| Basic Information | |
|---|---|
| Family ID | F072412 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 90.08 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.521 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (12.397 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.537 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.669 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.89% β-sheet: 19.44% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF02224 | Cytidylate_kin | 81.82 |
| PF13207 | AAA_17 | 1.65 |
| PF01641 | SelR | 1.65 |
| PF01042 | Ribonuc_L-PSP | 0.83 |
| PF02661 | Fic | 0.83 |
| PF13415 | Kelch_3 | 0.83 |
| PF00351 | Biopterin_H | 0.83 |
| PF10136 | SpecificRecomb | 0.83 |
| PF02954 | HTH_8 | 0.83 |
| PF02567 | PhzC-PhzF | 0.83 |
| PF00483 | NTP_transferase | 0.83 |
| PF00005 | ABC_tran | 0.83 |
| PF13620 | CarboxypepD_reg | 0.83 |
| PF11950 | DUF3467 | 0.83 |
| PF00152 | tRNA-synt_2 | 0.83 |
| PF00756 | Esterase | 0.83 |
| PF01336 | tRNA_anti-codon | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 81.82 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 1.65 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.83 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.83 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG3186 | Phenylalanine-4-hydroxylase | Amino acid transport and metabolism [E] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.52 % |
| Unclassified | root | N/A | 2.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002074|JGI24748J21848_1018997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 825 | Open in IMG/M |
| 3300004082|Ga0062384_100962009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 608 | Open in IMG/M |
| 3300004091|Ga0062387_100158344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1314 | Open in IMG/M |
| 3300004092|Ga0062389_104738745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 512 | Open in IMG/M |
| 3300005174|Ga0066680_10765895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 585 | Open in IMG/M |
| 3300005455|Ga0070663_100001295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 13713 | Open in IMG/M |
| 3300005938|Ga0066795_10026716 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300005950|Ga0066787_10137274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 546 | Open in IMG/M |
| 3300005995|Ga0066790_10016076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3293 | Open in IMG/M |
| 3300006086|Ga0075019_11113662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 513 | Open in IMG/M |
| 3300006162|Ga0075030_100158402 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
| 3300006162|Ga0075030_100926436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 687 | Open in IMG/M |
| 3300006354|Ga0075021_10940434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 562 | Open in IMG/M |
| 3300006893|Ga0073928_10710774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 700 | Open in IMG/M |
| 3300009623|Ga0116133_1113819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 694 | Open in IMG/M |
| 3300009630|Ga0116114_1088468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 833 | Open in IMG/M |
| 3300009632|Ga0116102_1054096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1251 | Open in IMG/M |
| 3300009698|Ga0116216_10162156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1374 | Open in IMG/M |
| 3300009762|Ga0116130_1096845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 926 | Open in IMG/M |
| 3300009839|Ga0116223_10025257 | All Organisms → cellular organisms → Bacteria | 4108 | Open in IMG/M |
| 3300009839|Ga0116223_10576483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 651 | Open in IMG/M |
| 3300010341|Ga0074045_10535670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 750 | Open in IMG/M |
| 3300010343|Ga0074044_10296415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1064 | Open in IMG/M |
| 3300010343|Ga0074044_11060499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 531 | Open in IMG/M |
