Metagenome Family F072455

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F072455
Family Type	Metagenome
Number of Sequences	121
Average Sequence Length	44 residues
Representative Sequence	MPRLELFPFRYRDRLTGKWVKARYVAERHEIAARYAEWEIIGSPE
Number of Associated Samples	100
Number of Associated Scaffolds	121

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	28.95 %
% of genes near scaffold ends (potentially truncated)	78.51 %
% of genes from short scaffolds (< 2000 bps)	87.60 %
Associated GOLD sequencing projects	83
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (52.066 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (15.703 % of family members)
Environment Ontology (ENVO)	Unclassified (60.331 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (73.554 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 9.59% β-sheet: 23.29% Coil/Unstructured: 67.12%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 121 Family Scaffolds
PF00072	Response_reg	4.96
PF13650	Asp_protease_2	4.13
PF04392	ABC_sub_bind	2.48
PF13975	gag-asp_proteas	2.48
PF00413	Peptidase_M10	2.48
PF00583	Acetyltransf_1	1.65
PF00486	Trans_reg_C	1.65
PF13683	rve_3	1.65
PF07589	PEP-CTERM	0.83
PF06114	Peptidase_M78	0.83
PF02735	Ku	0.83
PF14534	DUF4440	0.83
PF13751	DDE_Tnp_1_6	0.83
PF07702	UTRA	0.83
PF01548	DEDD_Tnp_IS110	0.83
PF13411	MerR_1	0.83
PF01068	DNA_ligase_A_M	0.83
PF02515	CoA_transf_3	0.83
PF13884	Peptidase_S74	0.83
PF14216	DUF4326	0.83
PF07731	Cu-oxidase_2	0.83
PF12146	Hydrolase_4	0.83
PF00211	Guanylate_cyc	0.83
PF02666	PS_Dcarbxylase	0.83
PF00271	Helicase_C	0.83
PF00665	rve	0.83
PF05977	MFS_3	0.83
PF12680	SnoaL_2	0.83
PF01804	Penicil_amidase	0.83

COG ID	Name	Functional Category	% Frequency in 121 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.48
COG5549	Predicted Zn-dependent protease	Posttranslational modification, protein turnover, chaperones [O]	2.48
COG0688	Phosphatidylserine decarboxylase	Lipid transport and metabolism [I]	0.83
COG1273	Non-homologous end joining protein Ku, dsDNA break repair	Replication, recombination and repair [L]	0.83
COG1423	ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family	Replication, recombination and repair [L]	0.83
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.83
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.83
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.83
COG2132	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)	Cell cycle control, cell division, chromosome partitioning [D]	0.83
COG2366	Acyl-homoserine lactone (AHL) acylase PvdQ	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.83
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.83
COG2814	Predicted arabinose efflux permease AraJ, MFS family	Carbohydrate transport and metabolism [G]	0.83
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.83
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.83
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.83
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
All Organisms	root	All Organisms	47.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
cellular organisms	root	All Organisms → cellular organisms	47.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	47.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	33.88 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	2.48 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.65 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	18.18 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	4.13 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	2.48 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.83 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.83 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	9.09 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4.96 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	2.48 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	1.65 %
Nevskiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	1.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	9.09 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	2.48 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	1.65 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	1.65 %
Pseudanabaenales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales	0.83 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.83 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	9.09 %
unclassified Verrucomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales	2.48 %
unclassified Methylococcaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae	1.65 %
Hydrocarboniphaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga	1.65 %
Leptolyngbyaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae	0.83 %
Ramlibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter	0.83 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	9.09 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	2.48 %
Hydrocarboniphaga effusa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga → Hydrocarboniphaga effusa	1.65 %
Methylococcaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium	1.65 %
unclassified Ramlibacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter	0.83 %
Leptolyngbya	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya	0.83 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	9.09 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	2.48 %
Hydrocarboniphaga effusa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga → Hydrocarboniphaga effusa	1.65 %
Methylococcaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium	1.65 %
Ramlibacter sp. USB13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. USB13	0.83 %
unclassified Leptolyngbya	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya	0.83 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.07 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	9.09 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	2.48 %
Hydrocarboniphaga effusa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga → Hydrocarboniphaga effusa	1.65 %
Methylococcaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium	1.65 %
Leptolyngbya sp. FACHB-321	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. FACHB-321	0.83 %
Ramlibacter sp. USB13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. USB13	0.83 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886012\|MBSR1b_contig_1993759	Not Available	1537	Open in IMG/M
2162886012\|MBSR1b_contig_3273780	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	1334	Open in IMG/M
3300003319\|soilL2_10292059	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. FACHB-321	1133	Open in IMG/M
3300004157\|Ga0062590_100348581	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	1183	Open in IMG/M
3300005295\|Ga0065707_11113249	Not Available	513	Open in IMG/M
3300005328\|Ga0070676_10157957	Not Available	1457	Open in IMG/M
3300005328\|Ga0070676_10239417	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1206	Open in IMG/M
3300005330\|Ga0070690_101305683	All Organisms → cellular organisms → Bacteria → Proteobacteria	581	Open in IMG/M
3300005331\|Ga0070670_100061652	All Organisms → cellular organisms → Bacteria	3219	Open in IMG/M
3300005331\|Ga0070670_100091808	All Organisms → cellular organisms → Bacteria	2611	Open in IMG/M
3300005333\|Ga0070677_10613641	Not Available	604	Open in IMG/M
3300005334\|Ga0068869_100160777	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	1748	Open in IMG/M
3300005335\|Ga0070666_11522322	Not Available	500	Open in IMG/M
3300005340\|Ga0070689_101007360	Not Available	741	Open in IMG/M
3300005343\|Ga0070687_100320953	Not Available	989	Open in IMG/M
3300005347\|Ga0070668_100846785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	815	Open in IMG/M
3300005347\|Ga0070668_101076864	Not Available	725	Open in IMG/M
3300005347\|Ga0070668_102036816	Not Available	530	Open in IMG/M
3300005354\|Ga0070675_100543893	Not Available	1050	Open in IMG/M
3300005355\|Ga0070671_100208491	All Organisms → cellular organisms → Bacteria	1657	Open in IMG/M
3300005356\|Ga0070674_100492890	Not Available	1019	Open in IMG/M
