NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F072471

Metagenome Family F072471

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072471
Family Type Metagenome
Number of Sequences 121
Average Sequence Length 200 residues
Representative Sequence MKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGN
Number of Associated Samples 103
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.74 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(26.446 % of family members)
Environment Ontology (ENVO) Unclassified
(38.017 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.934 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 9.05%    β-sheet: 43.22%    Coil/Unstructured: 47.74%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF00005ABC_tran 10.74
PF12679ABC2_membrane_2 0.83
PF13620CarboxypepD_reg 0.83



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004156|Ga0062589_101326950All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium697Open in IMG/M
3300004463|Ga0063356_102659129All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium769Open in IMG/M
3300004463|Ga0063356_106491148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300005290|Ga0065712_10133576All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1519Open in IMG/M
3300005293|Ga0065715_10425025All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium830Open in IMG/M
3300005294|Ga0065705_10590955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium640Open in IMG/M
3300005330|Ga0070690_100994352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium661Open in IMG/M
3300005331|Ga0070670_100297683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1411Open in IMG/M
3300005331|Ga0070670_101986287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium536Open in IMG/M
3300005333|Ga0070677_10040172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1840Open in IMG/M
3300005337|Ga0070682_100924520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium718Open in IMG/M
3300005343|Ga0070687_100470960All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium840Open in IMG/M
3300005353|Ga0070669_100238230All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1445Open in IMG/M
3300005353|Ga0070669_101079921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium691Open in IMG/M
3300005364|Ga0070673_100317882All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1375Open in IMG/M
3300005364|Ga0070673_102360354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium506Open in IMG/M
3300005367|Ga0070667_100151437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales2038Open in IMG/M
3300005440|Ga0070705_101141357All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium639Open in IMG/M
3300005544|Ga0070686_100021601All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3830Open in IMG/M
3300005578|Ga0068854_100409720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1124Open in IMG/M
3300005615|Ga0070702_101887092All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300005616|Ga0068852_102640091All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium522Open in IMG/M
3300005618|Ga0068864_101119235All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium784Open in IMG/M
3300005718|Ga0068866_11184989All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300005719|Ga0068861_100084580All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2491Open in IMG/M
3300005840|Ga0068870_11116278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium568Open in IMG/M
3300005841|Ga0068863_100249171All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1715Open in IMG/M
3300005843|Ga0068860_101877187All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium621Open in IMG/M
3300005844|Ga0068862_100314209All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1444Open in IMG/M
3300005844|Ga0068862_102682192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella catacumbae510Open in IMG/M
3300006058|Ga0075432_10427193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium577Open in IMG/M
3300006237|Ga0097621_100252923All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1543Open in IMG/M
3300006844|Ga0075428_101210757All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis796Open in IMG/M
3300006881|Ga0068865_101985720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium528Open in IMG/M
3300006969|Ga0075419_10494221All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium849Open in IMG/M
3300009094|Ga0111539_10514954All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1394Open in IMG/M
3300009094|Ga0111539_10659819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1218Open in IMG/M
3300009101|Ga0105247_10603273All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Dyadobacter → Dyadobacter koreensis814Open in IMG/M
