848_1146659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium876Open in IMG/M
3300007963|Ga0110931_1256021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria520Open in IMG/M
3300008050|Ga0098052_1345976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium557Open in IMG/M
3300008072|Ga0110929_1140785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium535Open in IMG/M
3300008114|Ga0114347_1041085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes6440Open in IMG/M
3300008217|Ga0114899_1258534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium534Open in IMG/M
3300008219|Ga0114905_1037339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium1838Open in IMG/M
3300008220|Ga0114910_1076289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium1029Open in IMG/M
3300008220|Ga0114910_1228582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300008264|Ga0114353_1153853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium1151Open in IMG/M
3300008266|Ga0114363_1058500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Fussvirus2617Open in IMG/M
3300009071|Ga0115566_10678308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria572Open in IMG/M
3300009420|Ga0114994_10874764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria583Open in IMG/M
3300009445|Ga0115553_1148143Not Available964Open in IMG/M
3300009526|Ga0115004_10892632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria531Open in IMG/M
3300009605|Ga0114906_1070388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium1296Open in IMG/M
3300010150|Ga0098056_1225121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria624Open in IMG/M
3300010153|Ga0098059_1299363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium615Open in IMG/M
3300010153|Ga0098059_1352896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium558Open in IMG/M
3300010155|Ga0098047_10031079Not Available2129Open in IMG/M
3300010155|Ga0098047_10120891All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1019Open in IMG/M
3300010155|Ga0098047_10357258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium549Open in IMG/M
3300010155|Ga0098047_10380283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium529Open in IMG/M
3300010299|Ga0129342_1281247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium575Open in IMG/M
3300010300|Ga0129351_1313181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria592Open in IMG/M
3300010934|Ga0137844_1045992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium579Open in IMG/M
3300011010|Ga0139557_1076303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300011258|Ga0151677_1027505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales2199Open in IMG/M
3300012950|Ga0163108_10435409All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae846Open in IMG/M
3300017717|Ga0181404_1105692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria689Open in IMG/M
3300017718|Ga0181375_1038829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium799Open in IMG/M
3300017730|Ga0181417_1047058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1055Open in IMG/M
3300017730|Ga0181417_1075088All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae821Open in IMG/M
3300017734|Ga0187222_1094563Not Available677Open in IMG/M
3300017737|Ga0187218_1049040Not Available1054Open in IMG/M
3300017758|Ga0181409_1246726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300017763|Ga0181410_1144494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria671Open in IMG/M
3300017765|Ga0181413_1256716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300017770|Ga0187217_1176277Not Available711Open in IMG/M
3300017779|Ga0181395_1015109Not Available2677Open in IMG/M
3300017782|Ga0181380_1263794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria569Open in IMG/M
3300017950|Ga0181607_10636883All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae558Open in IMG/M
3300017986|Ga0181569_10700754Not Available670Open in IMG/M
3300018049|Ga0181572_10631179All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae649Open in IMG/M
3300018416|Ga0181553_10670192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300019751|Ga0194029_1099441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P510Open in IMG/M
3300020214|Ga0194132_10626771Not Available513Open in IMG/M
3300020222|Ga0194125_10114813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus2170Open in IMG/M