3300005356\|Ga0070674_100879089	Not Available	779	Open in IMG/M
3300005364\|Ga0070673_101798902	Not Available	580	Open in IMG/M
3300005367\|Ga0070667_102048787	Not Available	539	Open in IMG/M
3300005438\|Ga0070701_10779302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga → Hydrocarboniphaga effusa	650	Open in IMG/M
3300005455\|Ga0070663_101561000	Not Available	588	Open in IMG/M
3300005459\|Ga0068867_100632360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	937	Open in IMG/M
3300005459\|Ga0068867_101994789	Not Available	548	Open in IMG/M
3300005539\|Ga0068853_101262085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	714	Open in IMG/M
3300005547\|Ga0070693_101126907	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300005548\|Ga0070665_100414953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium	1355	Open in IMG/M
3300005564\|Ga0070664_100037294	All Organisms → cellular organisms → Bacteria	4086	Open in IMG/M
3300005616\|Ga0068852_100824554	Not Available	942	Open in IMG/M
3300005616\|Ga0068852_101350852	Not Available	734	Open in IMG/M
3300005617\|Ga0068859_102416114	Not Available	579	Open in IMG/M
3300005618\|Ga0068864_102681124	Not Available	504	Open in IMG/M
3300005842\|Ga0068858_101259784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	727	Open in IMG/M
3300005844\|Ga0068862_101205555	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	755	Open in IMG/M
3300005844\|Ga0068862_102434150	Not Available	535	Open in IMG/M
3300006237\|Ga0097621_101575167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	624	Open in IMG/M
3300006871\|Ga0075434_101547100	Not Available	672	Open in IMG/M
3300006881\|Ga0068865_101878926	All Organisms → cellular organisms → Bacteria → Proteobacteria	542	Open in IMG/M
3300009098\|Ga0105245_11690430	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	685	Open in IMG/M
3300009156\|Ga0111538_12464991	Not Available	653	Open in IMG/M
3300009167\|Ga0113563_11507739	Not Available	792	Open in IMG/M
3300009177\|Ga0105248_11032795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium	929	Open in IMG/M
3300009177\|Ga0105248_11340231	All Organisms → cellular organisms → Bacteria → Proteobacteria	810	Open in IMG/M
3300009177\|Ga0105248_11898117	Not Available	676	Open in IMG/M
3300009553\|Ga0105249_11002818	All Organisms → cellular organisms → Bacteria → Proteobacteria	904	Open in IMG/M
3300009553\|Ga0105249_12194186	Not Available	625	Open in IMG/M
3300009792\|Ga0126374_11388253	All Organisms → cellular organisms → Bacteria → Proteobacteria	571	Open in IMG/M
3300010396\|Ga0134126_10217599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2276	Open in IMG/M
3300010400\|Ga0134122_12823192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga → Hydrocarboniphaga effusa	539	Open in IMG/M
3300010403\|Ga0134123_11866489	Not Available	656	Open in IMG/M
3300012960\|Ga0164301_11262318	Not Available	597	Open in IMG/M
3300012987\|Ga0164307_11424478	Not Available	584	Open in IMG/M
3300013296\|Ga0157374_10744043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	995	Open in IMG/M
3300013307\|Ga0157372_10952157	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	995	Open in IMG/M
3300014325\|Ga0163163_11995045	Not Available	640	Open in IMG/M
3300014325\|Ga0163163_12524725	Not Available	572	Open in IMG/M
3300014325\|Ga0163163_12549772	All Organisms → cellular organisms → Bacteria → Proteobacteria	569	Open in IMG/M
3300014745\|Ga0157377_10198008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1274	Open in IMG/M
3300014968\|Ga0157379_11662904	All Organisms → cellular organisms → Bacteria → Proteobacteria	625	Open in IMG/M
3300015371\|Ga0132258_13075566	All Organisms → cellular organisms → Bacteria → Proteobacteria	1154	Open in IMG/M
3300015372\|Ga0132256_102237065	All Organisms → cellular organisms → Bacteria → Proteobacteria	651	Open in IMG/M
3300015374\|Ga0132255_103823623	Not Available	640	Open in IMG/M
3300017927\|Ga0187824_10276710	All Organisms → cellular organisms → Bacteria → Proteobacteria	589	Open in IMG/M