3300009176|Ga0105242_10580325All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1080Open in IMG/M
3300009176|Ga0105242_11545853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium696Open in IMG/M
3300009553|Ga0105249_10309624All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1587Open in IMG/M
3300009609|Ga0105347_1086587All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1167Open in IMG/M
3300010397|Ga0134124_10393380All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1317Open in IMG/M
3300011119|Ga0105246_11454526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium642Open in IMG/M
3300012882|Ga0157304_1042125All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium674Open in IMG/M
3300012883|Ga0157281_1000427All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2819Open in IMG/M
3300012885|Ga0157287_1005253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → unclassified Rufibacter → Rufibacter sp. DG15C1303Open in IMG/M
3300012885|Ga0157287_1069811All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium595Open in IMG/M
3300012891|Ga0157305_10062893All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium829Open in IMG/M
3300012895|Ga0157309_10007006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2176Open in IMG/M
3300012895|Ga0157309_10105258All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium786Open in IMG/M
3300012898|Ga0157293_10037432All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1015Open in IMG/M
3300012900|Ga0157292_10017526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1679Open in IMG/M
3300012901|Ga0157288_10118936All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium746Open in IMG/M
3300012903|Ga0157289_10191734All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium660Open in IMG/M
3300012904|Ga0157282_10035254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1140Open in IMG/M
3300012904|Ga0157282_10062461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium946Open in IMG/M
3300012905|Ga0157296_10120482All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium746Open in IMG/M
3300012906|Ga0157295_10031182All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1152Open in IMG/M
3300012907|Ga0157283_10077822All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → unclassified Rufibacter → Rufibacter sp. DG15C836Open in IMG/M
3300012907|Ga0157283_10296967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium559Open in IMG/M
3300012908|Ga0157286_10049205All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1074Open in IMG/M
3300012909|Ga0157290_10023080All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1384Open in IMG/M
3300012909|Ga0157290_10046618All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1100Open in IMG/M
3300012910|Ga0157308_10263719All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium614Open in IMG/M
3300012912|Ga0157306_10106275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium822Open in IMG/M
3300012914|Ga0157297_10044609All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1133Open in IMG/M
3300012916|Ga0157310_10010850All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2200Open in IMG/M
3300012987|Ga0164307_10585242All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium858Open in IMG/M
3300013297|Ga0157378_12779212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium542Open in IMG/M
3300014325|Ga0163163_11174149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium830Open in IMG/M
3300014969|Ga0157376_10866602All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium919Open in IMG/M
3300015201|Ga0173478_10010598All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2376Open in IMG/M
3300015201|Ga0173478_10237900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Dyadobacter → Dyadobacter koreensis788Open in IMG/M
3300015371|Ga0132258_13109805All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1147Open in IMG/M
3300017792|Ga0163161_10188709All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1583Open in IMG/M
3300018051|Ga0184620_10168815All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → unclassified Rufibacter → Rufibacter sp. DG15C715Open in IMG/M
3300018073|Ga0184624_10204752All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium881Open in IMG/M
3300019362|Ga0173479_10012303All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2249Open in IMG/M
3300019362|Ga0173479_10037490All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1514Open in IMG/M
3300019362|Ga0173479_10068716All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1222Open in IMG/M
3300020016|Ga0193696_1015311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2070Open in IMG/M
3300022870|Ga0247782_1018095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → unclassified Rufibacter → Rufibacter sp. DG15C918Open in IMG/M