3300020277|Ga0211568_1086653Not Available659Open in IMG/M
3300020447|Ga0211691_10309278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria626Open in IMG/M
3300020477|Ga0211585_10614246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium597Open in IMG/M
3300020536|Ga0207939_1023800Not Available838Open in IMG/M
3300022167|Ga0212020_1086969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium523Open in IMG/M
3300023170|Ga0255761_10507680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300025045|Ga0207901_1031785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium715Open in IMG/M
3300025078|Ga0208668_1034508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage979Open in IMG/M
3300025097|Ga0208010_1046441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage975Open in IMG/M
3300025097|Ga0208010_1052817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium900Open in IMG/M
3300025099|Ga0208669_1052034Not Available933Open in IMG/M
3300025118|Ga0208790_1179218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium570Open in IMG/M
3300025122|Ga0209434_1078927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage968Open in IMG/M
3300025128|Ga0208919_1253555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300025138|Ga0209634_1090714All Organisms → Viruses1377Open in IMG/M
3300025138|Ga0209634_1337448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium502Open in IMG/M
3300025168|Ga0209337_1291058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria598Open in IMG/M
3300025267|Ga0208179_1075152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria705Open in IMG/M
3300025277|Ga0208180_1133123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria517Open in IMG/M
3300025282|Ga0208030_1009853Not Available3573Open in IMG/M
3300025646|Ga0208161_1127710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium663Open in IMG/M
3300025655|Ga0208795_1153148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria573Open in IMG/M
3300025759|Ga0208899_1016306All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae3864Open in IMG/M
3300025771|Ga0208427_1045846All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae1626Open in IMG/M
3300025810|Ga0208543_1072189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae836Open in IMG/M
3300026192|Ga0207986_1078280Not Available743Open in IMG/M
3300026199|Ga0208638_1045478All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300026208|Ga0208640_1024804All Organisms → cellular organisms → Bacteria → Proteobacteria1628Open in IMG/M
3300026212|Ga0208409_1111910Not Available608Open in IMG/M
3300027146|Ga0255104_1014168Not Available1552Open in IMG/M
3300027600|Ga0255117_1065995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium714Open in IMG/M
3300027801|Ga0209091_10290249All Organisms → Viruses778Open in IMG/M
3300028192|Ga0257107_1230211Not Available521Open in IMG/M
3300031644|Ga0308001_10238067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium707Open in IMG/M
3300031647|Ga0308012_10214055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae759Open in IMG/M
3300031851|Ga0315320_10259318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae1256Open in IMG/M
3300031963|Ga0315901_10986077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium590Open in IMG/M
3300032116|Ga0315903_10153450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Fussvirus2111Open in IMG/M
3300033742|Ga0314858_090079All Organisms → Viruses774Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine42.15%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.74%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.09%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean6.61%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.13%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.31%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.65%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.65%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.65%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.65%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.65%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.83%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.83%
