NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072394

Metagenome / Metatranscriptome Family F072394

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072394
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 37 residues
Representative Sequence MKAEIYDKVSLKFKIILVASIGVLAAVIALGEMGII
Number of Associated Samples 88
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.83 %
% of genes near scaffold ends (potentially truncated) 18.18 %
% of genes from short scaffolds (< 2000 bps) 83.47 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.165 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.793 % of family members)
Environment Ontology (ENVO) Unclassified
(47.107 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.802 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.88%    β-sheet: 0.00%    Coil/Unstructured: 53.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF00575S1 38.02
PF01553Acyltransferase 12.40
PF04402SIMPL 6.61
PF11164DUF2948 0.83
PF030614HBT 0.83
PF13599Pentapeptide_4 0.83
PF00171Aldedh 0.83
PF00326Peptidase_S9 0.83
PF04389Peptidase_M28 0.83
PF13578Methyltransf_24 0.83
PF13148DUF3987 0.83
PF01619Pro_dh 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG2859Outer membrane channel-forming protein BP26/OMP28, SIMPL familyCell wall/membrane/envelope biogenesis [M] 6.61
COG2968Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domainFunction unknown [S] 6.61
COG3471Predicted secreted (periplasmic) proteinFunction unknown [S] 6.61
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.83
COG0506Proline dehydrogenaseAmino acid transport and metabolism [E] 0.83
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.83
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.17 %
UnclassifiedrootN/A19.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_100100437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis1076Open in IMG/M
3300000559|F14TC_101011406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis1572Open in IMG/M
3300000559|F14TC_106276650All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes883Open in IMG/M
3300000881|JGI10215J12807_1266883All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis978Open in IMG/M
3300000953|JGI11615J12901_12830148Not Available508Open in IMG/M
3300000955|JGI1027J12803_105945118All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1034Open in IMG/M
3300000956|JGI10216J12902_119905286All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1064Open in IMG/M
3300000956|JGI10216J12902_122001901All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes620Open in IMG/M
3300002100|JGI24809J26612_1053704All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes610Open in IMG/M
3300005290|Ga0065712_10214837All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300005338|Ga0068868_101108140All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005456|Ga0070678_100733292All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300005526|Ga0073909_10084160All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1228Open in IMG/M
3300005536|Ga0070697_101725053All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes560Open in IMG/M
3300005543|Ga0070672_100051614All Organisms → cellular organisms → Bacteria3208Open in IMG/M
3300005543|Ga0070672_100219449Not Available1594Open in IMG/M
3300005543|Ga0070672_100365782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1232Open in IMG/M
3300005577|Ga0068857_100175432All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1950Open in IMG/M
3300005616|Ga0068852_100551005All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300005617|Ga0068859_100034338All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae5090Open in IMG/M
3300005617|Ga0068859_103102459Not Available507Open in IMG/M
3300005834|Ga0068851_10111690All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300005840|Ga0068870_10179595All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1269Open in IMG/M