3300022893|Ga0247787_1057842All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium579Open in IMG/M
3300022894|Ga0247778_1096126All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium784Open in IMG/M
3300022897|Ga0247764_1162046All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium680Open in IMG/M
3300022899|Ga0247795_1005364All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2064Open in IMG/M
3300022908|Ga0247779_1118289All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium692Open in IMG/M
3300023071|Ga0247752_1044254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium686Open in IMG/M
3300023078|Ga0247756_1024699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → unclassified Rufibacter → Rufibacter sp. DG15C939Open in IMG/M
3300023078|Ga0247756_1106980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium546Open in IMG/M
3300023168|Ga0247748_1055074All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium609Open in IMG/M
3300023265|Ga0247780_1013388All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1892Open in IMG/M
3300024055|Ga0247794_10038654All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1268Open in IMG/M
3300025315|Ga0207697_10197990All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium883Open in IMG/M
3300025893|Ga0207682_10179471All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → unclassified Rufibacter → Rufibacter sp. DG15C967Open in IMG/M
3300025918|Ga0207662_10582538All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium777Open in IMG/M
3300025923|Ga0207681_10329147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1217Open in IMG/M
3300025923|Ga0207681_11408049All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium585Open in IMG/M
3300025925|Ga0207650_11836340All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M
3300025931|Ga0207644_11452777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium576Open in IMG/M
3300025934|Ga0207686_10183335All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1486Open in IMG/M
3300025986|Ga0207658_11360474All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300026095|Ga0207676_11599694All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300027523|Ga0208890_1077919All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium545Open in IMG/M
3300027907|Ga0207428_10591207All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium800Open in IMG/M
3300027992|Ga0247750_1013210All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Dyadobacter → Dyadobacter koreensis777Open in IMG/M
3300027993|Ga0247749_1018961All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium725Open in IMG/M
3300028381|Ga0268264_10789148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium948Open in IMG/M
3300028802|Ga0307503_10680047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium576Open in IMG/M
3300031538|Ga0310888_10048756All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1972Open in IMG/M
3300031538|Ga0310888_10943011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium540Open in IMG/M
3300031562|Ga0310886_10554685All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium700Open in IMG/M
3300031847|Ga0310907_10682184All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium567Open in IMG/M
3300031908|Ga0310900_10260070All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter tropicus1255Open in IMG/M
3300032000|Ga0310903_10697141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium548Open in IMG/M
3300032003|Ga0310897_10284890All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium751Open in IMG/M
3300032012|Ga0310902_10441477All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium837Open in IMG/M
3300032013|Ga0310906_10494269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → unclassified Rufibacter → Rufibacter sp. DG15C827Open in IMG/M
3300032075|Ga0310890_10238408All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1272Open in IMG/M
3300032211|Ga0310896_10088907All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1356Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil26.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere9.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.09%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.79%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter5.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.48%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.65%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.83%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300022870Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L019-104C-5EnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300022894Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5EnvironmentalOpen in IMG/M