Water BodiesEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies0.83%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.83%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.83%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.83%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine0.83%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.83%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.83%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.83%
Subsea Pool Microbial MatEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool Microbial Mat0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001731Marine viral communities from the Pacific Ocean - LP-37EnvironmentalOpen in IMG/M
3300002033Marine microbial communities from the Sargasso Sea - GS000a &bEnvironmentalOpen in IMG/M
3300005400Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261EnvironmentalOpen in IMG/M
3300005426Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74EnvironmentalOpen in IMG/M
3300005509Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV51EnvironmentalOpen in IMG/M
3300005603Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006340Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770mEnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006736Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaGEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006900Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_AEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006927Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008072Microbial Communities in Water bodies, Singapore - Site MAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008217Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215EnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300008220Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908EnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010934Microbial mat microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV9-P3EnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012950Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaGEnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017718Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaGEnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020214Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80mEnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300020277Marine microbial communities from Tara Oceans - TARA_B100001971 (ERX556102-ERR599152)EnvironmentalOpen in IMG/M
3300020447Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159)EnvironmentalOpen in IMG/M
3300020477Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156)EnvironmentalOpen in IMG/M
3300020536Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300023170Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaGEnvironmentalOpen in IMG/M
3300025045Marine viral communities from the Pacific Ocean - LP-46 (SPAdes)EnvironmentalOpen in IMG/M
3300025078Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025097Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025122Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025267Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes)EnvironmentalOpen in IMG/M
3300025277Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes)EnvironmentalOpen in IMG/M
3300025282Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026192Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV89 (SPAdes)EnvironmentalOpen in IMG/M
3300026199Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV51 (SPAdes)EnvironmentalOpen in IMG/M
3300026208Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 (SPAdes)EnvironmentalOpen in IMG/M
3300026212Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 (SPAdes)EnvironmentalOpen in IMG/M
3300027146Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027600Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300028192Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500mEnvironmentalOpen in IMG/M
3300031644Marine microbial communities from water near the shore, Antarctic Ocean - #5EnvironmentalOpen in IMG/M
3300031647Marine microbial communities from water near the shore, Antarctic Ocean - #179EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1018676413300000115MarineVKYYNKGIAAHLEAILKLQDDDHLVFEAVQGVGPIDIITVNKITGKVTFYDAKSDRTSRH
DelMOSpr2010_1021945033300000116MarineVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKRNGKVTFYDAKSDRESRHKKRQQT