3300017947\|Ga0187785_10327024	Not Available	714	Open in IMG/M
3300017959\|Ga0187779_11046119	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300018469\|Ga0190270_13461859	Not Available	501	Open in IMG/M
3300025893\|Ga0207682_10489667	Not Available	582	Open in IMG/M
3300025901\|Ga0207688_10158632	All Organisms → cellular organisms → Bacteria → Proteobacteria	1340	Open in IMG/M
3300025901\|Ga0207688_10322138	Not Available	948	Open in IMG/M
3300025907\|Ga0207645_10146095	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1542	Open in IMG/M
3300025919\|Ga0207657_11343611	Not Available	538	Open in IMG/M
3300025921\|Ga0207652_10158510	All Organisms → cellular organisms → Bacteria → Proteobacteria	2028	Open in IMG/M
3300025923\|Ga0207681_10491709	Not Available	1003	Open in IMG/M
3300025925\|Ga0207650_10232470	Not Available	1487	Open in IMG/M
3300025930\|Ga0207701_11047188	Not Available	678	Open in IMG/M
3300025930\|Ga0207701_11573401	All Organisms → cellular organisms → Bacteria → Proteobacteria	530	Open in IMG/M
3300025931\|Ga0207644_11802988	Not Available	512	Open in IMG/M
3300025932\|Ga0207690_10036068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3199	Open in IMG/M
3300025936\|Ga0207670_11344683	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M
3300025937\|Ga0207669_10700273	Not Available	832	Open in IMG/M
3300025938\|Ga0207704_10528599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	955	Open in IMG/M
3300025938\|Ga0207704_11987105	All Organisms → cellular organisms → Bacteria → Proteobacteria	500	Open in IMG/M
3300025940\|Ga0207691_10104903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2518	Open in IMG/M
3300025942\|Ga0207689_11776653	Not Available	510	Open in IMG/M
3300025960\|Ga0207651_10567968	All Organisms → cellular organisms → Bacteria	988	Open in IMG/M
3300025962\|Ga0210070_1023966	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	715	Open in IMG/M
3300025986\|Ga0207658_10685412	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	925	Open in IMG/M
3300025986\|Ga0207658_10955917	Not Available	781	Open in IMG/M
3300025986\|Ga0207658_11598393	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300025986\|Ga0207658_11671229	Not Available	582	Open in IMG/M
3300026067\|Ga0207678_10945333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	762	Open in IMG/M
3300026088\|Ga0207641_10024124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5013	Open in IMG/M
3300026095\|Ga0207676_10946346	Not Available	847	Open in IMG/M
3300028379\|Ga0268266_11410170	Not Available	672	Open in IMG/M
3300028380\|Ga0268265_11667419	Not Available	643	Open in IMG/M
3300028381\|Ga0268264_11224107	Not Available	760	Open in IMG/M
3300031681\|Ga0318572_10949473	Not Available	511	Open in IMG/M
3300031736\|Ga0318501_10114532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1359	Open in IMG/M
3300031740\|Ga0307468_101468301	Not Available	630	Open in IMG/M
3300031748\|Ga0318492_10653790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	562	Open in IMG/M
3300031819\|Ga0318568_10075721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. USB13	1985	Open in IMG/M
3300031820\|Ga0307473_10657509	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	731	Open in IMG/M
3300031879\|Ga0306919_10661780	Not Available	805	Open in IMG/M
3300031893\|Ga0318536_10229982	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	943	Open in IMG/M
3300032180\|Ga0307471_102632203	Not Available	637	Open in IMG/M
3300032205\|Ga0307472_100409553	Not Available	1137	Open in IMG/M
3300032261\|Ga0306920_101423513	All Organisms → cellular organisms → Bacteria	993	Open in IMG/M
3300032782\|Ga0335082_10749283	All Organisms → cellular organisms → Bacteria	838	Open in IMG/M
3300032829\|Ga0335070_11212085	Not Available	692	Open in IMG/M
3300033408\|Ga0316605_11418340	Not Available	673	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	63.64%
Environmental	Environmental	36.36%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	63.64%
Terrestrial	Environmental → Terrestrial	30.58%
Aquatic	Environmental → Aquatic	5.79%