3300022897Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L051-202B-4EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022908Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023078Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300023265Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027992Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5EnvironmentalOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062589_10132695013300004156SoilERNNNPYYTFNPKKMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEI
Ga0063356_10265912913300004463Arabidopsis Thaliana RhizosphereMKKIFTLYAVLALFANSSPAQINESFENGLAPLEADCWQFINMMYASNPSAFVMNGNGSLYSEPPVSSDSIRIMRTPFLSVETSIDVSFIYRLSNNLNGQATRFIKIDLIDPSGNVVQVLDSFQITNSATSSTLYSQTLSVNVPGVYRLSITMGGKTGAGNVRLSMDDLTVNSTVVGCDASKTLPVHLVSFQ
Ga0063356_10649114813300004463Arabidopsis Thaliana RhizosphereQSVLIPPLKERNFPVTLRLLQKERNNNPYYTFNPKKMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAA
Ga0065712_1013357623300005290Miscanthus RhizosphereMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISSNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKT
Ga0065715_1042502513300005293Miscanthus RhizosphereMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGN
Ga0065705_1059095513300005294Switchgrass RhizosphereNNPYYTFNPKKMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNK
Ga0070690_10099435213300005330Switchgrass RhizosphereMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGNVRTSIDDLNVNAPVIGC
Ga0070670_10029768313300005331Switchgrass RhizosphereMKKFFTLCSLVTLSFFANNSFAQINENFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVIGCDDLIINKLLPVHLISFQGNMNKNNKVTLNWTV
Ga0070670_10198628713300005331Switchgrass RhizosphereYTFNPKKMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMASRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDL
Ga0070677_1004017213300005333Miscanthus RhizosphereMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTVADN
Ga0070682_10092452013300005337Corn RhizosphereFNPKKMKKIFTLCSLVTLSLFANNSFAQINENFDNGFTPLQADCWEFTSMMHATTPSGYVINGNGSVYSEPPVSSSDLRIMRTPYLNFSTVVNVSFMYRISGNLTGLATRFIKLDLVNSAGVVVQTLDSINISNAATTATLYSQTITVNNPGVYRFSFTMGGKTGAGSVRTSIDDLNVNAALVGCNDVVINKLLPVHLISFQGNMNKNNKVTLNWTIADNEIANDFEIERSFNGRDFT
Ga0070687_10047096023300005343Switchgrass RhizosphereMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVNKLLPVHLINFQGNMNKNNKVTLNWTVADNEISSNFEIERSFNGR
Ga0070669_10023823013300005353Switchgrass RhizosphereMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEIASNFEIERSFNGRDYTTVGVVVASEKMGTEN
Ga0070669_10107992113300005353Switchgrass RhizosphereMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDL
Ga0070673_10031788233300005364Switchgrass RhizosphereMKKIFTLCSIVTLSFFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVN
Ga0070673_10236035413300005364Switchgrass RhizosphereTDTSSKKKFPGNITAASEERNNNPYYTFNPKKMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGVATRFIKLDLVNSAGVIVQTLDSISISNAATTSTL
Ga0070667_10015143713300005367Switchgrass RhizosphereMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVNKLLPVHLINFQGNMNKNNKVTLNWTVADNEISSNFEIERSFNGRDYTTVGVLFASEKMGTENYMF
Ga0070705_10114135713300005440Corn, Switchgrass And Miscanthus RhizosphereMKKFFTLCSIVTLSFFANNSFAQINETFENGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVN
Ga0070686_10002160153300005544Switchgrass RhizosphereMKKIFTLCSLVTLSFFANNSFAQINENFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATAATLYSQTIAVTNPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVIGCDDLIINKLLPVHLISFQGNMNKNNKVTLNWTIADNEIA
Ga0068854_10040972023300005578Corn RhizosphereMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFTINVPGVYRFSLTLGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVNKLLPVHLINFQGNMNKNNKVTLNWTVADNEI
Ga0070702_10188709213300005615Corn, Switchgrass And Miscanthus RhizosphereKLETTIRLIFNPKKMKKFFTLCSIVTLSFFANNSFAQINETFENGFAPLQADCWQFTSMMHATTPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSISISNAATTSTLYSQTIAVTNPGVYRFS
Ga0068852_10264009113300005616Corn RhizosphereQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMASRFIKLDLVNSAGVVVQTLDSISISNAATAATLYSQTIAVTNPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVIGCNDVVINKLLPVHLISFQGNMNKNNKVTL
Ga0068864_10111923523300005618Switchgrass RhizosphereMKKIFTLCSLVTLSLFANNSFAQINENFDNGFTPLQADCWEFTSMMHATTPSGYVINGNGSVYSEPPVSSSDLRIMRTPYLNFSTVVNVSFMYRISGNLTGLATRFIKLDLVNSAGVVVQTLDSINISNAATTATLYSQTIAVNNPGVYRFSFTMGGKTGAGSVRTSIDDLNVNAALVGCNDVVINKLLPVHL
Ga0068866_1118498913300005718Miscanthus RhizosphereIRLIFNPKKMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVN
Ga0068861_10008458043300005719Switchgrass RhizosphereMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSFNIINAATTATLYSQTIAVNVPGVYRFSLTMGGKTGGGNVRTSIDDLNVN
Ga0068870_1111627813300005840Miscanthus RhizosphereYTFNPKKMKKIFTLCFIVTLSFFTNNSNAQINESFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDD
Ga0068863_10024917133300005841Switchgrass RhizosphereMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVNKLLPVHLINFQGNMNKNNKVTLNWTVADNEISSNFEIERSFNGRDYTTVGVLFASEKMGTENYMFYETT
Ga0068860_10187718713300005843Switchgrass RhizosphereMKKFFTLCSIVTLSFFANNSFAQINETFENGFAPLQADCWQFTSMMHATTPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSISISNAATTSTLYSQTIAVTNPGVYRFSLTMGGKTGGGNVRTSIDDLNVNAPVIGCDD
Ga0068862_10031420923300005844Switchgrass RhizosphereMNLLKFHLKKSLEKLATIKCAYYVCVIVRTIQVSPKNHDKQSVLIPPLKKKFPGNITTASEERKNNPFYTFNPKKMKKIFTLCFIVTLSFFTNNSNAQINESFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGSTIDISFVYRISGNLNGLATRFIKLDLVNSAGV
Ga0068862_10268219213300005844Switchgrass RhizospherePLQADCWQFTSMMHATSPSGYVINGSGSAYSEPPVSSDSLRIMRTPYLLFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFTINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVINKLLPVHLISFQGNMNK
Ga0075432_1042719313300006058Populus RhizosphereHDKQSVLIPPLKRNFPVTLRLLQKKETTIRIIHFNPKKMKKIFTLCSIVTLSLFANNTFAQFNENFDNGFASLQANCWQLTDMMHATSPSGYVINGNGSAYSEPPVSSTDLRIMRTPYLIFGTTVNVSFLYRISNNLTGQATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLT
Ga0097621_10025292323300006237Miscanthus RhizosphereMKKFFTLCSIVTLSFFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSTYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVNKLLPVHLINFQGNMN
Ga0075428_10121075713300006844Populus RhizosphereSKNSKKSIRLIFNPKKMKKIFTLSLLVTLSFFANNSYSQINENFNNGFASLQADCWQFTSMMHATSPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGQATRFIKLDLVNSAGVTVQTLDSISISNAATTATSYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPLIGCDDIVVNKLLPVHLIAFQGNMNKNNKVTLNWTVADNELANNFEIERSVNGRDFTSVGVVFASEKMGTENY
Ga0068865_10198572013300006881Miscanthus RhizosphereRNNNPYYTFNPKKMKKIFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGG
Ga0075419_1049422113300006969Populus RhizosphereMKKIFTLCILVTLSFFANNSYSQINENFNNGFAPLQADCWQFTSMMHATSPSGYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMASRFIKLDLVNSAGVVVQTLDSISISNAATAATLYSQTIAVTNPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVIGCDDLIINKLLPVHLISFQGNMNKNNKVTLNWTIADNEIAGNFEIERSFNG
Ga0111539_1051495413300009094Populus RhizosphereMKQIFTLCSLLTLSFFANNTYAQINENFDNGFAPLEASCWQFTNMMHATSPSGYVINGNGSAYSEPPVSNDSLRIMRTPFLDFGAVVDVSFMYRISGNLIGLAKRFIKLELVNSAGEVVQTLDSFNITNTATTATLYSQTFAVNIPGQYRFSLTMGGKTGAGTVRTSVDDLNVNAPVIGCVEINKLLPVHLISFQGNLNKNNKVTLNWTVADNEIANNFEVERSFN
Ga0111539_1065981923300009094Populus RhizosphereMKKIFTLCTLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHATSPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTVVDVSFMYRISGNLNGQATRFIKLDLVNSAGVVVQTLDSISISNSATTATSYSQTFAINVPGVYRFSLTMG
Ga0105247_1060327313300009101Switchgrass RhizosphereKLETTIRLIFNPKKMKKFFTLCSIVTLSFFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVNKLLPVHLINFQGNMNKNNKVTLNWTVADNEISSNFEIERSFNGRDYTTVGVLFASEKMGTENYMFYETTYG
Ga0105242_1058032513300009176Miscanthus RhizosphereMKKFFTLCYIVTLTFFANNSFAQINENFENGFAPLQADCWQFTSMMHATSPSGYVINGNGSAYSEPPVSSDSLRIMRTPYLNFGAVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSISISNAATTSTLYSQTIAINIPGVYRCSLTLGGKSGGGNVRTSIDDLNVNATLVGCDDVVVNKSLPVHLISFQGNMNKN
Ga0105242_1154585313300009176Miscanthus RhizosphereNPYYTFNPKKMKKFFTLCYIVTLTFFANTSFAQINENFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPYLDFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSISISNAATTSTLYSQTIAINIPGVYRFSLTLGGKSGGGNVRTSIDDLNVNAPVIGCDDVVVNKLLPVHLISFQGNMNKNNKVTLNWTIADNEIANNFE
Ga0105249_1030962423300009553Switchgrass RhizosphereMNLLKFHLKKSLEKLATIKCAYYVCVIVRTIQVSPKNHDKQSVLIPPLKKKFPGNITTASEERKNNPFYTFNPKKMKKIFTLCFIVTLSFFTNNSNAQINESFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGSTIDISFVYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSINISNAATSPTVYSQTITVNNPGVYRFSLTMGGKSGGGSVRTSIDDLNVNAPVIGCDDVVINKLLPVHLISFQGNMNKNNKVTLNW
Ga0105347_108658723300009609SoilMKKIFTLCFLVTLSFFANNSNAQINENFENGFAPLQTQCWQFTNMMHATIPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLDFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSFNINNAATTSTLYSQTFAVNTPGVYRFSFTMGGKTGAGNVRT
Ga0134124_1039338023300010397Terrestrial SoilMKKFFTLCSIVTLSFFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSTYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSEGVVVQTLDSISISNAATNATLYSQTIAVTNPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVNKLLPVHLINFQGNMNKNNKVT
Ga0105246_1145452613300011119Miscanthus RhizosphereFTLCSLVTLSFFANNSFAQINENFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSISISNAATTSTLYSQTIAVTNPGVYRFSLTMGGKTGGGNVRTSIDDLNVNAPVIGCDDVVVNKLLPVHLISFQGNMNKNNKVTLNWTIADNEIA
Ga0157304_104212513300012882SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFS
Ga0157281_100042713300012883SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRMSGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTS
Ga0157287_100525313300012885SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEIANNFEIERSFNGRDYTTVGIVLASEKIGTENYMFYETTSGTDKVMYRLKMIDKN