3300005840|Ga0068870_11361991Not Available519Open in IMG/M
3300005841|Ga0068863_100614385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella yeongjuensis1077Open in IMG/M
3300005844|Ga0068862_100471156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1187Open in IMG/M
3300005844|Ga0068862_100900427All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella yeongjuensis870Open in IMG/M
3300006031|Ga0066651_10276900All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300006358|Ga0068871_101049577All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300006844|Ga0075428_100036139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella5443Open in IMG/M
3300006844|Ga0075428_100113391All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella2953Open in IMG/M
3300006844|Ga0075428_100308297All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300006844|Ga0075428_100663524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella yeongjuensis1112Open in IMG/M
3300006844|Ga0075428_101022073All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300006876|Ga0079217_10195004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1029Open in IMG/M
3300006894|Ga0079215_10203448All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300006894|Ga0079215_10247758All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes942Open in IMG/M
3300007004|Ga0079218_10066094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2328Open in IMG/M
3300009094|Ga0111539_10618689All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1261Open in IMG/M
3300009094|Ga0111539_11017868Not Available963Open in IMG/M
3300009100|Ga0075418_11145397All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300009147|Ga0114129_10284985All Organisms → cellular organisms → Bacteria2206Open in IMG/M
3300009156|Ga0111538_10308274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2003Open in IMG/M
3300009156|Ga0111538_11164639All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300009176|Ga0105242_11386838All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300009553|Ga0105249_10059900All Organisms → cellular organisms → Bacteria3492Open in IMG/M
3300009553|Ga0105249_11285955Not Available803Open in IMG/M
3300009609|Ga0105347_1073772All Organisms → cellular organisms → Bacteria1254Open in IMG/M
3300009610|Ga0105340_1074426All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1341Open in IMG/M
3300010037|Ga0126304_10106294All Organisms → cellular organisms → Bacteria1780Open in IMG/M
3300011333|Ga0127502_10535065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes733Open in IMG/M
3300011333|Ga0127502_11129250All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes858Open in IMG/M
3300011442|Ga0137437_1256192All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes603Open in IMG/M
3300012231|Ga0137465_1261005Not Available510Open in IMG/M
3300012882|Ga0157304_1011661All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300012882|Ga0157304_1014193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae937Open in IMG/M
3300012883|Ga0157281_1019152All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300012883|Ga0157281_1043560Not Available665Open in IMG/M
3300012891|Ga0157305_10207518Not Available566Open in IMG/M
3300012896|Ga0157303_10010513Not Available1387Open in IMG/M
3300012910|Ga0157308_10426813All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes521Open in IMG/M
3300012911|Ga0157301_10061419All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300012912|Ga0157306_10457523Not Available514Open in IMG/M
3300012914|Ga0157297_10037466All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300012984|Ga0164309_10840322All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300012987|Ga0164307_10078393All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium PMP191F1999Open in IMG/M