| 3300010364|Ga0134066_10310300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 570 | Open in IMG/M |
| 3300012205|Ga0137362_10721460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 856 | Open in IMG/M |
| 3300012362|Ga0137361_11504236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 595 | Open in IMG/M |
| 3300012683|Ga0137398_10520177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 819 | Open in IMG/M |
| 3300012923|Ga0137359_10763693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 839 | Open in IMG/M |
| 3300014159|Ga0181530_10214981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1049 | Open in IMG/M |
| 3300014200|Ga0181526_10828772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 582 | Open in IMG/M |
| 3300014491|Ga0182014_10163601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1240 | Open in IMG/M |
| 3300014492|Ga0182013_10687518 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300014498|Ga0182019_10642153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 748 | Open in IMG/M |
| 3300014499|Ga0182012_10788074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 603 | Open in IMG/M |
| 3300014638|Ga0181536_10207504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 970 | Open in IMG/M |
| 3300015264|Ga0137403_10689929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 882 | Open in IMG/M |
| 3300017822|Ga0187802_10166998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 842 | Open in IMG/M |
| 3300017929|Ga0187849_1309622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 589 | Open in IMG/M |
| 3300017933|Ga0187801_10340327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 616 | Open in IMG/M |
| 3300017934|Ga0187803_10006085 | All Organisms → cellular organisms → Bacteria | 4782 | Open in IMG/M |
| 3300017934|Ga0187803_10298821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 642 | Open in IMG/M |
| 3300017935|Ga0187848_10114269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1217 | Open in IMG/M |
| 3300017935|Ga0187848_10284665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 692 | Open in IMG/M |
| 3300017943|Ga0187819_10614081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 616 | Open in IMG/M |
| 3300018002|Ga0187868_1035622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2234 | Open in IMG/M |
| 3300018006|Ga0187804_10292353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 709 | Open in IMG/M |
| 3300018009|Ga0187884_10218110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 783 | Open in IMG/M |
| 3300018016|Ga0187880_1403719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 572 | Open in IMG/M |
| 3300018017|Ga0187872_10127745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1240 | Open in IMG/M |
| 3300018020|Ga0187861_10284439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 712 | Open in IMG/M |
| 3300018024|Ga0187881_10478348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 507 | Open in IMG/M |
| 3300018025|Ga0187885_10181310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 983 | Open in IMG/M |
| 3300018026|Ga0187857_10407582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 613 | Open in IMG/M |
| 3300018035|Ga0187875_10360851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 780 | Open in IMG/M |
| 3300018038|Ga0187855_10472779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 730 | Open in IMG/M |
| 3300018040|Ga0187862_10605972 | Not Available | 648 | Open in IMG/M |
| 3300018047|Ga0187859_10717864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 569 | Open in IMG/M |
| 3300018086|Ga0187769_10937601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 655 | Open in IMG/M |
| 3300018468|Ga0066662_10350634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1269 | Open in IMG/M |
| 3300020199|Ga0179592_10179286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 964 | Open in IMG/M |