JGI12421J11937_10001259103300000756Freshwater And SedimentMIAILELVDDDHLVFTNVNGVGPIDIVTVNIKTGKVDLYDAKSDRESRHYKRPTNDIQKKLNVKQFYINL
JGI24003J15210_1016014223300001460MarineVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDXITVNKKTGKVTYYDAKSDRESRHKKRPQTQIQK
JGI24004J15324_1013432933300001472MarineVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYYDAKSDRESRHKKRPQTQIQK
JGI24514J20073_102133123300001731MarineVRYFNKGIAAHLEAMLKLLDDDHLIFTNQFGVGPIDIVTVNIKTGKVDLYDAKSDRESRHRKRPSTQIQHKYKKN*
GOS24894_1045815643300002033MarineVKYFNKGIAAHLEAMLELLDDDHLLFTNVQGIGPIDIVRVNIHTGKVDFYDAKSDRE
Ga0066867_1034771133300005400MarineVKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVNFYDAKSDRERSH
Ga0066847_1019387523300005426MarineVKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKTGKVDFYDAKSDRER
Ga0066827_1007465613300005509MarineVKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIKSGEVTFYDAKSDRECSHKPRKLTELQKKL
Ga0066853_1029560813300005603MarineVKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVTFYDAKSDRECSH
Ga0075466_102493843300006029AqueousVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYYDAKSDRESRHKKRPQT
Ga0075445_1018138433300006193MarineVKYYNKGIAAHLEAILKLQDDDHLLFENIQGVGPIDIITVNKQTGKVTFYDAKSDRTSRH
Ga0068503_1053305813300006340MarineVKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVTVNIKTGKVDFYDAKSDRDRAHKKRPYTEIQ
Ga0075514_101735323300006403AqueousVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNKHSGKVTFYDAKSDREDRHKKRQNTKIQKKIRS*
Ga0098033_114067913300006736MarineMKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVKFYDAKSDRERSHKPRK
Ga0098035_124001213300006738MarineMKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVKFYDAKSD
Ga0098048_107839043300006752MarineVKFYNKGIAAHLEAILKLLDDDHLVFQNIQGVGPIDIVTVNKETGKVVFYDAKSDRERSHKKR
Ga0098048_125563823300006752MarineVKYYNKGIAAHLEAMLELLDDDHLLFTNVQGIGPIDIVRVNIHTGKTDFFDAKSDRESRHKKRPIT
Ga0098039_110390013300006753MarineMKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKTGKVDFYDAKSDRERSHKPRKLTALQKKLGVKNF
Ga0098039_125155933300006753MarineVRYFNKGIAAHLEALLKLLDDDHLIFTNLFGVGPIDIVTVNIKTGKVDLYDAKSDRETRHKKRP
Ga0098044_108541613300006754MarineVKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVKFYDAKSDRERS
Ga0098054_125110313300006789MarineVRYFNKGIAAHLEAMLKLLDDDHLIFRNQFGVGPIDIVTVNIKTGKVDFYDAKSDRERSHKKRPSTQIQKKL
Ga0075467_1051814233300006803AqueousVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYYDAKSDRESRHKKRPQTQIQKKLGV
Ga0066376_1049571343300006900MarineVKYYNKGIAAHLIAMLELLDDDHLIFSNTFGIGPIDIVTVNIKTGKVNYYDAKTDRETTHHKRPI
Ga0070746_1010341943300006919AqueousVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYYDAKS
Ga0070748_136625833300006920AqueousVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKNTGKVTYYDAKSDRERA
Ga0098050_110357813300006925MarineVKYYNKGIAAHLEAMLELLDDDHLLFSNVQGLGPIDIVRVNIQTGKVDFFDAKSDR
Ga0098034_109138123300006927MarineMKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKTGKVDFYDAKSDRERSHKPRKLTEIQK
Ga0098034_122817533300006927MarineVKYYNKGIAAHLEAMLELLDDDHLLFTNVQGLGPIDIVRVNIHTGKTDFYDAKSDRESRHKKRP
Ga0098041_119291623300006928MarineVKYYNKGIAAHLEAMLELLDDDHLLFSNVQGLGPIDIVRVNIHTGKTDFYDAKSDRESRHKKRPI
Ga0098041_130046723300006928MarineVKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVTVNIKTGKVDFYDAKSDRERSHKKRAFTEIQKRLGVKH
Ga0098046_102771713300006990MarineVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKRNGKVSFYDAKSDRESRHKK
Ga0075468_1021736633300007229AqueousVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNKHSGKVTFYDAKSDREDR
Ga0099848_114665913300007541AqueousVKYYNNGIAAHLTAMLELLDDDHLLFTNVNGVGPVDIVRVNIHTGKVDFFDAKADHPLRHRKRPLTEIQKKLKV
Ga0110931_125602113300007963MarineVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYYDAKSDRESRHKKRP
Ga0098052_134597633300008050MarineVKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVKFYDAKSDRERSHKPRKLTELQKK
Ga0110929_114078513300008072Water BodiesLKYYNKGIAAHVIAILELLDDDHLVFTNVNGVGPIDIVTVNTKTGKVDLYDAKSDRESRHKPRPIKDI
Ga0114347_104108563300008114Freshwater, PlanktonLKHYNKGIAAHIIAILELLDDDHLIFTNVNGVGPIDIVTVNTKTGKVDLYDAKSDRESRHYKRPINDIQKIALVIILLATVIL*
Ga0114899_125853413300008217Deep OceanVKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVRVNIKTGEVDFYDAKSDRERSHKKRAFT
Ga0114905_103733953300008219Deep OceanVKYYNKGIAAHLIAMLELLDDDHLIFTNVQGIGPIDIVRVNIKTGEVDFYDAKSDRESRHKKRSFTEIQKRLGVKH
Ga0114910_107628913300008220Deep OceanVKYYNKGIAAHLIAMLELLDDDHLIFTNVQGIGPIDIVTVNIKTGEVDFYDAKSDRERSHKKRAFTE
