Basic Information | |
---|---|
Family ID | F072423 |
Family Type | Metagenome |
Number of Sequences | 121 |
Average Sequence Length | 40 residues |
Representative Sequence | LDCGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 121 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.17 % |
% of genes from short scaffolds (< 2000 bps) | 85.95 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.909 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (24.793 % of family members) |
Environment Ontology (ENVO) | Unclassified (79.339 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.777 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 121 Family Scaffolds |
---|---|---|
PF00462 | Glutaredoxin | 58.68 |
PF01641 | SelR | 23.14 |
PF00850 | Hist_deacetyl | 5.79 |
PF02826 | 2-Hacid_dh_C | 4.96 |
PF04773 | FecR | 1.65 |
PF11924 | IAT_beta | 1.65 |
PF07350 | DUF1479 | 1.65 |
PF01810 | LysE | 0.83 |
PF01266 | DAO | 0.83 |
PF01738 | DLH | 0.83 |
COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
---|---|---|---|
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 23.14 |
COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 11.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.91 % |
Unclassified | root | N/A | 9.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001349|JGI20160J14292_10026580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3096 | Open in IMG/M |
3300001964|GOS2234_1058546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
3300002033|GOS24894_10305701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1689 | Open in IMG/M |
3300002040|GOScombined01_104886822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
3300004279|Ga0066605_10362582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 524 | Open in IMG/M |
3300005239|Ga0073579_1679781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1418 | Open in IMG/M |
3300005510|Ga0066825_10119092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 965 | Open in IMG/M |
3300005838|Ga0008649_10363437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 532 | Open in IMG/M |
3300005931|Ga0075119_1041444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1202 | Open in IMG/M |
3300005941|Ga0070743_10097924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 986 | Open in IMG/M |
3300005942|Ga0070742_10024216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1619 | Open in IMG/M |
3300005971|Ga0066370_10053158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1274 | Open in IMG/M |
3300006027|Ga0075462_10250698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 524 | Open in IMG/M |
3300006337|Ga0068495_1063115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 711 | Open in IMG/M |
3300007681|Ga0102824_1189406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 542 | Open in IMG/M |
3300007962|Ga0102907_1148941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 603 | Open in IMG/M |
3300009058|Ga0102854_1242617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 517 | Open in IMG/M |
3300009071|Ga0115566_10039685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3278 | Open in IMG/M |
3300009071|Ga0115566_10559581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 644 | Open in IMG/M |
3300009071|Ga0115566_10720315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 552 | Open in IMG/M |
3300009077|Ga0115552_1361002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 575 | Open in IMG/M |
3300009172|Ga0114995_10047415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2463 | Open in IMG/M |
3300009172|Ga0114995_10204757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1095 | Open in IMG/M |
3300009172|Ga0114995_10805676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 515 | Open in IMG/M |
3300009420|Ga0114994_10354450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 974 | Open in IMG/M |