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	38.84%
Soil	Environmental → Terrestrial → Soil	30.58%
Rhizoplane	Host-Associated → Plants → Rhizoplane	20.66%
Freshwater	Environmental → Aquatic → Freshwater	4.96%
Roots	Host-Associated → Plants → Roots	4.13%
Marine	Environmental → Aquatic → Marine	0.83%

Habitat	Taxonomy	Distribution
Soil	Host-Associated → Plants → Rhizosphere → Soil	28.93%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	19.01%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	17.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.92%
Loam	Environmental → Terrestrial → Soil → Loam	7.44%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.13%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	4.13%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.31%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.48%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.65%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.83%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	28.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	17.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.92%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	9.09%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	6.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.61%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.13%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	4.13%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.31%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.48%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.65%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.65%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.83%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.83%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.83%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.83%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.83%

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	15.70%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	8.26%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	7.44%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.13%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	4.13%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.13%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.31%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.31%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	3.31%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	2.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.48%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.48%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.48%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.48%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	1.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.65%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.65%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.65%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.65%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	1.65%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.65%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.65%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.83%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.83%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.83%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.83%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.83%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.83%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017927	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025962	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300027972	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027975	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031681	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20	Environmental	Open in IMG/M
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031748	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22	Environmental	Open in IMG/M