Ga0114910_122858213300008220Deep OceanVKYYNKGIAAHLIAMLELLDDDHLIFTNVQGIGPIDIVRVNIKTGEVDFYDAKSDRERSHKKRAFTE
Ga0114353_115385333300008264Freshwater, PlanktonLKHYNKGIAAHIIAILELLDDDHLIFTNVNGVGPIDIVTVNTKTGKVDLYDAKAD
Ga0114363_105850053300008266Freshwater, PlanktonLKHYNKGIAAHIIAILELLDDDHLIFTNVNGVGPIDIVTVNTKTGKVDLYDAKSDRESRHYKRPINDIQK
Ga0115566_1067830813300009071Pelagic MarineVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNKHTGKVIFYDAKSDRESRHKKRNSTQIQKN*
Ga0114994_1087476413300009420MarineVKYYNKGIAAHLEAILKLQDDDHLVFENLQGVGPIDIITVNKETGKVTFYDAKSDRESRHKNRPQSIIQKKLGVK
Ga0115553_114814343300009445Pelagic MarineVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKRNGKVTFYDAKSDRESRHKKR
Ga0115004_1089263213300009526MarineVKFYNKGIAAHLEAILKLQDDDHLVFENLQGQGPIDIITVNKHTGKVTFYDAKSDRTSRHKKRPQS
Ga0114906_107038843300009605Deep OceanVKYYNKGIAAHLEAMLELLDDDHLLFTNVQGIGPIDIVRVNIQTGKVDFFDAKS
Ga0098056_122512113300010150MarineVKYFNKGIAAHLEAMLELLDDDHLIFTNVQGIGPIDIVRVNIHTGSVDFFDAKSDRESRHKKRPITDIQKKL
Ga0098059_129936323300010153MarineVKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVTVNIKTGKVDFYDAKSDRESRHKK
Ga0098059_135289613300010153MarineVKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVTVNIKTGEVDFYDAK
Ga0098047_1003107963300010155MarineVKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIKSGKVTFYDAKS
Ga0098047_1012089113300010155MarineMKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKTGKVDFYDAKSDRE
Ga0098047_1035725833300010155MarineVKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIVRVNIHTGAVDFYDAKSDRESRHKKRELTELQKKLG
Ga0098047_1038028333300010155MarineVKYYNKGIAAHLIAMLELLDDDHLIFTNVQGIGPIDIVRVNIKTGEVDFYDAKSDR
Ga0129342_128124733300010299Freshwater To Marine Saline GradientVKYYNNGIAAHLTAMLELLDDDHLLFTNVNGVGPIDIVRVNIHTGKVDFFDAKADHPLR
Ga0129351_131318133300010300Freshwater To Marine Saline GradientVKFYNKGIAAHLEAILKLLDDDHLVFQNIQGVGPIDIVTVNKKTGKVIFYDAKSDRERSHKK
Ga0137844_104599213300010934Subsea Pool Microbial MatVKYYNKGIAAHLIAMLELLDDDHLIFSNTNGVGPIDIVTVNIKTGQVDFYDAKSDRE
Ga0139557_107630313300011010FreshwaterLKHYNKGIAAHMIAILELVDDDHLVFTNVNGVGPIDIVTVNTKTGKVDLYD
Ga0151677_102750523300011258MarineVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKNTGKVTYYDAKTDRESDTKKDLKHKYKKN*
Ga0163108_1043540913300012950SeawaterVKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIKSGEVTFYDAKSDRECSHKP
Ga0181404_110569233300017717SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKRNGKVTFYDAKSDRESRHKK
Ga0181375_103882933300017718MarineVKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVKFYDAKSDRE
Ga0181417_104705813300017730SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKRTGKVTYYDAKSDRESRHKKRHQPQIQKK
Ga0181417_107508843300017730SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKETGKVTFYDAKSDRTSRHKK
Ga0187222_109456333300017734SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGEVTYYDAKSDRESRHKK
Ga0187218_104904043300017737SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGEVTYYDAKS
Ga0181409_124672633300017758SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGLIDIITVNKETGKVTFYDAKSDRTSRH
Ga0181410_114449413300017763SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKRTGKVTYYDAKSDRESRHKKRPQTQIQKKLGVKN
Ga0181413_125671613300017765SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYYDAKSDRERAHKKRPQTKIQKQ
Ga0187217_117627713300017770SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKRTGKVTYYDAKSDRESRHKKRP
Ga0181395_101510943300017779SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKRNGKVIFYDAKSDR
Ga0181380_126379433300017782SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKRNGKVTFYDAKSDRESRHKKRPQT
Ga0181607_1063688313300017950Salt MarshVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKNSGKVTFYDAKSDREDRHKKR
Ga0181569_1070075443300017986Salt MarshVKPYNKGIAAQLTAMLELQDDNHLVFTNLFGVGPIDIVTVNLNSGEVCFYDAKCDRESRHKK
Ga0181572_1063117933300018049Salt MarshVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNKHSGKVTFYDAKSDREDRHKKRQNTKIQKK
Ga0181553_1067019233300018416Salt MarshVKYYNKGITAHLEAVIKLLDDDHLVFTNVNGVGPIDIVRINIHSGKVELYDAKSDREDRHKKRPY
Ga0194029_109944133300019751FreshwaterVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNKHSGKVTFYDAKSDREDRH
Ga0194132_1062677133300020214Freshwater LakeLNYYNKGIAAHVIAILELLDDNHLVFTNINGVGPIDIITVNKDSGEIELYDAKSDRETRHKQRPL
Ga0194125_1011481343300020222Freshwater LakeVIAILELLDDNHLVFTNINGVGPIDIITVNKDSGEIQLYDAKSDRETRHKQRPLKDIQKKLKV