Ga0157287_106981113300012885SoilTDTSSKERNFPVTLRLLQKKRNNNPYYTFNPKKMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGIVVQTLDSFNISNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTV
Ga0157305_1006289313300012891SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTG
Ga0157309_1000700613300012895SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMASRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEIANN
Ga0157309_1010525813300012895SoilIVRTIQVSPKNHDKQSVLIPPLKKKFPGNITTASEERKNNPFYTFNPKKMKKIFTLCTVVTLSLFAKNSFAQITENFDNGFAPLQADCWQFTSMMHANTPSPYVINGNGSAYSEPPVSSDSLRIMRTPFLDFGTVVDVSFMYRISSNLNGMATRFIKLDLVNSAGVIVQTLDSINISNAATTATTYSQTFAINVPGVYRFSLTMGGKTGGGNVRTSFDDLNVNAPIVGCTDVVVNKLLPVHLISFQGNMNKNNKVTLNWTVA
Ga0157293_1003743213300012898SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTL
Ga0157292_1001752613300012900SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGAVRTSIDDLNVNAPVIGCDDL
Ga0157288_1011893613300012901SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMASRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAG
Ga0157289_1019173413300012903SoilMKKIFTLCILVTLSFFANNSYSQINENFNNGFAPLQADCWQFTSMMHATSPSGYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFTINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVINKLLPVHLISFQG
Ga0157282_1003525423300012904SoilMKKIFTLCTLVTLSLFANNSFAQITENFNNGLAPLQADCWQFTSMMHATSPSGYVINGSGSAYSEPPVSSDSLRIMRTPYLLFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYNQTFTINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCADVVINKLLPVHLI
Ga0157282_1006246113300012904SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMASRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKV
Ga0157296_1012048213300012905SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNK
Ga0157295_1003118213300012906SoilMKKIFTLCSIVTLSLFANNTFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTLGGKTGAGNVRTSIDDLNINAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEI
Ga0157283_1007782213300012907SoilKERNNNPYYTFNPKKMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEIANNFEIERSFNGRDYTTVGIVIASEKIGTENYMFYETTSGTDKVMY
Ga0157283_1029696713300012907SoilMKKLFSLCSLVTLSLFANNSFAQINENFDNGFTPLQADCWEFTSMMHATTPSGYVINGNGSVYSEPPVSSSDLRIMRTPYLNFSTVVNVSFMYRISGNLTGLATRFIKLDLVNSAGVVVQTLDSINISNAATTSTLYSQTITVNNPGVYRF
Ga0157286_1004920523300012908SoilMKKIFTLCTLVTLSLFANNSFAQITENFNNGLAPLQADCWQFTSMMHATSPSGYVINGSGSAYSEPPVSSDSLRIMRTPYLLFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVNKLLPVHLINFQGNMNKNNKVTLNWTVA
Ga0157290_1002308023300012909SoilMKQIFTLCSLLTLSFFANNTYAQINENFDNGFAPLEASCWQFTNMMHATSPSGYVINGNGSAYSEPPVSNDSLRIMRTPFLDFGAVVDVSFMYRISGNLIGLAKRFIKLELVNSAGEVVQTLDSFNITNTATTATLYSQTFAVNIPGQYRFSLTMGGKTGAGTVRTSVDDLNVNAPVIGCVEINKLLPVHLISFQGNLNKNNKVTLNWTVAD
Ga0157290_1004661823300012909SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTS
Ga0157308_1026371913300012910SoilHDKQSVLIPPLKKKFPGNITAASEERNNNPYYTFNPKKMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLTGLSKRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRT
Ga0157306_1010627523300012912SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISSNLTGLSKRFIKLDLVNSAGAVVQTLDSFSINNAATTATLYSQTIAVTNP
Ga0157297_1004460923300012914SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSL
Ga0157310_1001085033300012916SoilMKKIFTLCTLVTLSLFANNSFAQITENFDNGFAPLQADCWQFTSLMHATNPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNV
Ga0164307_1058524213300012987SoilMKKIFTLCSIVTMSFFTNNSFAQINESFENGFAPLEAVCWQFTDMIHATSPSGYVINGNGSVYSAPPVSPDSLRIMRTPYLNFGSVVDVSFVYRLSGTLTGSARRFIKLDLVNSAGVIVQALDSIDITATTSTLYSQTIAINIPGVYRFSLSLG
Ga0157378_1277921213300013297Miscanthus RhizosphereDTSSKERNFPVTLRLLQKKRNNNPYYTFNPKKMKKFFTLCSIVTLTFFANNSFAQINENFENGFAPLQADCWQFTSMMHAASPSTYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVIVQTFDSISISNAATTATLYSQTIAVNIPGV
Ga0163163_1117414913300014325Switchgrass RhizosphereMKKFFTLCYIVTLTFFANTSFAQINENFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPYLDFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSISISNAATTSTLYSQTIAINIPGVYRFSLTMGGKSGGGTVRTSIDDLNVNAPVIGC
Ga0157376_1086660213300014969Miscanthus RhizosphereMKKFFTLCSIVTLSFFANNSFAQINETFENGFAPLQADCWQFTSMMHATTPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSISISNAATTSTLYSQTIAVTNPGVYRFSLTMGGKTGGGNVRTSIDDLN
Ga0173478_1001059833300015201SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRMSGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEIANNFE
Ga0173478_1023790013300015201SoilIFNPKKMKKIFTLCILVTLSFFANNSYSQINENFNNGFAPLQADCWQFTSMMHATSPSGYVINGSGSAYSEPPVSSDSLRIMRTPYLLFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFTINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCADVVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEIASNFEIERSFNGRDYTTVGVVVASEKMGTENYMFYETTS