3300031819	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MBSR1b_0778.00000830	2162886012	Miscanthus Rhizosphere	MPLELFLFPFRYRDPLTGKWVRARYVAERHEIAARYNEWEIIGAPEI
MBSR1b_0631.00000100	2162886012	Miscanthus Rhizosphere	MPRLELFPFRYRDRLTGKWVKARYVAERHEIAARY
F14TB_1029822331	3300001431	Soil	MPAPLFPFRYRDARTGKWVRARYVATRDDIAARYAEW
soilL2_102920592	3300003319	Sugarcane Root And Bulk Soil	MPRLELFPFRYRNPTTGKWIRARYVAERHEIAARDAPGDWDIIGPP*
Ga0062590_1003485811	3300004157	Soil	MPRLELFPFRYRDRLTGKWVKARYVAERHEIAARYAEWEII
Ga0065707_111132491	3300005295	Switchgrass Rhizosphere	MTPRLGLLHFRYRDARTGKWIRARYRADRDEIAARHAEWE
Ga0070676_101579571	3300005328	Miscanthus Rhizosphere	MPRLEFFPLRCWDRLTGKSVKARYVERHEIAARCAEWEIIGSV*
Ga0070676_102394172	3300005328	Miscanthus Rhizosphere	MPRLELFSFRYRDPLTGKWVKARCVAERHEISARYAEWQMVGRPGICRIV*
Ga0070690_1013056832	3300005330	Switchgrass Rhizosphere	MPRLELFPFRYRAPLTGKRVKARYVAERHEIAARYAEWDR
Ga0070670_1000616526	3300005331	Switchgrass Rhizosphere	MPRIELFPFRYRDRVTGRWETRYVAEGHEIAARYSEWETSH*
Ga0070670_1000918085	3300005331	Switchgrass Rhizosphere	MPRLELFPFRYRDGLTGQWVRARYHAERHEISKRYADTDWEISG
Ga0070677_106136411	3300005333	Miscanthus Rhizosphere	MPRLELFSFRYRDRLTGKWVRARYVAERHAIAARYTEWKIIGPREIRDV
Ga0068869_1001607771	3300005334	Miscanthus Rhizosphere	MPRLELFPFRYRDRLTGKWVKARYVAERHEIAARYAEWEIIGSPEIRD
Ga0070666_115223222	3300005335	Switchgrass Rhizosphere	MPRLELFPFRYRESFTGKWVKARYRAERHEIAARYNEWEIIGPPEIRDVDP
Ga0070689_1010073602	3300005340	Switchgrass Rhizosphere	MPKELFPFRYRDELTGKWVRARYLAERHEIAAAYKEWEIAGPPEIR
Ga0070687_1003209533	3300005343	Switchgrass Rhizosphere	RLELFAFHYRNSLTGKWVKARYVAAPHKIAARYAEWESLDRPRS*
Ga0070668_1008467851	3300005347	Switchgrass Rhizosphere	MPRLELFPLRYRDRVTGEWVKARYVAERHEIAARCSKSQMVGRPGICRIV*
Ga0070668_1010768642	3300005347	Switchgrass Rhizosphere	MPRLQLFPFRYRDDVTGKWVKARYVAEPQEIAARYSEWEIIGPPEIRDVD
Ga0070668_1020368161	3300005347	Switchgrass Rhizosphere	VPAARLELFPFRYRDRVTGKWVKARHVAERHDIAARYAEWEIIGPPEI
Ga0070675_1005438933	3300005354	Miscanthus Rhizosphere	ASFFMPRLEFFPLRCWDRLTGKSVKARYVERHEIAARCAEWEIIGSV*
Ga0070671_1002084912	3300005355	Switchgrass Rhizosphere	MPRLELFPFRYRDRVTGRWVKARYVAEGHESAARYSEWETSR*
Ga0070674_1004928902	3300005356	Miscanthus Rhizosphere	MPKELFPFRYRDELTGKWVRASYLAERHEIAERYKEWEITGS
Ga0070674_1008790891	3300005356	Miscanthus Rhizosphere	VHRLELFPFRYRDPRTGKWVRARYRAERQEIAARYAEYEIVGQAEIRE
Ga0070673_1017989021	3300005364	Switchgrass Rhizosphere	RLELFPFRYRDRVTGKWVKARYVAERHEIAARHSEWEIVGPPEIRDVVTCPLR*
Ga0070667_1020487872	3300005367	Switchgrass Rhizosphere	MPRLELFPFRYRDCLTGKWVKARYIAEREIAASHSEWEIIGPREIRDV
Ga0070701_107793022	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	MSRIELFPFRFRDRITGKWVRARYRAERDEIARRYPEYEITGPP
Ga0070663_1015610002	3300005455	Corn Rhizosphere	MPRLELFPFRYREPFTGKWVKARYRAELHEIVARYKEWEIIGPPEIREV
Ga0068867_1006323603	3300005459	Miscanthus Rhizosphere	MGRVELFPFRFRDPVTGKWTRARYKAERHEIAERYADYEIIG
Ga0068867_1019947892	3300005459	Miscanthus Rhizosphere	MPRLELFPFRYRDRLTGKWVRARYVAERQEIARRYAEWEIIGPPVGR*
Ga0070679_1009100543	3300005530	Corn Rhizosphere	MGRLVLYPFRYRDETTGKWVKARYVAELKDIEARHAQWEPTGPPEVREL
Ga0068853_1012620852	3300005539	Corn Rhizosphere	LRADRGIVCTMPRLELFSFRYRDPLTGKWVKARCVAERHEISARYAEWQMVGRPGICRIV
Ga0070693_1011269072	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	VPRLELFRFRYRNVVTGQWVRARYVAERHEIATRHKEWKIVGPPEIR
Ga0070665_1004149531	3300005548	Switchgrass Rhizosphere	MPRIELFPFRYRDRVTGRWETRYVAEGHESAARYSEWET
Ga0070664_1000372943	3300005564	Corn Rhizosphere	MPRLELFPFRYHDRITGKWVKARYVAERHEIAARYSE*
Ga0068852_1008245541	3300005616	Corn Rhizosphere	MPRLQLFPFRYRDDVTGKWVKARYVAEPQEIAARYSE
Ga0068852_1013508521	3300005616	Corn Rhizosphere	MPRLELFPFRYRDPVTRKWVRARYVAERHESPTRYSEWETLI*
Ga0068859_1024161142	3300005617	Switchgrass Rhizosphere	MPRLELFPFATTTGSGKWVKALYVAETHEIAARYTEWE
Ga0068864_1026811241	3300005618	Switchgrass Rhizosphere	MPIKELFPFRYRDPVTGKWVSARYVAERHEIAERYKEWEIAGPPECEPVLRG*
Ga0068858_1012597841	3300005842	Switchgrass Rhizosphere	MARLELFPFRYRDHLSGKWVKARYVAERQEIVARYADWEIIGPPEIRD