3300013308|Ga0157375_11082657Not Available938Open in IMG/M
3300014157|Ga0134078_10185815All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300014326|Ga0157380_11218219All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes797Open in IMG/M
3300014326|Ga0157380_11849209Not Available664Open in IMG/M
3300014875|Ga0180083_1075498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes720Open in IMG/M
3300015371|Ga0132258_10598964All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2766Open in IMG/M
3300017792|Ga0163161_10449441All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium PMP191F1041Open in IMG/M
3300017792|Ga0163161_11289007Not Available635Open in IMG/M
3300018031|Ga0184634_10422994Not Available604Open in IMG/M
3300018469|Ga0190270_10032938All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3398Open in IMG/M
3300018476|Ga0190274_10001516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae13597Open in IMG/M
3300018476|Ga0190274_10409237All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300018476|Ga0190274_11635529Not Available737Open in IMG/M
3300018481|Ga0190271_11680713Not Available749Open in IMG/M
3300018920|Ga0190273_11270141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes632Open in IMG/M
3300019263|Ga0184647_1487134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes659Open in IMG/M
3300019356|Ga0173481_10082020All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300019361|Ga0173482_10132806All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae948Open in IMG/M
3300019361|Ga0173482_10372522Not Available654Open in IMG/M
3300019884|Ga0193741_1009767All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2515Open in IMG/M
3300019884|Ga0193741_1054514All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1031Open in IMG/M
3300019884|Ga0193741_1112383All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes693Open in IMG/M
3300019884|Ga0193741_1160530All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes549Open in IMG/M
3300020009|Ga0193740_1023160All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes983Open in IMG/M
3300020020|Ga0193738_1000093All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes56285Open in IMG/M
3300020020|Ga0193738_1000454All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes21527Open in IMG/M
3300020020|Ga0193738_1031649All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1639Open in IMG/M
3300021415|Ga0193694_1000001All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1862607Open in IMG/M
3300022756|Ga0222622_10592005Not Available800Open in IMG/M
3300022886|Ga0247746_1034030All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300022899|Ga0247795_1021091All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1051Open in IMG/M
3300022899|Ga0247795_1066847Not Available616Open in IMG/M
3300024055|Ga0247794_10101204All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae857Open in IMG/M
3300025899|Ga0207642_10797468All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes600Open in IMG/M
3300025903|Ga0207680_10144319All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300025922|Ga0207646_11498406Not Available584Open in IMG/M
3300025961|Ga0207712_10015921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4860Open in IMG/M
3300025961|Ga0207712_10185030All Organisms → cellular organisms → Bacteria1639Open in IMG/M
3300025981|Ga0207640_10564512All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300026095|Ga0207676_10233639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1645Open in IMG/M
3300027639|Ga0209387_1052187All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes903Open in IMG/M
3300027735|Ga0209261_10020552All Organisms → cellular organisms → Bacteria1637Open in IMG/M
3300027840|Ga0209683_10001200All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes10042Open in IMG/M
3300027880|Ga0209481_10009401All Organisms → cellular organisms → Bacteria4183Open in IMG/M
3300027886|Ga0209486_10045010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2188Open in IMG/M
3300027886|Ga0209486_11153277Not Available529Open in IMG/M
3300028380|Ga0268265_10040674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3435Open in IMG/M
3300031538|Ga0310888_10290037All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300031538|Ga0310888_11104436Not Available502Open in IMG/M
3300031858|Ga0310892_10430734All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300031913|Ga0310891_10249361All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes613Open in IMG/M
3300031995|Ga0307409_101349494All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300032180|Ga0307471_101542261All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes822Open in IMG/M
3300034115|Ga0364945_0157554All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes683Open in IMG/M
3300034675|Ga0314800_062408Not Available552Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.31%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.31%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.48%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.65%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.65%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.83%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002100Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDAEnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020009Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027735Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034675Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10010043723300000559SoilMKAVIYDKVSLKFKVILIASIGVLATVIALGEMGII*
F14TC_10101140623300000559SoilMKAVIYDKVSLRFKIFLVAAIGVLATVIALGEMGII*
F14TC_10627665013300000559SoilMKAVIYDKVSLKFKIILVVSIGVLATVIALGEMGII*
JGI10215J12807_126688323300000881SoilMKAEIYDKVSLRFKILLAASIGILATVIVLGELGII*
JGI11615J12901_1283014823300000953SoilMKAVIYEKVNLKFKVFLVVAIGVLATVITLGELGII*
JGI1027J12803_10594511813300000955SoilMKAVIYDKVSLRFKIILIASIGVLATVIALGEMGI
JGI10216J12902_11990528623300000956SoilMKAVIYDKVNTKFKVLLIAAIGVLAAVITLGEMGII*
JGI10216J12902_12200190123300000956SoilMKAVIYDKVSMKFKLLLVASIGILATVIVLGELGII*
JGI24809J26612_105370423300002100SoilMKAEIYDKVDLKFKILVLAAASMLAAVIALGELGII*
Ga0065712_1021483713300005290Miscanthus RhizosphereCFCMKAEINDQMGIKFKILLAASIGILLAVIALGETGII*
Ga0068868_10110814013300005338Miscanthus RhizosphereVFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII*
Ga0070678_10073329213300005456Miscanthus RhizosphereNVFIMQEETYDQLGTKFKIILVASIGILVAVIALGEMGII*
Ga0073909_1008416023300005526Surface SoilMKAEINDQMGTKFKILLVASIGILLAVIALGEMGII*
Ga0070697_10172505313300005536Corn, Switchgrass And Miscanthus RhizosphereSFNVFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII*
Ga0070672_10005161423300005543Miscanthus RhizosphereMRAEIHDKVSGKFILLLVASLGVLATVIALGEMGII*
Ga0070672_10021944933300005543Miscanthus RhizosphereMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII*
Ga0070672_10036578223300005543Miscanthus RhizosphereMKAEINDQMSTKFKILLVASIGVLAVVIALGEMGII*
Ga0068857_10017543223300005577Corn RhizosphereMKAVIYDKVSLRFKVIVAAAIGILIAVIALGETGII*
Ga0068852_10055100523300005616Corn RhizosphereMKAEINDQMSTRFKILLVASIGILAAVIALGEMGII*
Ga0068859_10003433843300005617Switchgrass RhizosphereMKAVIYDKVSLRFKLILVASIGVLATVIALGEMGII*
Ga0068859_10310245923300005617Switchgrass RhizosphereMKAEINDQMGIKFKILLAASIGILLAVIALGETGII*
Ga0068851_1011169013300005834Corn RhizosphereKAEINDQMGTKFKILLVASIGILLAVIALGEMGII*
Ga0068870_1017959523300005840Miscanthus RhizosphereMKAVIYDKVGLRFKVVLIAAIGVLATVIALGEMGII*
Ga0068870_1136199113300005840Miscanthus RhizosphereMKAEINDQMSTKFKILLVASIGVLAAVIALGEMGII*
Ga0068863_10061438523300005841Switchgrass RhizosphereMKAVIYDKVSLKFKIILVASIGVLATVIALGEMGII*
Ga0068862_10047115623300005844Switchgrass RhizosphereMRAEIYDRVSLKFKIILAASIGILATVIALGEMGII*
Ga0068862_10090042723300005844Switchgrass RhizosphereMKAEINDQMSTKFKILLVASIGILVAVIALGEMGII*
Ga0066651_1027690023300006031SoilMQEETYDQLGTKFKIILVASIGILVAVIALGEMGII*
Ga0068871_10104957713300006358Miscanthus RhizosphereIMQEETYDQLGTKFKIILVASIGILVTVIALGEMGII*
Ga0075428_10003613963300006844Populus RhizosphereMRAEIHDKIPLKFKLLLAASIGLLATVIALGELGII*
Ga0075428_10011339123300006844Populus RhizosphereMRAEIFDRLGWKFKVLLAASIGLLATVIALGEMGII*
Ga0075428_10030829723300006844Populus RhizosphereMKAVIYDKVSLKFKIILLASIGVLAAVIALGEMGII*
Ga0075428_10066352423300006844Populus RhizosphereMKAEINDQMGMKFKILLAASIGILLAVIALGETGII*
Ga0075428_10102207323300006844Populus RhizosphereMKAVIYDKVSWKFKVILIASIGVLATVIALGEMGII*
Ga0079217_1019500423300006876Agricultural SoilMRAEIFDRVSLKFKVLLAAAIGLLASVIVLGELGII*
Ga0079215_1020344833300006894Agricultural SoilMRAEIFDKVSLKFKVLLAAAIGLLASVIVLGELGII*
Ga0079215_1024775823300006894Agricultural SoilMRAEIFDKISLKFKVLLAAAIGLLASVIVLGELGII*
Ga0079218_1006609433300007004Agricultural SoilLYLTFNVFIMKEEIYDQMGTKFKILLAASIGILVAVIALGEMGII*
Ga0111539_1061868923300009094Populus RhizosphereMKAEIYDKVSLKFKIILVASIGVLATVIALGEMGII*
Ga0111539_1101786823300009094Populus RhizosphereMKAQIYDKVRFKFKVMLIASIGVLATVIALGEMGII*
Ga0075418_1114539713300009100Populus RhizosphereKLAFMKAEIYDRVDTRFKVLVAVSMALLATVVALGEMGII*
Ga0114129_1028498523300009147Populus RhizosphereMKAEIYDKVDTKFKVLVAVSIGFLAAVIALGEMGII*
Ga0111538_1030827423300009156Populus RhizosphereMKAEIYDRVSLKFKIILVASIGVLATVIALGEMGII*
Ga0111538_1116463923300009156Populus RhizosphereMKAEIYDKVSLKFKIILVASIGVLAAVIALGEMGII*
Ga0105242_1138683813300009176Miscanthus RhizosphereVFIMKAEINDQMGTKFKILLVASIGILLAVIALGEMGII*
Ga0105249_1005990043300009553Switchgrass RhizosphereMKAEIYDKVSLRFKVLVAASIGILATVIALGEMGII*
Ga0105249_1128595523300009553Switchgrass RhizosphereMKAVIYDKVSLKFKLILVASIGVLATVIALGEMGII*
Ga0105347_107377223300009609SoilMKEETFDQMGTKFKILLAASIGILVAVIALGETGII*
Ga0105340_107442623300009610SoilMKAEIYDKVSLKFKIILVASIGVLATVIALGEMGI
Ga0126304_1010629413300010037Serpentine SoilMKEEIFDQMGTKFKILLAASIGILIAVIALGETGII*
Ga0127502_1053506523300011333SoilMKAEINDQMSMKFKVLLAASIGILLTVIALGETGII*
Ga0127502_1112925033300011333SoilMRAEIFDRLGLKFKVLLVASIGVLAAVIALGEMGII*
Ga0137437_125619213300011442SoilMKAVIYDKVSLKFKLILVASIGLLAAVIALGEMGII*
Ga0137465_126100513300012231SoilMKAVIYDKVNMKFKVFLVAAIGVLATVIALGEMGII*
Ga0157304_101166113300012882SoilFNVFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII*
Ga0157304_101419323300012882SoilMQEETYDQLGTKFKIALVASIGILVAVIALGEMGII*
Ga0157281_101915223300012883SoilMKAVIYDKVSLKFKVILIASIGVLATVIVLGEMGII*
Ga0157281_104356013300012883SoilMKAEINDQMSTKFKILLVASIGVLAAVIVLGEMGII*
Ga0157305_1020751813300012891SoilMKAEIYDKVSLKFKIILVASIGILVAVIALGEMGII*
Ga0157303_1001051313300012896SoilMQEETYDQLGTKFKIVLVASIGILVAVIALGEMGII*
Ga0157308_1042681323300012910SoilFIMQEETYDQLGTKFKIILVASIGILITVIALGEMGII*
Ga0157301_1006141923300012911SoilFMKAEIYDKVSLKFKIILVASIGVLATVIALGEMGII*
Ga0157306_1045752323300012912SoilMRAEIYDRVSLKFKILLAASIGILAAVIVLGELGII*
Ga0157297_1003746613300012914SoilAEINDQMSTKFKILLVASIGVLAAVIVLGEMGII*
Ga0164309_1084032213300012984SoilNSKYSYMRAEIHDKVSGKFILLLVASLGVLATVIALGEMGII*
Ga0164307_1007839323300012987SoilMRAEIQDKVSGKFILLLVASLGVLATVIALGEMGII*
Ga0157375_1108265713300013308Miscanthus RhizosphereMKAVIYDKVSLKFKIILVASIGVLATVIALGEMGI
Ga0134078_1018581513300014157Grasslands SoilNVFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII*
Ga0157380_1121821913300014326Switchgrass RhizosphereMKAEINDQMGTKFKILLVASIGILLAVIALGEIGII*
Ga0157380_1184920923300014326Switchgrass RhizosphereMKAEINDQMSTKFKILLVASIGVLAAVITLGEMGII*
Ga0180083_107549813300014875SoilMKAVIYDKVGLKFKVVLVAAIGVLATVIALGEMGII*
Ga0132258_1059896433300015371Arabidopsis RhizosphereMKAEINDQMSTKFKILLVASIGMLIAVIALGEMGII*
Ga0163161_1044944123300017792Switchgrass RhizosphereMRAEIHDKVSGKFILLLVASLGVLATVIALGEMGII
Ga0163161_1128900713300017792Switchgrass RhizosphereMQEETYDQLGTKFKIILVASIGILVAVIALGEMGII
Ga0184634_1042299413300018031Groundwater SedimentMKAEIYDKVSLKFKIILVASIGVLATVIALGEMGII
Ga0190270_1003293823300018469SoilMKAEINDQMGMKFKVLLAASIGILLAVIALGETGII
Ga0190274_1000151623300018476SoilMKEETFDQLGTKFKILLAASIGILVAVIALGETGII
Ga0190274_1040923723300018476SoilMKAEIYDKVSLKFKLILVASIGVLATVIALGEMGII
Ga0190274_1163552913300018476SoilMRAEIQDKVSGKFILLLVASLGVLATVIALGEMGI
Ga0190271_1168071313300018481SoilMQEETYDQLGTKFKLLLVASIGILVAVITLGEMGII
Ga0190273_1127014113300018920SoilMKSVFYDKAHRKFKVILILSIGLLAAVIALGKMGFI
Ga0184647_148713413300019263Groundwater SedimentMKAEIYDKVSLKFKIILVASIGVLAAVIALGEMGII
Ga0173481_1008202023300019356SoilMKAVIYDKVSLKFKVILIASIGVLATVIVLGEMGII
Ga0173482_1013280623300019361SoilMQEETYDQLGTKFKIALVASIGILVAVIALGEMGII
Ga0173482_1037252213300019361SoilMKAEINDQMSTKFKILLVASIGVLAAVIVLGEMGII
Ga0193741_100976723300019884SoilMKAVIYDKVSMRFKVVLIAAIGVLVTVIALGEMGII
Ga0193741_105451413300019884SoilMRAEIYDRVPMKFKLLLAASIGVLVAVITLGELGII
Ga0193741_111238323300019884SoilMKAEIYDKVDVKFKVLVAVSFGFLAAVIALGEMGII
Ga0193741_116053013300019884SoilMRAEVYDRVSLKFKVLLAASIAILATVIALGELGII
Ga0193740_102316023300020009SoilMKEEIYDQMGTKFKILLAASIGILVAVIALGEMGII
Ga0193738_1000093123300020020SoilMRAEIQDKVSGKFILLLVASLGVLATVIALGEMGII
Ga0193738_1000454193300020020SoilMQEETYDQLGTKFKILLVASIGMLVAVITLGEMGII
Ga0193738_103164913300020020SoilMKAEIYDRVSLKFKIILFASIGVLATVIALGEMGII
Ga0193694_1000001233300021415SoilMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII
Ga0222622_1059200513300022756Groundwater SedimentMKAEINDQMSTKFKILLVASIGVLAAVIALGEMGII
Ga0247746_103403013300022886SoilKYFFMKAVIYDKVSLKFKVILIASIGVLATVIVLGEMGII
Ga0247795_102109123300022899SoilMKAEINDQMGIKFKILLAASIGILLAVIALGETGII
Ga0247795_106684713300022899SoilMKAVIYDKVSLKFKIILVASIGVLATVIALGEMGII
Ga0247794_1010120423300024055SoilMKAEINDQMGTKFKILLVASIGILLAVIALGEMGII
Ga0207642_1079746823300025899Miscanthus RhizosphereLNVFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII
Ga0207680_1014431913300025903Switchgrass RhizosphereMKAEINDQMSTRFKILLVASIGILAAVIALGEMGII
Ga0207646_1149840613300025922Corn, Switchgrass And Miscanthus RhizosphereMKAVIYDKVSLKFKVIVVAAIGILATVIALGEMGII
Ga0207712_1001592113300025961Switchgrass RhizosphereMKAEIYDKVSLRFKVLVAASIGILATVIALGEMGII
Ga0207712_1018503023300025961Switchgrass RhizosphereMKAVIYDKVSLKFKLILVASIGVLATVIALGEMGII
Ga0207640_1056451213300025981Corn RhizosphereKNSKYFYMRAEIQDKVSGKFILLLVASLGILATVIALGEMGII
Ga0207676_1023363933300026095Switchgrass RhizosphereMKAVIYDKVSLRFKVIVAAAIGILIAVIALGETGII
Ga0209387_105218723300027639Agricultural SoilMRAEIFDKISLKFKVLLAAAIGLLASVIVLGELGII
Ga0209261_1002055223300027735Wetland SedimentMKAVNYDKVSLKFKVILVAAIGILAAVIALGEMGIL
Ga0209683_1000120043300027840Wetland SedimentMKAVNYDKVSLKFKVILVAAIGILAEVIALGEMGIL
Ga0209481_1000940133300027880Populus RhizosphereMRAEIFDRLGWKFKVLLAASIGLLATVIALGEMGII
Ga0209486_1004501033300027886Agricultural SoilMRAEIFDRVSLKFKVLLAAAIGLLASVIVLGELGII
Ga0209486_1115327723300027886Agricultural SoilMRAEIFDKVSLKFKVLLAAAIGLLASVIVLGELGII
Ga0268265_1004067443300028380Switchgrass RhizosphereMKAEINDQMSTKFKILLVASIGILVAVIALGEMGII
Ga0310888_1029003713300031538SoilMKAVIYDKVSWKFKVILIASIGVLATVIALGEMGII
Ga0310888_1110443623300031538SoilMKEETFDQLGTKFKILLAASIGILIAVIALGETGII
Ga0310892_1043073423300031858SoilVFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII
Ga0310891_1024936113300031913SoilMKAVIYDKVSLKFKVILIASIGVLATVIALGEMGII
Ga0307409_10134949423300031995RhizosphereMKAEINDQMGTKFKILLAASVGILVAVIALGEMGII
Ga0307471_10154226123300032180Hardwood Forest SoilMRAEIYDRVSLRFKVLLAASIGILATVVALGEMGII
Ga0364945_0157554_226_3363300034115SedimentMKAVIYDKVSLRFKVVLIAAIGVLATVIALGEMGII
Ga0314800_062408_239_3493300034675SoilMIAEINDQMSTKFKILLVASIGILAAVIALGEMGII

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.