Ga0132258_1310980523300015371Arabidopsis RhizosphereMKKIFTLCSLITLTLCANNSFAQINENFDNGFAPLQADCWQFTSMMNASSPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGNTIDISFVYRLSGNLTGLAKRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGNVRTSIDDLNVNVPVVGCTDVVINKLLPVHLINFQGNMNKNNKVTLNWTVADNEIASNF
Ga0163161_1018870923300017792Switchgrass RhizosphereMKKIFTLCSLVTLSLFANNSFAQINENFDNGFTPLQADCWEFTSMMHATTPSGYVINGNGSVYSEPPVSSSDLRIMRTPYLNFSTVVNVSFMYRISGNLTGLATRFIKLDLVNSAGVVVQTLDSINISNAATTATLYSQTIAVNNPGVYRFSFTMGGKTGAGSVRTSIDDLNVNAALVGCNDVVINKLLPVHLISFQGNMN
Ga0184620_1016881513300018051Groundwater SedimentFFANNSFAQINENFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVIGCDDLIINKLLPVHLISFQGNMNKNNKVTLNWTVADNEIANNFEIERSFNGRDYTTVGIVIASEKIGTENYMFY
Ga0184624_1020475213300018073Groundwater SedimentMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTM
Ga0173479_1001230313300019362SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTIADNE
Ga0173479_1003749013300019362SoilMKKIFTLCILVTLSFFANNSYSQINENFNNGFAPLQADCWQFTSMMHATSPSGYVINGSGSAYSEPPVSSDSLRIMRTPYLLFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFTINVPGVYRFSLTMGGKTGGGS
Ga0173479_1006871623300019362SoilMKKIFTLCSLVTLSLFANNSFAQINENFDNGFTPLQADCWEFTSMMHATTPSGYVINGNGSAYSEPPVSSSDLRIMHTPYLNFSTVVNVSFMYRISGNLTGLATRFIKLDLVNSAGVVVQTLDSINISNAATTATLYSQTITVNNPGVYRFSLTMGGKTGAGSVRTSLDDLNVNAALVGCNDVVINKLVPVHLISFQGNMNKNNKVTLK
Ga0193696_101531113300020016SoilMKKFFTLCSLVTLSFFANNSFAQINENFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPV
Ga0247782_101809513300022870Plant LitterMKKIFTLCSLVTLSLFANNSFAQINENFDNGFTPLQADCWEFTSMMHATTPSGYVINGNGSVYSEPPVSSSDLRIMRTPYLNFSTVVNVSFMYRISGNLTGLATRFIKLDLVNSAGVVVQTLDSINISNAATTATLYSQTITVNNPGVYRFSFTMGGKTGAGSVRTSIDDLNVNAALVGCNDVVINKLLPVHLISFQGNMNKNNKVTLNWTIADNEIANDFEIERSFNGRDFTTVGVVFASEK
Ga0247787_105784213300022893SoilMKKIFTLCTLVTLSLFANNSFAQITENFNNGLAPLQADCWQFTSMMHATSPSGYVINGSGSAYSEPPVSSDSLRIMRTPYLLFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFTINVPGVYRFSLTMGGKT
Ga0247778_109612613300022894Plant LitterMKKIFTLCSLVTLSLFANNSFAQINENFDNGFTPLQADCWEFTSMMHATTPSGYVINGNGSVYSEPPVSSSDLRIMRTPYLNFSTVVNVSFMYRISGNLTGLATRFIKLDLVNSAGVVVQTLDSINISNAATTATLYSQTITVNNPGVYRFSFTMGGKTGAGSVRTSIDDLNVNAALVGCNDVVINKLLPVHLISFQGNMNK
Ga0247764_116204613300022897Plant LitterMKKIFTLCSLVTLSLFANNSFAQINENFDNGFTPLQADCWEFTSMMHATTPSGYVINGNGSVYSEPPVSSSDLRIMRTPYLNFSTVVNVSFMYRISGNLTGLATRFIKLDLVNSAGVVVQTLDSINISNAATTATLYSQTITVN
Ga0247795_100536433300022899SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMASRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVR
Ga0247779_111828913300022908Plant LitterMKKIFTLCSLVTLSLFANNSFAQINENFDNGFTPLQADCWEFTSMMHATTPSGYVINGNGSVYSEPPVSSSDLRIMRTPYLNFSTVVNVSFMYRISGNLTGLATRFIKLDLVNSAGVVVQTLDSINISNAATTATLYSQTITVNNPGVYRFSFTMGGKTGAGSVRTSIDDLNVNAALVGCNDVVINKLLPVHLISFQ
Ga0247752_104425413300023071SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLT
Ga0247756_102469913300023078Plant LitterMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEIANNFEIERSFNGRDYTTVGIV
Ga0247756_110698013300023078Plant LitterKKMKKIFTLCTLVTLSLFANNSFAQITENFNNGLAPLQADCWQFTSMMHATSPSGYVINGSGSAYSEPPVSSDSLRIMRTPYLLFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYNQTFTINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVV
Ga0247748_105507413300023168SoilMCILRLCHRKNDHSISEKPRQAIRTDTSSKKKFPGNITAASEERNNNPYYTFNPKKMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQT
Ga0247780_101338823300023265Plant LitterMKKIFTLCSLVTLSLFANNSFAQINENFDNGFTPLQADCWEFTSMMHATTPSGYVINGNGSVYSEPPVSSSDLRIMRTPYLNFSTVVNVSFMYRISGNLTGLATRFIKLDLVNSAGVVVQTLDSINISNAATTATLYSQTITVNNPGVYRFSFTMGGKTGAGSVRTSIDDLNVNAALVGCNDVVINKLLPVHLISFQGNMNKNNKVTLNWTIADNEIANDFEIERSF
Ga0247794_1003865413300024055SoilMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKT
Ga0207697_1019799013300025315Corn, Switchgrass And Miscanthus RhizosphereMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVN
Ga0207682_1017947113300025893Miscanthus RhizosphereMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTIADNEIAGNFEIEKSFNGRDFTTVGVVFASEKSGTEN
Ga0207662_1058253813300025918Switchgrass RhizosphereMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVNKLLPVHLINFQGNMNK
Ga0207681_1032914713300025923Switchgrass RhizosphereMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVNKLLPVHLINFQ
Ga0207681_1140804913300025923Switchgrass RhizosphereCFRRKKKSIRLIFNPKKMKKIFTLCTLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYNQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPV
Ga0207650_1183634013300025925Switchgrass RhizosphereKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMASRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDL
Ga0207644_1145277713300025931Switchgrass RhizosphereNENFNNGFAPLQADCWQFTSMMHAASPSTYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGNVRTSIDDLNVNAPVIGCDDVVVNKLLPVHLISFQGNMNKNNKVTLNWTIADN