3300009420|Ga0114994_10446149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 855 | Open in IMG/M |
3300009422|Ga0114998_10166039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1058 | Open in IMG/M |
3300009425|Ga0114997_10058656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2448 | Open in IMG/M |
3300009425|Ga0114997_10191880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1181 | Open in IMG/M |
3300009425|Ga0114997_10344910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
3300009425|Ga0114997_10504310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 644 | Open in IMG/M |
3300009447|Ga0115560_1049671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1861 | Open in IMG/M |
3300009481|Ga0114932_10517981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
3300009498|Ga0115568_10049112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2234 | Open in IMG/M |
3300009498|Ga0115568_10211652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 889 | Open in IMG/M |
3300009512|Ga0115003_10881841 | Not Available | 520 | Open in IMG/M |
3300009526|Ga0115004_10302542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium | 949 | Open in IMG/M |
3300009705|Ga0115000_10129594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1687 | Open in IMG/M |
3300010300|Ga0129351_1030403 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2236 | Open in IMG/M |
3300010883|Ga0133547_10615283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2168 | Open in IMG/M |
3300010883|Ga0133547_10894205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1731 | Open in IMG/M |
3300012919|Ga0160422_10112870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1608 | Open in IMG/M |
3300012919|Ga0160422_10191315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1236 | Open in IMG/M |
3300012928|Ga0163110_11202757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
3300012954|Ga0163111_10623598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1009 | Open in IMG/M |
3300012954|Ga0163111_10928291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 836 | Open in IMG/M |
3300012954|Ga0163111_11564549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 654 | Open in IMG/M |
3300017697|Ga0180120_10058337 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
3300017717|Ga0181404_1016526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1919 | Open in IMG/M |
3300017734|Ga0187222_1026793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1386 | Open in IMG/M |
3300017740|Ga0181418_1102060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 695 | Open in IMG/M |
3300017756|Ga0181382_1196239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 511 | Open in IMG/M |
3300017770|Ga0187217_1029325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1951 | Open in IMG/M |
3300017783|Ga0181379_1032823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2052 | Open in IMG/M |
3300018428|Ga0181568_10275470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1377 | Open in IMG/M |
3300020251|Ga0211700_1037107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 526 | Open in IMG/M |
3300020312|Ga0211542_1087422 | Not Available | 543 | Open in IMG/M |
3300020362|Ga0211488_10207887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 526 | Open in IMG/M |
3300020371|Ga0211500_1069656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1069 | Open in IMG/M |
3300020391|Ga0211675_10144695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1063 | Open in IMG/M |
3300020391|Ga0211675_10446786 | Not Available | 528 | Open in IMG/M |
3300020396|Ga0211687_10241540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 722 | Open in IMG/M |
3300020401|Ga0211617_10133047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1038 | Open in IMG/M |
3300020403|Ga0211532_10413197 | Not Available | 502 | Open in IMG/M |
3300020404|Ga0211659_10261777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 766 | Open in IMG/M |