| 3300020199|Ga0179592_10519501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 508 | Open in IMG/M |
| 3300020580|Ga0210403_10064253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2944 | Open in IMG/M |
| 3300020581|Ga0210399_10626367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 888 | Open in IMG/M |
| 3300021088|Ga0210404_10145441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1238 | Open in IMG/M |
| 3300021420|Ga0210394_11690146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 530 | Open in IMG/M |
| 3300021433|Ga0210391_10365420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
| 3300021477|Ga0210398_11368288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 554 | Open in IMG/M |
| 3300021478|Ga0210402_10927593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300022557|Ga0212123_10948802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 502 | Open in IMG/M |
| 3300023250|Ga0224544_1028193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 787 | Open in IMG/M |
| 3300025453|Ga0208455_1045985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 944 | Open in IMG/M |
| 3300025474|Ga0208479_1049176 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300025505|Ga0207929_1070571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 660 | Open in IMG/M |
| 3300025579|Ga0207927_1105411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 634 | Open in IMG/M |
| 3300025612|Ga0208691_1149321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 526 | Open in IMG/M |
| 3300025922|Ga0207646_11212653 | Not Available | 661 | Open in IMG/M |
| 3300025934|Ga0207686_10298154 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300026320|Ga0209131_1157986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1134 | Open in IMG/M |
| 3300026557|Ga0179587_11114097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 519 | Open in IMG/M |
| 3300027591|Ga0209733_1035682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1333 | Open in IMG/M |
| 3300027591|Ga0209733_1086939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 798 | Open in IMG/M |
| 3300027674|Ga0209118_1026502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1804 | Open in IMG/M |
| 3300027676|Ga0209333_1131927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 674 | Open in IMG/M |
| 3300027692|Ga0209530_1014333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2432 | Open in IMG/M |
| 3300027729|Ga0209248_10110079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 829 | Open in IMG/M |
| 3300027737|Ga0209038_10189450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 622 | Open in IMG/M |
| 3300027768|Ga0209772_10297135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 512 | Open in IMG/M |
| 3300027846|Ga0209180_10375524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 808 | Open in IMG/M |
| 3300027854|Ga0209517_10222575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1148 | Open in IMG/M |
| 3300027854|Ga0209517_10592219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 589 | Open in IMG/M |
| 3300027894|Ga0209068_10725752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 583 | Open in IMG/M |
| 3300027905|Ga0209415_11007132 | Not Available | 553 | Open in IMG/M |
| 3300027910|Ga0209583_10091377 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300027911|Ga0209698_10638645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 815 | Open in IMG/M |
| 3300028747|Ga0302219_10133476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 947 | Open in IMG/M |
| 3300028792|Ga0307504_10057603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1130 | Open in IMG/M |
| 3300029945|Ga0311330_10531865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 939 | Open in IMG/M |
| 3300030020|Ga0311344_10091980 | All Organisms → cellular organisms → Bacteria | 3488 | Open in IMG/M |
| 3300030041|Ga0302274_10216883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 933 | Open in IMG/M |
| 3300030042|Ga0302300_1147299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 680 | Open in IMG/M |