Ga0207686_1018333513300025934Miscanthus RhizosphereMKKFFTLCYIVTLTFFANTSFAQINENFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPYLDFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSISISNAATTSTLYSQTIAINIPGVYRFSLTLGGKSGGGNVRTSIDDLNVNAPVIGCDDVVVNKLLPVHLISFQG
Ga0207658_1136047413300025986Switchgrass RhizosphereMKKFFTLCSLVTLSLFANNSFAQINENFNNGFAPLQADCWQFTSMMHAASPSPYVINGSGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYSQTFAINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVVNKLLPVHLINF
Ga0207676_1159969413300026095Switchgrass RhizosphereMKKIFTLCSLVTLSLFANNSFAQINENFDNGFTPLQADCWEFTSMMHATTPSGYVINGNGSVYSEPPVSSSDLRIMRTPYLNFSTVVNVSFMYRISGNLTGLATRFIKLDLVNSAGVVVQTLDSINISNAATTATLYSQTITVNNPGV
Ga0208890_107791913300027523SoilSIVTLSFFANNSFAQINENFENGFAPLEADCWQFIDMIHATSPSGYVINGNGSAYSQPPVSSDSLRIMRTPFLDFGTIVDVSFIYRLSGTLNGSATRFIKLDLVNSAGVIVQTLDSININNAATTSTLYSQTIAVNIPGVNRFSLTLGGKSGGGNVRTSIDDLNVNAPVIGCNDVVVNKL
Ga0207428_1059120713300027907Populus RhizosphereMSPLKFYLKKILRKTCINKMRILRLCHRKNDPSIPENHDKQSVLIPPLKRNFPVTLRLLQKKETTIRIIHFNPKKMKKIFTLCSIVTLSLFANNTFAQFNENFDNGFASLQANCWQLTDMMHATSPSGYVINGNGSAYSEPPVSSTDLRIMRTPYLIFGTTVNVSFLYRISNNLTGQATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLT
Ga0247750_101321013300027992SoilKKIFTLCTLVTLSLFANNSFAQITENFNNGLAPLQADCWQFTSMMHATSPSGYVINGSGSAYSEPPVSSDSLRIMRTPYLLFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYNQTFTINVPGVYRFSLTMGGKTGGGSVRTSIDDLNVNAPVVGCTDVVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEIASNFEIERSFNGRDYTTVGVVVASEKMGTENYMFYETTNGTD
Ga0247749_101896113300027993SoilMKKIFTLCTVVTLSLFAKNSFAQITENFDNGFAPLQADCWQFTSMMHANTPSPYVINGNGSAYSEPPVSSDSLRIMRTPFLDFGTVVDVSFMYRISSNLNGMATRFIKLDLVNSTGVIVQTLDSISISNAATTATLYSQTFAINVP
Ga0268264_1078914813300028381Switchgrass RhizosphereMKKFFTLCSIVTLSFFANNSFAQINETFENGFAPLQADCWQFTSMMHATTPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSISISNAATTSTLYSQTIAVTNPGVYRFSLTMGGKTGGGNVRTSIDDLNVNAPVIGCDDVVVN
Ga0307503_1068004713300028802SoilVCVIVRTIQVSPKNHDKQSVLIPPLKKEFPGNITTASEERKNNPFYTFNPKKMKKIFTLCFIVTLSFFTNNSNAQINESFENGFAPLQADCWQFTSMMYATTPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGSTIDISFVYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSISISNAATSPTVYSQ
Ga0310888_1004875613300031538SoilMKKFFTLCSIVILTFFANNSFAQITENFDNGFAPLQADCWQFTSMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSFNINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGGGNVRTSIDDLNVNAPVIGCDDVVVNKLLPVHLISFQGNMNKNNKVTLNWTIADNE
Ga0310888_1094301113300031538SoilIFPVTLRLLQKKEKIIRLIFNPKKMKKIFTLCILVTLSFFANNSYSQINENFNNGFAPLQADCWQFTSMMHATSPSGYVINGSGSAYSEPPVSSDSLRIMRTPYLLFGTVVDVSFMYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSISISNAATTATLYNQTFTINVPGVYRFSLTM
Ga0310886_1055468513300031562SoilMKKFFTLCSIVILTFFANNSFAQITENFDNGFAPLQADCWQFTSMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVYRFSLTMGGK
Ga0310907_1068218413300031847SoilNHDKQSVLIPLLKKKFPGNITAASEERNNNPYYTFNPKKMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYSQTIAVTNPGVY
Ga0310900_1026007013300031908SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVIVQTLDSISISNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGGGNVRTSIDDLNVNAPVIGCDDVVVNKLLPVHLISFQGNMNKNNKVTLNWTIADNEIANNFEVESSFNGRDFTTVGSVFASEKMGAENYMYYETTSGTDKVMYRLKMIDKNQKVDYSRVLIFQLKSS
Ga0310903_1069714113300032000SoilQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYNQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDVVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEI
Ga0310897_1028489013300032003SoilSVLIPPLKKKFPGNITTASEERKNNPFYTFNPKKMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSFNINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGGGNVRTSIDDLNVNAPVIGCDDVVVNKLLPVHLISFQGNMNKNNKVTLNWTIADNE
Ga0310902_1044147713300032012SoilMKKIFTLCSIVTLSLFANNSFAQINENFNNGFAPLQADCWQFTNMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGMATRFIKLDLVNSAGVVVQTLDSFSINNAATTATLYNQTIAVTNPGVYRFSLTMGGKTGAGTVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTVADN
Ga0310906_1049426913300032013SoilMKKFFTLCSIVILTFFANNSFAQITENFDNGFAPLQADCWQFTSMMHATSPSGYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSFNINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGGGNVRTSIDDLNVNAPVIGCDDLVINKLLPVHLISFQGNMNKNNKVTLNWTVADNEIANNFEIERSFNGRDYTTVGIVIASEKIGT
Ga0310890_1023840813300032075SoilMKKIFTLCSIVILTFFANNSFAQITENFDNGFAPLQADCWQFTSMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSFNINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGGGNVRTSIDDLNVNAPVIGCDDVVVNKLLPVHLISFQGNMNKNNKVTLNWTIADNEIANNFEVESSFNGRDFTTVGSVFASEKMGTENYMYYETTSGTDKVMYRLKMIDKNQKVDYSRVLIFQLKSSITNNIKIIGNPVNDKLTFSYTTPATQMIDVKVYDISGRIVLNNKINGLEGSNVISLPLSSTFKAG
Ga0310896_1008890713300032211SoilMKKIFTLCSIVILTFFANNSFAQITENFDNGFAPLQADCWQFTSMMHATSPSSYVINGNGSAYSEPPVSSDSLRIMRTPFLLFGTTIDISFVYRISGNLNGLATRFIKLDLVNSAGVVVQTLDSFNINNAATTATLYSQTIAVTNPGVYRFSLTMGGKTGGGNVRTSIDDLNVNAPVIGCDDVVVNKLLPVHLISFQGNMNKNNKVTLNWTIADNEIANNFEVERSFN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.