3300020405|Ga0211496_10393907 | Not Available | 516 | Open in IMG/M |
3300020417|Ga0211528_10312112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
3300020424|Ga0211620_10034276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2210 | Open in IMG/M |
3300020424|Ga0211620_10480456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 523 | Open in IMG/M |
3300020442|Ga0211559_10091494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1469 | Open in IMG/M |
3300020442|Ga0211559_10292472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 760 | Open in IMG/M |
3300020446|Ga0211574_10272517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
3300020454|Ga0211548_10615015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 530 | Open in IMG/M |
3300020455|Ga0211664_10561442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 518 | Open in IMG/M |
3300020460|Ga0211486_10530696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 500 | Open in IMG/M |
3300020461|Ga0211535_10035347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2072 | Open in IMG/M |
3300020463|Ga0211676_10147925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1481 | Open in IMG/M |
3300020465|Ga0211640_10538039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
3300020469|Ga0211577_10153422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1550 | Open in IMG/M |
3300020470|Ga0211543_10084545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1633 | Open in IMG/M |
3300020595|Ga0206126_10062364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1963 | Open in IMG/M |
3300021375|Ga0213869_10351083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 615 | Open in IMG/M |
3300021375|Ga0213869_10452906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
3300021378|Ga0213861_10125757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1489 | Open in IMG/M |
3300021378|Ga0213861_10401516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 673 | Open in IMG/M |
3300023178|Ga0255759_10295957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1020 | Open in IMG/M |
3300023245|Ga0222655_1031556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
3300023294|Ga0222670_1027120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1001 | Open in IMG/M |
(restricted) 3300024260|Ga0233441_1126329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 837 | Open in IMG/M |
(restricted) 3300024327|Ga0233434_1300593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 543 | Open in IMG/M |
(restricted) 3300024336|Ga0233447_1009995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4464 | Open in IMG/M |
3300025636|Ga0209136_1092712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 890 | Open in IMG/M |
3300025667|Ga0209043_1069090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 999 | Open in IMG/M |
3300025685|Ga0209095_1197760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
3300025688|Ga0209140_1080237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1043 | Open in IMG/M |
3300025699|Ga0209715_1166244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 725 | Open in IMG/M |
3300025803|Ga0208425_1036783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1252 | Open in IMG/M |
3300025830|Ga0209832_1071964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1162 | Open in IMG/M |
3300025880|Ga0209534_10448220 | Not Available | 544 | Open in IMG/M |
3300025890|Ga0209631_10229876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 936 | Open in IMG/M |
3300025892|Ga0209630_10071276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1973 | Open in IMG/M |
3300026085|Ga0208880_1008595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2082 | Open in IMG/M |
3300027687|Ga0209710_1033119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2518 | Open in IMG/M |
3300027704|Ga0209816_1111225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium | 1046 | Open in IMG/M |
3300027752|Ga0209192_10192775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 781 | Open in IMG/M |
3300027774|Ga0209433_10058199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1389 | Open in IMG/M |
3300027779|Ga0209709_10021956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4150 | Open in IMG/M |
3300027779|Ga0209709_10070282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1934 | Open in IMG/M |
3300027791|Ga0209830_10030934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2995 | Open in IMG/M |
3300027801|Ga0209091_10024812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3760 | Open in IMG/M |
3300027813|Ga0209090_10270157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 853 | Open in IMG/M |
3300027839|Ga0209403_10544932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 576 | Open in IMG/M |
3300031519|Ga0307488_10118312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1902 | Open in IMG/M |
3300031519|Ga0307488_10371020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 895 | Open in IMG/M |
3300031627|Ga0302118_10055511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2013 | Open in IMG/M |
3300031630|Ga0308004_10323735 | Not Available | 589 | Open in IMG/M |
3300031644|Ga0308001_10308580 | Not Available | 593 | Open in IMG/M |
3300031659|Ga0307986_10413778 | Not Available | 535 | Open in IMG/M |
3300031775|Ga0315326_10931847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 534 | Open in IMG/M |
3300032073|Ga0315315_11305782 | Not Available | 637 | Open in IMG/M |
3300032360|Ga0315334_11701810 | Not Available | 537 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 24.79% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 22.31% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 8.26% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.96% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.13% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.31% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.31% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.31% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.48% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.48% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.48% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.48% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 1.65% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.65% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.65% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.65% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.65% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.65% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.65% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.83% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.83% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.83% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.83% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
3300001964 | Marine microbial communities from Rosario Bank, Honduras - GS018 | Environmental | Open in IMG/M |
3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
3300007962 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 | Environmental | Open in IMG/M |
3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020251 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040) | Environmental | Open in IMG/M |
3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
3300020362 | Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX556035-ERR599049) | Environmental | Open in IMG/M |
3300020371 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555978-ERR598991) | Environmental | Open in IMG/M |
3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
3300023245 | Saline water microbial communities from Ace Lake, Antarctica - #423 | Environmental | Open in IMG/M |
3300023294 | Saline water microbial communities from Ace Lake, Antarctica - #732 | Environmental | Open in IMG/M |
3300024260 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MG | Environmental | Open in IMG/M |
3300024327 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_120_MG | Environmental | Open in IMG/M |
3300024336 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_135_MG | Environmental | Open in IMG/M |
3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025667 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
3300025688 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
3300027774 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes) | Environmental | Open in IMG/M |
3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI20160J14292_100265801 | 3300001349 | Pelagic Marine | DLLNLLHSDYGEKELIKKVSSIEKNLNTLEKKLLVKLKRMTIYK* |
GOS2234_10585463 | 3300001964 | Marine | IMEKKGSMKKVLNIERNLNTLENKYLVKLKKVIIYSL* |
GOS24894_103057011 | 3300002033 | Marine | DHSNPPHLDYGEKGFMKKVSNIERNLNTLENKYLVKLKKMIIYSL |
GOScombined01_1048868221 | 3300002040 | Marine | HHLDHGEKGFMKKVSNIEKNLNTLENKYLVKLKKVIIYSL* |
Ga0066605_103625821 | 3300004279 | Marine | LFLLDCGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI* |
Ga0073579_16797814 | 3300005239 | Marine | MRRSVKPLRLDYGEKELIKKVLNTEKNLNILEKKLLVKLKRMIIYKL* |
Ga0066825_101190921 | 3300005510 | Marine | HLDYGEKEFTKKVLNTEKNLNTLENKYLVKLKKMIIYNL* |
Ga0008649_103634373 | 3300005838 | Marine | LDCGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI*NQ* |
Ga0075119_10414441 | 3300005931 | Saline Lake | LLDYGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI* |
Ga0070743_100979244 | 3300005941 | Estuarine | GEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI* |
Ga0070742_100242164 | 3300005942 | Estuarine | SLFLLDCGEKELIKKVLSTKKSSNILEKKLLVKLKRMIIYNP* |
Ga0066370_100531581 | 3300005971 | Marine | LNHPHLDYGEKEFTKKVLNTEKNLNTLENKYLVKLKKMIIYNL* |
Ga0075462_102506981 | 3300006027 | Aqueous | LLRLDYGEKELIKKVLNTEKNLNILEKKLLVKLKRMIIYKI* |
Ga0068495_10631151 | 3300006337 | Marine | PLDCGEKELIKKVLNIEKSLNILENKYLVKLKKVTIYNS* |
Ga0102824_11894061 | 3300007681 | Estuarine | LLDCGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI* |
Ga0102907_11489413 | 3300007962 | Estuarine | LDYGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI* |
Ga0102854_12426173 | 3300009058 | Estuarine | LDYGEKELIKKVLNTEKNLNILEKKLLVKLKRMIIYKS* |
Ga0115566_100396857 | 3300009071 | Pelagic Marine | CGEKEFIKKVLNIEKNLNTQENKLLVKLKKVIISN* |
Ga0115566_105595813 | 3300009071 | Pelagic Marine | DYGEKELIKKALNIKKNLNTQEKKLLVKLERMIIYKL* |
Ga0115566_107203151 | 3300009071 | Pelagic Marine | NLLRLDYGEKELIKKVLNTEKNLNILEKKLLVKLKRMIIYRI* |
Ga0115552_13610021 | 3300009077 | Pelagic Marine | NLLRLDYGEKELIKKVLNTEKNLNILEKKLLVKLKRMIIYKI* |
Ga0114995_100474151 | 3300009172 | Marine | NQYHLDCGEKELIKKVLNTEKSLNILEKKLLVKLKRMIIYKV* |
Ga0114995_102047571 | 3300009172 | Marine | NQYHLDCGEKELIKKVLNTEKSLNILEKKLLVKLKRMIIYKK* |
Ga0114995_108056761 | 3300009172 | Marine | SLYLLDCGEKELIKKALNIKRNSSIQEKKLLVKLKRMIIYKS* |
Ga0114994_103544504 | 3300009420 | Marine | FLLDCGEKELIKKVSSIKKNLNTLEKKLLVKSKRMIIYKL* |
Ga0114994_104461493 | 3300009420 | Marine | FLLDCGEKELIKKVLNTKKSLNIQEKKLLAKLKRMIIYKA* |
Ga0114998_101660391 | 3300009422 | Marine | LLDCGEKELIKKVLSIKRNLSIQEKKLLVKLKRMIIYNS* |
Ga0114997_100586565 | 3300009425 | Marine | DCGEKELIKKVLNTKKSSNIQEKKLLAKLKRMIIYKP* |
Ga0114997_101918801 | 3300009425 | Marine | LFLLDCGEKELIKKVLSTKKSSNIQEKKLLVKLKRMIIYKL* |
Ga0114997_103449104 | 3300009425 | Marine | CGEKELIKKASNTEKSLNTLEKKLLAKLKRMIIYKI* |
Ga0114997_105043103 | 3300009425 | Marine | FLLDCGEKELIKKVLSTKKSSNIQEKKLLVKLKRMIIYRS* |
Ga0115560_10496711 | 3300009447 | Pelagic Marine | CGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI* |
Ga0114932_105179811 | 3300009481 | Deep Subsurface | ELSNLPLSDYGEKEFTKKVLNIEKNLNIQENKLLVKLKKVIIFKK* |
Ga0115568_100491125 | 3300009498 | Pelagic Marine | GEKEFIKKVLNIEKNLNTQENKLLVKLKKVIISN* |
Ga0115568_102116523 | 3300009498 | Pelagic Marine | GEKELIKKVSSIEKNLNTLEKKLLVKLKRMTIYKL* |
Ga0115003_108818413 | 3300009512 | Marine | DCGEKELIKKVLNTKKSSNIQEKKLLVKLKRMIIYKS* |
Ga0115004_103025423 | 3300009526 | Marine | FLLDCGEKELIKKVLNTKKSSNIQEKKLLAKLKRMIIYES* |
Ga0115000_101295945 | 3300009705 | Marine | LLDCGEKELIKKASNTEKSLNTLEKKLLAKLKRMIIYKI* |
Ga0129351_10304035 | 3300010300 | Freshwater To Marine Saline Gradient | EKEFIKKVLNIEKNLNTQEKKLLVKLKKVIIPNL* |
Ga0133547_106152831 | 3300010883 | Marine | SLFLLGCGEKELIKKVLNTKKSSNIQGKKLLVKLKRMIIYNS* |
Ga0133547_108942056 | 3300010883 | Marine | LLDCGEKELIKKVLNIKKNLNIPGKKLLAKLKRMIIYRI* |
Ga0160422_101128705 | 3300012919 | Seawater | PHLDYGEKEFMKKVSNIEKNLNILENKCLVKLKKVITYNS* |
Ga0160422_101913153 | 3300012919 | Seawater | GEKEFIKKVSNTEKNLNIQENKLLVKLKKVIICNL* |
Ga0163110_112027571 | 3300012928 | Surface Seawater | DRLNHLHLDYGEKEFTKKVLNIEKNLNFLENKCLVKLKKVIIYNL* |
Ga0163111_106235981 | 3300012954 | Surface Seawater | EKEFMKKVLNIEKNLNILENKYLVKLKKMIIYNL* |
Ga0163111_109282914 | 3300012954 | Surface Seawater | HLDCGEKEFMKKVLNIEKNLNILEKNYLVKLKKVIIYN* |
Ga0163111_115645491 | 3300012954 | Surface Seawater | DYGEKEFMKKVLNIEKNLNTLENKCLVKLEKVIIYNL* |
Ga0180120_100583374 | 3300017697 | Freshwater To Marine Saline Gradient | LLDYGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKIXKQ |
Ga0181404_10165265 | 3300017717 | Seawater | LSNHLLLDCGEKEFIKKVLNIEKNLNTQENKLLVKLKKVIISN |
Ga0187222_10267931 | 3300017734 | Seawater | EDHLNHLHLDYGEKEFTKKVLNIEKNLNFLENKCLVK |
Ga0181418_11020603 | 3300017740 | Seawater | YGEKELIKKVLNIKKSSNIQEKKLLVKLKRMIIYKSXNQ |
Ga0181382_11962391 | 3300017756 | Seawater | LDYGEKEFMKKALNIEKNLNTLEKLYLVKLKKVITYNVXKK |
Ga0187217_10293254 | 3300017770 | Seawater | DYGEKELIKKVSSIEKNLNTLEKKLLVKLKRMTIYNIXNQ |
Ga0181379_10328236 | 3300017783 | Seawater | CGEKEFIKKVLNIEKNLNTQENKLLVKLKKVIISN |
Ga0181568_102754703 | 3300018428 | Salt Marsh | MSSKLXEEILNHLHLDYGEKEFMKKVSNIGKNLNTLENKCLVKLKKVIIYNL |
Ga0211700_10371071 | 3300020251 | Marine | LDYGEKEFMKKVSNIEKNLNTLENKYLVKLKKVIIYNL |
Ga0211542_10874222 | 3300020312 | Marine | ENLSNHHHLDYGEKEFIKKVLNTEKNLNIQENKLLVK |
Ga0211488_102078873 | 3300020362 | Marine | GEKEFMKKVLNIEKNLNIQENKYLVKLKKVIIYKL |
Ga0211500_10696563 | 3300020371 | Marine | SNHPHLDYGEKGFMKKVLNIEKNLNTLENKYLVKLKKVIIYSL |
Ga0211675_101446954 | 3300020391 | Marine | HLDYGEKELIKKVSNIEKSLNILENKLLVKLKKVITYNL |
Ga0211675_104467863 | 3300020391 | Marine | NHPHLDFGGKELIKKVLNIKKNLNTHGNKLLVKLKKVIIFKEXKM |
Ga0211687_102415401 | 3300020396 | Marine | LDCGEKELIKKVLNTKKNLNIQEKKLLVKLKRMIIYNT |
Ga0211617_101330474 | 3300020401 | Marine | YGEKEFTKKVLNIEKNLNFLENKCLVKLKKVIIYNL |
Ga0211532_104131971 | 3300020403 | Marine | EDLLNHPHLDYGEKEFTKKALNIEKNLNILENKYLVKLKKMIICKS |
Ga0211659_102617773 | 3300020404 | Marine | LGCGENELIRKVLNIEKNLNTRENKLLVKLKRMIIYKL |
Ga0211496_103939073 | 3300020405 | Marine | LGYGEKEFMKKASNIEKSLNTLEKLYLVKLKKVIIYKL |
Ga0211528_103121121 | 3300020417 | Marine | HLNHLHLDYGEKEFTKKVSNIEKNLNILENKCLVKLKKVIIYNS |
Ga0211620_100342763 | 3300020424 | Marine | PHLDYGEKEFIKKVSNTEKNLSIQENKYLVKLKKAIIYKL |
Ga0211620_104804563 | 3300020424 | Marine | HLDYGEKEFIKKVSNTEKNLNIQEKKLLVKLKKVITCK |
Ga0211559_100914941 | 3300020442 | Marine | DYGEKEFMKKVSNIGKNLNTLENKCLVKLKKVIIYNL |
Ga0211559_102924721 | 3300020442 | Marine | DYGEKEFMKKVSNIGKNLNTLENKCLVKLKKVIIYNS |
Ga0211574_102725171 | 3300020446 | Marine | LLNHPHLDYGEKEFTKKVLNTEKNLNTLENKYLVKLKKMIIYNL |
Ga0211548_106150151 | 3300020454 | Marine | DHSNPPHLDYGEKEFMKKVSNIEKNLNTLENKYLVKLKKVIIYSL |
Ga0211664_105614423 | 3300020455 | Marine | HLDYGEKEFMKKALNIEKNLNTLEKLYLVKLKKVITYNV |
Ga0211486_105306963 | 3300020460 | Marine | HPHLDYGEKEFMKKVSNIEKNLNILENKCLVKLKKVITYNS |
Ga0211535_100353473 | 3300020461 | Marine | LSNHPHLDYGEKEFIKKVSNTEKNLSIQENKYLVKLKKAIIYKL |
Ga0211676_101479254 | 3300020463 | Marine | YGEKELIKKVSNIEKSLNILENKLLLKLKKVIIYNK |
Ga0211640_105380391 | 3300020465 | Marine | NHHLLDYGEKEFMKKVLNIEKNLNTLEKLYLVKLKKVIIYKE |
Ga0211577_101534224 | 3300020469 | Marine | EDLLNQLLLDYGEKELTKKVLNTEKNLNTLEKKLLVKLKKVTTYSL |
Ga0211543_100845453 | 3300020470 | Marine | SPPHLDCGEKEFTKKVLNIEKNLNILENKFLVKLKKVIIYRL |
Ga0206126_100623645 | 3300020595 | Seawater | FLLDCGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI |
Ga0213869_103510831 | 3300021375 | Seawater | FLLDCGEKELIKKVLNIGKNLNTLEKKLLVKLKRMIIYKI |
Ga0213869_104529063 | 3300021375 | Seawater | LLLDYGEKEFIKKVLNIEKNLNTQENKLLVKLKKVIISN |
Ga0213861_101257571 | 3300021378 | Seawater | NHLLLDCGEKEFIKKVLNIEKNLNTQENKLLVKLKKVIISN |
Ga0213861_104015163 | 3300021378 | Seawater | NLLRLDYGEKELTKKVLNTEKNLNILEKKLLVKLKRMIIYKT |
Ga0255759_102959574 | 3300023178 | Salt Marsh | LHSDYGEKEFMKKVSNIGKNLNTLENKCLVKLKKVIIYNL |
Ga0222655_10315564 | 3300023245 | Saline Water | LFLLDCGEKELIKKVLNTKKSSNIQEKKLLAKLKRTIIYKI |
Ga0222670_10271203 | 3300023294 | Saline Water | LDCGEKELIKKVLNTKKSSNIQEKKLLAKLKRMIIYKS |
(restricted) Ga0233441_11263294 | 3300024260 | Seawater | LDCGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI |
(restricted) Ga0233434_13005933 | 3300024327 | Seawater | DCGEKELIKKVLSIKRNLSIQEKKLLVKLKRMIIYNL |
(restricted) Ga0233447_10099957 | 3300024336 | Seawater | DCGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI |
Ga0209136_10927121 | 3300025636 | Marine | LDYGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKI |
Ga0209043_10690904 | 3300025667 | Marine | LLDYGEKELIKKALNIKKNLNTLEKKLLVKLKRMIIYKIXNQ |
Ga0209095_11977603 | 3300025685 | Pelagic Marine | LLLDYGEKEFIKKVLNIEKNLNTQENKLLVKLKKVIISNL |
Ga0209140_10802374 | 3300025688 | Marine | FLLDCGEKELIKKVLNIEKNLNTLEKKLLVKLKRMIIYKIXNQ |
Ga0209715_11662441 | 3300025699 | Pelagic Marine | LFLLDCGEKELIKKALNIKKNLNTQEKKLLVKLERMIIYKLXNQ |
Ga0208425_10367831 | 3300025803 | Aqueous | LDCGEKELTKKVLNTEKNLNILEKKLLVKLKRMIIYKL |
Ga0209832_10719645 | 3300025830 | Pelagic Marine | DYGEKEFIKKVLNIEKNLNTQENKLLVKLKKVIISNL |
Ga0209534_104482203 | 3300025880 | Pelagic Marine | FLLDCGEKELTKKVLSTKKSSNILEKKLLVKLERMIIYNP |
Ga0209631_102298764 | 3300025890 | Pelagic Marine | EKGLIKKVLNTKKSSNIQEKKLLVKLKRMIIYKSXNQ |
Ga0209630_100712761 | 3300025892 | Pelagic Marine | GEKELIKKVLNIEKNLNTLEKKLLAKLKRMIIYKL |
Ga0208880_10085951 | 3300026085 | Marine | EHLNLHLLDCGGKEFMKKVLNIEKNLNIQENKYLVKLKKVIIYKL |
Ga0209710_10331195 | 3300027687 | Marine | CLLDCGEKELIKKASNTEKSLNTLEKKLLAKLKRMIIYKI |
Ga0209816_11112253 | 3300027704 | Marine | DCGEKELTKKVLNIRRSLNILEKKLLVKLKRMIIYRLXKQ |
Ga0209192_101927751 | 3300027752 | Marine | LYLLDCGEKELIKKALNIKRNSSIQEKKLLVKLKRMIIYKSXNQ |
Ga0209433_100581994 | 3300027774 | Marine | NLSNHPHLDYGEKEFIKKVSNTEKNLNIQENKLLVK |
Ga0209709_100219567 | 3300027779 | Marine | LDCGEKELIKKVLNTKKSSNIQEKKLLAKLKRMIIYKP |
Ga0209709_100702825 | 3300027779 | Marine | CGEKELIKKASNTEKSLNTLEKKLLAKLKRMIIYKI |
Ga0209830_100309341 | 3300027791 | Marine | LLDCGERELIKKVLNTEKSLNIPEKKLLAKLKRMIIYNS |
Ga0209091_100248121 | 3300027801 | Marine | LGCGEKGLIKKVLNIEKNLNILEKKLLVKLKRMIIYKI |
Ga0209090_102701573 | 3300027813 | Marine | LFLLDCGEKELIKKVLNTKKSLNIQEKKLLAKLKRMIIYKA |
Ga0209403_105449323 | 3300027839 | Marine | CGEKELIKKVLNIEKSLNTPEKKLLVKLKRMIIYKI |
Ga0307488_101183125 | 3300031519 | Sackhole Brine | LLDCGEKELIKKALSIKRNSSIQEKKLLVKLKRMIIYNP |
Ga0307488_103710204 | 3300031519 | Sackhole Brine | GEKELIKKALSIKRNLSIQEKKLLVKLKRMIIYNSXNQ |
Ga0302118_100555111 | 3300031627 | Marine | FLLGCGEKGLIKKVLNIEKNLNILEKKLLVKLKRMIIYKI |
Ga0308004_103237351 | 3300031630 | Marine | LDCGEKELIKKVLNIERNLNILEKKLLVKLKRMIIYNSXKL |
Ga0308001_103085801 | 3300031644 | Marine | CGERELIKKVLNIERNLNILEKKLLVKLKRMIIYNSXKL |
Ga0307986_104137783 | 3300031659 | Marine | CGEKELIKKVLNTKKNLNILGKKLLVKLKRMTIYK |
Ga0315326_109318473 | 3300031775 | Seawater | KELIKKVLNIEKNLNIPEKKLVVKLKKMIIYNPXKM |
Ga0315315_113057823 | 3300032073 | Seawater | LNLLLLDCGEKELIKKVLNIEKNLNTLEKKLLVKLKRMTIYNI |
Ga0315334_117018103 | 3300032360 | Seawater | FFLDCGEKELIKKALNIEKNLNTPEKKYLVKLKRMTIYKL |
⦗Top⦘ |