Ga0068862_1012055551	3300005844	Switchgrass Rhizosphere	PRLELFRFRYRDRVTGKWVGTYVAERHEIVARYAEWEMVGRPGICRIV*
Ga0068862_1024341501	3300005844	Switchgrass Rhizosphere	MPRLELFSFRYRDPLTGKWVKARCVAERHEISARYAEWQMV
Ga0097621_1015751672	3300006237	Miscanthus Rhizosphere	FRYRGRITGKWVRARYVADRHEIAARYAEWGFLRPPTLRAPS*
Ga0075434_1015471002	3300006871	Populus Rhizosphere	MPRPELFPFRYRSPVTGKWVRARYLAEWLEIIERYVEWEIIGPPEIRYADPASES
Ga0068865_1018789262	3300006881	Miscanthus Rhizosphere	MPRLELFPFRYREPFTGKWVKARYRAERHEIAARYKEWEIIGPPEIR
Ga0105103_101632551	3300009085	Freshwater Sediment	MTSTIEAFPFRYRDARTGRWVKARNKAERDDIAARYAEWE
Ga0105245_116904302	3300009098	Miscanthus Rhizosphere	MAPRLELFPFRYRDPRTGKWIRARYRADRQEIASRY
Ga0111538_124649911	3300009156	Populus Rhizosphere	MAIELFPFRYRDPLTGKWVKARYLAERHEIAARYAEWEITGAPE
Ga0113563_115077392	3300009167	Freshwater Wetlands	MARLELYPFRDPLAGKWDRARYVAERHEIAARSAE*
Ga0105248_110327951	3300009177	Switchgrass Rhizosphere	MPRIELFPFRYRDRVTGRWVKTRYVAERHEIAARYPEIEIVGPA
Ga0105248_113402313	3300009177	Switchgrass Rhizosphere	MPRLELFPFRYRDPPTGKWVKARYVAERHEIAERNTDWEI
Ga0105248_118981171	3300009177	Switchgrass Rhizosphere	MPRIELFPFRYRDRVTGKWVKARYVAERHEIAARHSEWEIVGPPEI
Ga0105249_110028182	3300009553	Switchgrass Rhizosphere	VPRLELFPVRYRNPVTGKWVRARYVATREEIAKANAEWEIIGPPETREVD
Ga0105249_121941862	3300009553	Switchgrass Rhizosphere	MPRLELFPFATTTGSGKWVKALYVAETHEIAARYTEWEIIGRPEIRDVDP
Ga0126374_113882531	3300009792	Tropical Forest Soil	MALTLYPFRYRDQRTGKWHQARYLAELHEISARYAEWEIIGPPEVRPDQDGGHFT
Ga0134126_102175995	3300010396	Terrestrial Soil	MRRLLLYPFRYRDEATGKWVKARYVAEWHDIEARHAQWEP
Ga0134122_128231922	3300010400	Terrestrial Soil	MSRIELFPFRFRDRITGKWVRARYRAERDEIARRYPEYEITGPPE
Ga0134123_118664891	3300010403	Terrestrial Soil	MFKALFPFRYRDEVTGQWVPARYLAERREIGAARTHA*
Ga0164301_112623182	3300012960	Soil	MGRLVLYPFRYRDETTGKWVKARYVAELKDIEARHAQWE
Ga0164307_114244782	3300012987	Soil	MPRLELFPFRYRESFTGKWVKARYRAERHEIAARYN
Ga0157374_107440432	3300013296	Miscanthus Rhizosphere	MRRLLLYPFRYRDEATGKWVKARYVAEWHDIEARHAQWEPTGPP
Ga0157372_109521573	3300013307	Corn Rhizosphere	MGRLVLYPFRYRDETTGKWVKARYVAELKDIEARHAQWEPTG
Ga0163163_118542241	3300014325	Switchgrass Rhizosphere	MKLFPFRYRDPLTDKWVRARYKAELHEIADRYREW
Ga0163163_119950451	3300014325	Switchgrass Rhizosphere	MPRIELFPFRYRDPVTRKWVRARYVAERHESPTRYSEWETSHLS
Ga0163163_125247251	3300014325	Switchgrass Rhizosphere	MPRLELFPFRYRDRLTGKWVRARYVAERHEIAARYAAWEIIGPPEIRDV
Ga0163163_125497722	3300014325	Switchgrass Rhizosphere	MPRVELFAFHYRDPRTGRWIRARYRAERHEIASRHAEFEIIGAPE
Ga0157377_101980081	3300014745	Miscanthus Rhizosphere	MPRLELFPFRYRDRVTGKWLKARYVAERHEVAARCSKSQMVGRPGICRIV*
Ga0157379_116629042	3300014968	Switchgrass Rhizosphere	MPRLELFPFRYREPFTGKWAKARYRAERHEIAARYQEWEITGPPEIGDVDP
Ga0132258_130755662	3300015371	Arabidopsis Rhizosphere	VRIELFPFRFRDPVTGKWVRARYHPEPHEIATRYVEWEITGPAEVHDS*
Ga0132256_1022370652	3300015372	Arabidopsis Rhizosphere	MPRLELFPFRYRDRLTGKWVKARYFAERHEIAARYSEWEIVGPP
Ga0132255_1038236232	3300015374	Arabidopsis Rhizosphere	MPRLELFPFATTTGSGKWVKALYVAETHEIAARYTEWEIIGR
Ga0187824_102767101	3300017927	Freshwater Sediment	MGRMRRLLLYPFCYRDETTGKWVKARYVAELHEIEAR
Ga0187785_103270241	3300017947	Tropical Peatland	MPRGFFQFRYRDPLTGKMVKARYRAERHEITARYAEWELIEPPERSRGR
Ga0187779_110461191	3300017959	Tropical Peatland	MPRELFPFRFRDSVTGKWVRARYVTEHHEIAARYKEWEIAGAPEIR
Ga0190270_134618592	3300018469	Soil	MAPRIEPFNFRYRDPRTGKWIRARYRAERHEIAARYAEGEITGPAEV
Ga0207682_104896672	3300025893	Miscanthus Rhizosphere	MPLELFLFPFRYRDPLTGKWVRARYVAERHEIAARYNEWEIIGAPEIRQGG
Ga0207688_101586322	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	PRAAGPFRYHDRITGKWVKARYVAERHEIAARYSE
Ga0207688_103221383	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MPRLQLFPFRYRDRVTGKWAKARYVAEPQEIAARYERVGD
Ga0207645_101460951	3300025907	Miscanthus Rhizosphere	IAASFFMPRLEFFPLRCWDRLTGKSVKARYVERHEIAARCAEWEIIGSV
Ga0207657_113436111	3300025919	Corn Rhizosphere	MPRLELFPFRYRDRLTGKWVEARYVAERHEIAARYAEWEIIGSPEIRRYRTRS
Ga0207652_101585101	3300025921	Corn Rhizosphere	MRRLLLYPFRYRDEATGKWVKARYVAEWHDIEARHAQWEPT