Ga0211568_108665333300020277MarineVKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIKSGEVTFYDAKSDRECSHKPRKLTEL
Ga0211691_1030927813300020447MarineVKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVTVNIKTGKVDFYDAKSDRESRH
Ga0211585_1061424623300020477MarineVKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVRVNIKTGQVDFYDAKSDRERSHKK
Ga0207939_102380033300020536FreshwaterMIAILELVDDDHLVFTNVNGVGPIDIVTVNTKTGKVDLYDAKCDRESRHYKRPINDIQKKLNVKQFYINLKK
Ga0212020_108696913300022167AqueousVKFYNKGIAAHLITMLELLDDDHLIFSNVCGVGPIDVVTVNIKTGKVCFYDAKSDRESRHKKRP
Ga0255761_1050768013300023170Salt MarshVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKNSGKVTFYDAKSDREDRHKKRQT
Ga0207901_103178513300025045MarineVKPLNKGIAAHLEAMLKLLDDDHLIFTNQFGVGPIDIVTVNIKTGKVDLYDAKSDRETSH
Ga0208668_103450833300025078MarineMKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVNFYDAKSDRERSHKP
Ga0208010_104644113300025097MarineMKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKTGKVDFYDAKSDRERSHKPRKLTE
Ga0208010_105281713300025097MarineMKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVNFYDAK
Ga0208669_105203413300025099MarineVKFYNKGIAAHLEAILKLLDDDHLVFQNIQGVGPIDIVTVNKKTGKVIFYDAKSDRERSHKKRPQTQIQKKL
Ga0208790_117921813300025118MarineVKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVTVNIKTGKVDFYDAKSDRESRHKKRSFTEIQKRLG
Ga0209434_107892713300025122MarineMKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKTGKVDFYDAKSDR
Ga0208919_125355523300025128MarineVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVIYYDAKSDRERAHKKRPQTKI
Ga0209634_109071443300025138MarineVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYYDAKSDRESRHKKRPQTQIQKKLG
Ga0209634_133744833300025138MarineVKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKHTGKVTFYDAKSDRTSRH
Ga0209337_129105813300025168MarineVKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKHTGKVTFYDAKS
Ga0208179_107515213300025267Deep OceanVKYYNKGIKAHLIAMQELLDDDHLIFQNVQGIGPIDIVRVNVHTGFCEFFDAKSDRDT
Ga0208180_113312333300025277Deep OceanVKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKETGKVTFYDAKSDRTSRHKKR
Ga0208030_100985313300025282Deep OceanVKYYNKGIAAHLIAMLELLDDDHLIFTNQFGVGPIDIVTVNIKTGKVDLYDAKSDRETRHKKRPTTQIQ
Ga0208161_112771033300025646AqueousVKYYNNGIAAHLTAMLELLDDDHLLFTNVNGVGPVDIVRVNIHTGKVDFFDAKADHPLRHRKRPLTEIQKKLKVKN
Ga0208795_115314813300025655AqueousVKYYNKGITAHLEAVIKLLDDDHLVFTNVNGVGPIDIVRINIHSGKVELYDAKS
Ga0208899_101630673300025759AqueousVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYYDAKSD
Ga0208427_104584663300025771AqueousVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNKHSGKVTFYDAKSD
Ga0208543_107218913300025810AqueousVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNKHSGKVTFYDAKSDREDRHKKRQTTKIQKKLGVKN
Ga0207986_107828043300026192MarineVKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIKSGEVTFYDAKSDRECSHKPRKL
Ga0208638_104547843300026199MarineVKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIKSGEVTFYDAKSDRECSHKPRKLTELQKK
Ga0208640_102480433300026208MarineVKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIKSGEVTFYDAKSDRECSHKPRKLTELQKKLGVKNF
Ga0208409_111191013300026212MarineVKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIKSGEVTFYDAKSDRECSHKPRKLTELQK
Ga0255104_101416853300027146FreshwaterLKHYNKGIAAHMIAILELVDDDHLVFTNVNGVGPIDIVTVNTKTGKVDLYDAKSDRESRHYKRPINDIQKKLKVK
Ga0255117_106599513300027600FreshwaterMIAILELVDDDHLVFTNVNGVGPIDIVTVNTKTGKVDLYDAKSDRESRHYKRPINDIQKKLNVKQFY
Ga0209091_1029024913300027801MarineVKYYNKGIAAHLEAILKLQDDDHLVFEAVQGVGPIDIITVNKETGKVTYYDAKCDRVRSHKNRPQSTIQKKL
Ga0257107_123021113300028192MarineVRYFNKGIAAHLEAMLKLLDDDHLIFTNQFGVGPIDIVTVNIKTGKVDLYDAKSDRESRHRK
Ga0308001_1023806713300031644MarineVKYYNKGIAAHLEAILKLQDDDHLVFEAVQGVGPIDIITVNKITGKVTFYDAKSDRTSRHKNRPQSEIQKKLGVK
Ga0308012_1021405513300031647MarineVKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDLITVNKETGKVTFYDAKSDRTSRHKKRPQSTIQKK
Ga0315320_1025931833300031851SeawaterVKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKRTGKVTYYDAKSDRESRHKKRPQTQ
Ga0315901_1098607713300031963FreshwaterLKHYNKGIAAHIIAILELLDDDHLIFTNVNGVGPIDIVTVNTKTGKVDLYDAKSDRESRHYKRPINDIQKKL
Ga0315903_1015345033300032116FreshwaterLKHYNKGIAAHIIAILELLDDDHLIFTNVNGVGPIDIVTVNTKTGKVDLYDAKSDRESRHYKRPINDIQKKLKV
Ga0314858_090079_3_1823300033742Sea-Ice BrineVKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKETGKVTFYDAKSDRSPPS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.