| 3300030049|Ga0302191_10242152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 670 | Open in IMG/M |
| 3300030051|Ga0302195_10029681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3345 | Open in IMG/M |
| 3300030520|Ga0311372_11718180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 755 | Open in IMG/M |
| 3300030520|Ga0311372_12585773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 567 | Open in IMG/M |
| 3300031231|Ga0170824_116176676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 654 | Open in IMG/M |
| 3300031236|Ga0302324_100096868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5017 | Open in IMG/M |
| 3300031247|Ga0265340_10535885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 515 | Open in IMG/M |
| 3300031250|Ga0265331_10265677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 769 | Open in IMG/M |
| 3300031708|Ga0310686_104832292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 614 | Open in IMG/M |
| 3300031720|Ga0307469_11286655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 694 | Open in IMG/M |
| 3300031823|Ga0307478_11187610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 636 | Open in IMG/M |
| 3300032160|Ga0311301_10102959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5562 | Open in IMG/M |
| 3300032205|Ga0307472_102611845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 515 | Open in IMG/M |
| 3300032828|Ga0335080_12387422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 504 | Open in IMG/M |
| 3300033402|Ga0326728_10423283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1123 | Open in IMG/M |
| 3300033755|Ga0371489_0047404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2908 | Open in IMG/M |
| 3300033982|Ga0371487_0159969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1113 | Open in IMG/M |
| 3300033983|Ga0371488_0142288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1267 | Open in IMG/M |
| 3300034090|Ga0326723_0216495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 850 | Open in IMG/M |
| 3300034124|Ga0370483_0209800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 663 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 12.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.13% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.13% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.13% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 4.13% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.48% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.48% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.48% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.48% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24748J21848_10189971 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | ALLAARELSFLRAGSHSMLQVTPPKAVYVPQPRPERVG* |
| Ga0062384_1009620091 | 3300004082 | Bog Forest Soil | VKEAVHALLAARELSFVHVGSKSLLQVTPPKVAYVPKSRAERMRERSST* |
| Ga0062387_1001583441 | 3300004091 | Bog Forest Soil | LECVIAVDEGDVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKVVYVPKNRRPERVS* |
| Ga0062389_1047387451 | 3300004092 | Bog Forest Soil | KEAIHALLAARELSFVHVGSKSLLQVTPPKQVYVPKPRPQRVS* |
| Ga0066680_107658951 | 3300005174 | Soil | IHALLAARELSFVHVGSKSLLQVTPPKQAYVPKPRAERLRERSST* |
| Ga0070663_1000012951 | 3300005455 | Corn Rhizosphere | KEAVNALLAARELSFLRAGSHSMLQVTPPKAVYVPQPRPERVG* |
| Ga0066795_100267164 | 3300005938 | Soil | LLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVV* |
| Ga0066787_101372741 | 3300005950 | Soil | CVIAVDEGEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLVQVTPPKQVYIPKNRRPERVS* |
| Ga0066790_100160761 | 3300005995 | Soil | NFVPRTRVKEAIHALLSARELSFVHAGSKSLLQVTPPKQAYVPKPRPLRVS* |
| Ga0075019_111136622 | 3300006086 | Watersheds | AIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPQRVS* |
| Ga0075030_1001584021 | 3300006162 | Watersheds | VAVDESEVEKFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYMPKNRRPERVG* |
| Ga0075030_1009264362 | 3300006162 | Watersheds | DEGEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKRRSERVS* |
| Ga0075021_109404341 | 3300006354 | Watersheds | NFLANFVPRTRVKEAIHALLSAREVSFVHVGSKSMVQVTPPKQVFAPKNRRPERVS* |
| Ga0073928_107107741 | 3300006893 | Iron-Sulfur Acid Spring | TRVKEAIHALLSARELSFVHVGSKSLMQLTPPKQVYVPKPRPERVS* |
| Ga0116133_11138192 | 3300009623 | Peatland | EVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPQRVS* |
| Ga0116114_10884681 | 3300009630 | Peatland | NFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS* |
| Ga0116102_10540963 | 3300009632 | Peatland | ALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS* |
| Ga0116216_101621563 | 3300009698 | Peatlands Soil | LANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS* |
| Ga0116130_10968451 | 3300009762 | Peatland | EVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS* |
| Ga0116223_100252574 | 3300009839 | Peatlands Soil | ANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVG* |
| Ga0116223_105764832 | 3300009839 | Peatlands Soil | ANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKRRSERVS* |
| Ga0074045_105356702 | 3300010341 | Bog Forest Soil | LLSARELSFVHVGSKSLIQVTPPKQVYVPKPRPERVG* |
| Ga0074044_102964151 | 3300010343 | Bog Forest Soil | KEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS* |
| Ga0074044_110604992 | 3300010343 | Bog Forest Soil | LLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVG* |
| Ga0134066_103103002 | 3300010364 | Grasslands Soil | EVETFFSNFVPRSRVKDAINALLSARELSFVHVGKHSLLQVTPPKPAFVPRIRPQQVGS* |
| Ga0137362_107214602 | 3300012205 | Vadose Zone Soil | FVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVT* |
| Ga0137361_115042361 | 3300012362 | Vadose Zone Soil | HALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS* |
| Ga0137398_105201772 | 3300012683 | Vadose Zone Soil | DCVVAVDEGEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS* |
| Ga0137359_107636931 | 3300012923 | Vadose Zone Soil | RELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS* |
| Ga0181530_102149811 | 3300014159 | Bog | AIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVG* |
| Ga0181526_108287721 | 3300014200 | Bog | TRVKEAIHALLAARELSFVHVGTKSLLQVTPPKQVYIPKNRRPERVS* |
| Ga0182014_101636013 | 3300014491 | Bog | TRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVLKRRPERVS* |
| Ga0182013_106875182 | 3300014492 | Bog | ARELSFVHVGSKSLLHVTPPKQAYVPKPRPERVS* |
| Ga0182019_106421532 | 3300014498 | Fen | VPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKPRPERVG* |
| Ga0182012_107880742 | 3300014499 | Bog | TRVKEAIHALLAARELSFVHVGGKTLLQVTPPKQVYIPKNRRPERVS* |
| Ga0181536_102075041 | 3300014638 | Bog | HALLSARELSFVHIGSKSLLQITPPRQAYVPKPRPERVT* |
| Ga0137403_106899291 | 3300015264 | Vadose Zone Soil | DQVEVEAFFSNFVPRSRVKDAINALLSARELSFVHVGKRSLLQVTPPKQAFVPRSRPQHVS* |
| Ga0187802_101669982 | 3300017822 | Freshwater Sediment | ARELSFAHIGSKSLLQVTPPKQAYVPKPRPERVSG |
| Ga0187849_13096222 | 3300017929 | Peatland | LLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPQRVS |
| Ga0187801_103403272 | 3300017933 | Freshwater Sediment | IHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS |
| Ga0187803_100060856 | 3300017934 | Freshwater Sediment | DEGEVENFLANFVPRTRVKEAIHALLSARELCFVHVGSKSLLQVTPPKQAYVPKPRPERV |
| Ga0187803_102988212 | 3300017934 | Freshwater Sediment | HALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS |
| Ga0187848_101142693 | 3300017935 | Peatland | VKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS |
| Ga0187848_102846651 | 3300017935 | Peatland | IKALLAARELSFVRMGSKSLLQVAPVREAFVLRPRGERVR |
| Ga0187819_106140812 | 3300017943 | Freshwater Sediment | FVPRSRVKESINALLSAREVSFVRVGSKSLLQVTPPKQAYVPRPRPERVGS |
| Ga0187868_10356221 | 3300018002 | Peatland | KEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS |
| Ga0187804_102923531 | 3300018006 | Freshwater Sediment | ENFLANFVPRTRVKEAIHALLSARELSFAHIGSKSLLQVTPPKQAYVPKPRPERVSG |
| Ga0187884_102181101 | 3300018009 | Peatland | EAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPQRVS |
| Ga0187880_14037191 | 3300018016 | Peatland | PRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS |
| Ga0187872_101277451 | 3300018017 | Peatland | ELSFVHIGSKSLLQVTPPKLPYVHKPRAERMKKIVSE |
| Ga0187861_102844392 | 3300018020 | Peatland | SFVPRTRVKEAVHALLSARELSFVHVGSKSLLQVTPPKQAYVLKRRPERVS |
| Ga0187881_104783481 | 3300018024 | Peatland | VPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS |
| Ga0187885_101813102 | 3300018025 | Peatland | SARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS |
| Ga0187857_104075821 | 3300018026 | Peatland | NFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS |
| Ga0187875_103608512 | 3300018035 | Peatland | EVENFLANFVPRTRVKEAIHALLSARELSFVHIGSKSLLQVTPPKQAYVPKPRPERVS |
| Ga0187855_104727791 | 3300018038 | Peatland | AIHALLAARELSFVHVGSKSLLQVTPPKQVYIPKNRRPERVS |
| Ga0187862_106059722 | 3300018040 | Peatland | RMKEAIHALLSARELSFVHIGSKSLLQVTPPKLPYVHKPRAERMKKIVSE |
| Ga0187859_107178642 | 3300018047 | Peatland | CVVAVDEGEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKRRSAPVS |
| Ga0187769_109376012 | 3300018086 | Tropical Peatland | SNFVPRTRVKEAFHALLAARELSFLHVGGKSLLQVTPPRRAYIPKIVAQSG |
| Ga0066662_103506343 | 3300018468 | Grasslands Soil | DCVIAVDEGEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPRQVYVPKNRRPERVS |
| Ga0179592_101792862 | 3300020199 | Vadose Zone Soil | VDEGEVENFLANFVPRTRVKEAIHALLSAREVSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS |
| Ga0179592_105195011 | 3300020199 | Vadose Zone Soil | EAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS |
| Ga0210403_100642531 | 3300020580 | Soil | TRVKEAIHALLAARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS |
| Ga0210399_106263671 | 3300020581 | Soil | RVKEAIHALLAARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS |
| Ga0210404_101454412 | 3300021088 | Soil | NFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPRQAYVPKNRRPERVS |
| Ga0210394_116901462 | 3300021420 | Soil | LLAARELSFVHVGSKSLLQVTPPKVAYVPKNRRPERVS |
| Ga0210391_103654201 | 3300021433 | Soil | AIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPVRVS |
| Ga0210398_113682881 | 3300021477 | Soil | EAIHALLSARELSFVHVGSKSLLQVTPPKVVYVPKNRRPERVS |
| Ga0210402_109275932 | 3300021478 | Soil | VDFFANFVPRTRVRESINALLSARELTFVHVGKRSLLQVTPAKQPYVPRVRPQQVGG |
| Ga0212123_109488022 | 3300022557 | Iron-Sulfur Acid Spring | VKEAIHALLSARELSFVHVGSKSLMQLTPPKQVYVPKPRPERVS |
| Ga0224544_10281932 | 3300023250 | Soil | AENFLANFVPRTRVKEAIHALLSAREVSFVLVGSKSLLQVTPPKQVYVPKPRPERVS |
| Ga0208455_10459851 | 3300025453 | Peatland | KEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS |
| Ga0208479_10491761 | 3300025474 | Arctic Peat Soil | CVVAVDEADVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPVRVS |
| Ga0207929_10705712 | 3300025505 | Arctic Peat Soil | IHALLSARELSFVHVGSKSLVQVTPPKQVYVPKPRPERVS |
| Ga0207927_11054111 | 3300025579 | Arctic Peat Soil | KEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKPRPERVS |
| Ga0208691_11493212 | 3300025612 | Peatland | TRVKEAIHALLAARELSFVHVGSKSLIQVTPPKQVYIPKNRRPERVSRS |
| Ga0207646_112126531 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EAVHALLSARELSFVHIGSKSLLQVTPPKQVYVPKNRRPERAS |
| Ga0207686_102981543 | 3300025934 | Miscanthus Rhizosphere | RVKEAVNALLAARELSFLRAGSHSMLQVTPPKAVYVPQPRPERVG |
| Ga0209131_11579862 | 3300026320 | Grasslands Soil | IHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS |
| Ga0179587_111140972 | 3300026557 | Vadose Zone Soil | RVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS |
| Ga0209733_10356821 | 3300027591 | Forest Soil | SARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS |
| Ga0209733_10869392 | 3300027591 | Forest Soil | LSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS |
| Ga0209118_10265023 | 3300027674 | Forest Soil | LLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS |
| Ga0209333_11319272 | 3300027676 | Forest Soil | NFLVNFVPRTRVKEAVHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS |
| Ga0209530_10143333 | 3300027692 | Forest Soil | LTNFVPRTRVKEAIHALLSARELSFVHVGGKSLLQVTPPKQAYVPKPRPQRVS |
| Ga0209248_101100791 | 3300027729 | Bog Forest Soil | IHALLSARELSFVHVGSKSLLQVTPPKQPYVPKPRPNRVTTSS |
| Ga0209038_101894501 | 3300027737 | Bog Forest Soil | VKEAVHALLAARELSFVHVGSKSLLQVTPPKVAYVPKSRAERMRERSST |
| Ga0209772_102971351 | 3300027768 | Bog Forest Soil | TRVKESIHALLAARELSFVHVGSKSLLQVTPPKQVYMPKNRRPERVS |
| Ga0209180_103755242 | 3300027846 | Vadose Zone Soil | KEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRAERLRERSST |
| Ga0209517_102225751 | 3300027854 | Peatlands Soil | LLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVG |
| Ga0209517_105922191 | 3300027854 | Peatlands Soil | RVKEAIHALLSARELSFVHIGSKSLLQVTPPKQAYVPKPRPQRVS |
| Ga0209068_107257522 | 3300027894 | Watersheds | HALLSAREVSFVHVGSKSMVQVTPPKQVFAPKNRRPERVS |
| Ga0209415_110071321 | 3300027905 | Peatlands Soil | RVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYLPKPRPERVG |
| Ga0209583_100913771 | 3300027910 | Watersheds | KEAIHALLSARELSFVHVGSKSLLQVTPPKEAYVPKPRPERVSRG |
| Ga0209698_106386452 | 3300027911 | Watersheds | VEKFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYMPKNRRPERVG |
| Ga0302219_101334762 | 3300028747 | Palsa | KEAIHALLSARELSFLYVGSKSLLQVTPPKQAYVPKPRPQRVM |
| Ga0307504_100576031 | 3300028792 | Soil | VKDAINALLSARELSFVHVGKRSLLQVTPPKQAFVPRTRPQQVGS |
| Ga0311330_105318651 | 3300029945 | Bog | SARELSFVHVGSKSLLQVTPPKQVYIPKNRRPERVS |
| Ga0311344_100919801 | 3300030020 | Bog | ARELSFVHVGSKSLIQVTPPKQVYIPKNRRPERVSRS |
| Ga0302274_102168831 | 3300030041 | Bog | VDEGEVEKFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLIQVTPPKQVYIPKNRRPERVSRS |
| Ga0302300_11472992 | 3300030042 | Palsa | GEVENFLANFVPRTRVKEAIHALLSAREVSFVLVGSKSLLQVTPPKQVYVPKPRPERVS |
| Ga0302191_102421521 | 3300030049 | Bog | EAIHALLAARELSFVHVGGKTLLQVTPPKQVYIPKNRRPERVS |
| Ga0302195_100296811 | 3300030051 | Bog | ALLAARELSFVHVGGKTLLQVTPPKQVYIPKNRRPERVS |
| Ga0311372_117181801 | 3300030520 | Palsa | SNFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKPRPVRVS |
| Ga0311372_125857731 | 3300030520 | Palsa | IHALLSAREVSFVLVGSKSLLQVTPPKQVYVPKPRPERVS |
| Ga0170824_1161766762 | 3300031231 | Forest Soil | ARELSFVHVGSKSLLQVTPPKVAYVPKSRAERMRERSSTS |
| Ga0302324_1000968684 | 3300031236 | Palsa | FLANFVPRTRVKEAIHALLSAREVSFVLVGSKSLLQVTPPKQVYVPKPRPERVS |
| Ga0265340_105358851 | 3300031247 | Rhizosphere | TRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKPRPERVS |
| Ga0265331_102656772 | 3300031250 | Rhizosphere | VKEAIHALLSARELSFVHVGSKSLVQVTPPKQVFIPKNRRPERVS |
| Ga0310686_1048322922 | 3300031708 | Soil | LAARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS |
| Ga0307469_112866552 | 3300031720 | Hardwood Forest Soil | ETFFSNFVPRSRVKDAINGLLSARELSFVHVGKHSLLQVTPPKQAFVPRSRPQHVG |
| Ga0307478_111876101 | 3300031823 | Hardwood Forest Soil | DQQEIEVFFGNFVPRSRVKESINALLSARELSFVHVGNRSLIQITPEKEPPAPFVSRHPERAKR |
| Ga0311301_101029595 | 3300032160 | Peatlands Soil | LANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVG |
| Ga0307472_1026118451 | 3300032205 | Hardwood Forest Soil | RVKEAINALLSARELSFVHVGKRSLLQVTPPKQAFVPRTRPQHVS |
| Ga0335080_123874222 | 3300032828 | Soil | ANFVPRTKVKEAIHALLSAREFSFVHVGGKSLLQATPPKQVYVAKPRPQRVS |
| Ga0326728_104232831 | 3300033402 | Peat Soil | CVVAVEEDEVEKLLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVT |
| Ga0371489_0047404_2746_2907 | 3300033755 | Peat Soil | ANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVT |
| Ga0371487_0159969_2_178 | 3300033982 | Peat Soil | VEKLLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVT |
| Ga0371488_0142288_2_184 | 3300033983 | Peat Soil | DEVEKLLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVT |
| Ga0326723_0216495_708_845 | 3300034090 | Peat Soil | VKEAINALLSARELSFVHVTNRSLLQVTPPKEAFVPRQHRPERVS |
| Ga0370483_0209800_6_149 | 3300034124 | Untreated Peat Soil | VKEAIHALLAARELSFVHVGSKSLIQVTPPKQVYIPKNRRPERVSRS |
| ⦗Top⦘ |