Ga0207681_104917092	3300025923	Switchgrass Rhizosphere	MPRLELFPFRYHDRITGKWVKARYVAERHEIAARYSE
Ga0207650_102324706	3300025925	Switchgrass Rhizosphere	MPRLEQFPFRYRDRVTGKWVRARYVAERHEIAARYAEWEIIGPPEIRDVD
Ga0207701_110471882	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MPRLELFPFRYRDRVTGKCVKARYVAERHEIAARYTEWEIIGPPEI
Ga0207701_115734011	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MPKELFPFRYRDELTGKWVRASYLAERHEIAERYKEWEI
Ga0207644_118029881	3300025931	Switchgrass Rhizosphere	MPRIELFPFRYRDRVTGKWVKARYVAERHEIAARHSEW
Ga0207690_100360686	3300025932	Corn Rhizosphere	MPRLELFPFRYRDRLTGKWVKARYVAERHEIAARYAEWEIIGSPE
Ga0207670_113446831	3300025936	Switchgrass Rhizosphere	MSRELFPFRYRDPLTGKWVRARYLAERHEIAATCKEWEI
Ga0207669_107002733	3300025937	Miscanthus Rhizosphere	MPRLQLFPFRYRDRVTGKWVKARYVAEPQEIAARYSEWEIIGPPEIRD
Ga0207704_105285992	3300025938	Miscanthus Rhizosphere	MPRLELFSFRYRDPLTGKWVKARCVAERHEISARYAEWQMVGRPGICRIV
Ga0207704_119871051	3300025938	Miscanthus Rhizosphere	MRHRLHMPRLELFPFRYREPFTGKWVKARYRAERHEIAARYK
Ga0207691_101049035	3300025940	Miscanthus Rhizosphere	MPRLELFPFRYPDRITGKWVKARYVAERHEIAARYSE
Ga0207689_117766532	3300025942	Miscanthus Rhizosphere	MPRLELFPFATTTGSGKWVKALYVAETHEIAARYTEWEIIGRPEIRDVDPRA
Ga0207651_105679681	3300025960	Switchgrass Rhizosphere	MPRLELFPFRYRKPVTGKWVRARYVASREEIAKGN
Ga0210070_10239661	3300025962	Natural And Restored Wetlands	MPQLELFPFRYRDPITGKWVRAHYRAERHEIEARYVEWEITGPPEIRDVDS
Ga0207658_106854122	3300025986	Switchgrass Rhizosphere	MQSSIARMPLELYPFRYRDTPTGKWVRARYVAELHEIAARYKEWEITGAPEIRQG
Ga0207658_109559173	3300025986	Switchgrass Rhizosphere	MPRLELFPFATTTGSGKWVKALYVAETHEIAARYTEWEIIGRPEI
Ga0207658_115983932	3300025986	Switchgrass Rhizosphere	MPRLELFPFRYRDPLTGKWAKARNVAERHEIAARHGEWEIIGPPEIRNV
Ga0207658_116712291	3300025986	Switchgrass Rhizosphere	MPRLELFPFRYRDCLTGKWVKARYIAEREIAASHSEWEIIGPREIRDVD
Ga0207678_109453331	3300026067	Corn Rhizosphere	MPRLELFPFRYREPFTGKWVKARYRAELHEIVARYKEWEIIGPPEIREVD
Ga0207641_100241246	3300026088	Switchgrass Rhizosphere	MPIKELFPFRYRDPVTGKWVSARYVAERHEIAERYKEWEIAGPPECEPVLRG
Ga0207676_109463461	3300026095	Switchgrass Rhizosphere	MPKELFPFRYRDELTGKWVHARYRAERHEIAGRYKEWEITGAPEI
Ga0209668_111042192	3300027899	Freshwater Lake Sediment	PLMHYPFRFRDPVSGKWVRARYKAERTEIATRYAN
Ga0209079_100690572	3300027972	Freshwater Sediment	MTSTIEAFPFRYRDARTGRWVKARNKAERDDIAARYA
Ga0209391_100210421	3300027975	Freshwater Sediment	MTSTIEVFPFRYRDARTGKWVKARYKAERDEIAARYAEWEII
Ga0268266_114101701	3300028379	Switchgrass Rhizosphere	MANAPCLELFPFRYRDPRTGKWVRARYVATREQIADRHAEWEITGPAEIAP
Ga0268265_116674191	3300028380	Switchgrass Rhizosphere	MPRLELFSFRYRDPLTGKWVKARCVAERHEISARYAEWQMVGRPG
Ga0268264_112241071	3300028381	Switchgrass Rhizosphere	MPKELFPFRYRDELTGKWVRARYLAERHEIAAAYKE
Ga0318572_109494732	3300031681	Soil	MAPRLELFPFRFRDPRTGKWVRARYVAERHEIAARY
Ga0318501_101145321	3300031736	Soil	MAPRLELFPFRFRDPRTGKWVRVRYVAERHEIAARYAEWKI
Ga0307468_1014683012	3300031740	Hardwood Forest Soil	MAPRLELFPFRYRDERTGKWVRARYVAAFHEIAPRHAEFEIIGRAEIR
Ga0318492_106537902	3300031748	Soil	LGVEGAIVELFPFRFRDPLTGKWVRAQYVAERHEIAARYAEWEIIGPPEIRADS
Ga0318568_100757211	3300031819	Soil	VELFPFRFRDPLTGKWVRAQYVAERHEIAARYAEWEIIGPPEIRADSTDG
Ga0307473_106575091	3300031820	Hardwood Forest Soil	MPRLELFAFRYRDARTGKWVRARYVAERHEIAARYAEYGLIEPPEIREVGAD
Ga0306919_106617802	3300031879	Soil	MAPRLELFPFRFRDPRTGKWVRVRYVAERHEIAARYAEWKITGPAE
Ga0318536_102299821	3300031893	Soil	MAPRLELFPFRFRDPRTGKWVRARYVAERHEIAARYAEWKI
Ga0307471_1026322033	3300032180	Hardwood Forest Soil	MAPRLELYPFRYRDPRTGKWVRSRYVAERHEIKARYV
Ga0307472_1004095532	3300032205	Hardwood Forest Soil	MAPRLELFPFRYRDERTGKWVRARYVAAFHEIAARHAEFEITRFAT
Ga0306920_1014235132	3300032261	Soil	MARLELFLFRYRDSRTGKWMLARYRAELHEIVARYTEFEVVGPPEICEI
Ga0335082_107492832	3300032782	Soil	MVPRLELFPFRYRDERTGKWVRARYVAELHEIKARYADFEIIG
Ga0335070_112120851	3300032829	Soil	MVPRLELFPFRYRDERTGKWVRARYVAELHEIKARYADFEII
Ga0316605_114183401	3300033408	Soil	MPTTIELFPFRYRDPRTGKWVRARYMATREEIAARYAELEIIGSGELRRPRTG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F072455

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences