| Basic Information | |
|---|---|
| Family ID | F072394 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MKAEIYDKVSLKFKIILVASIGVLAAVIALGEMGII |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.83 % |
| % of genes near scaffold ends (potentially truncated) | 18.18 % |
| % of genes from short scaffolds (< 2000 bps) | 83.47 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.165 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.793 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.107 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.802 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.88% β-sheet: 0.00% Coil/Unstructured: 53.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF00575 | S1 | 38.02 |
| PF01553 | Acyltransferase | 12.40 |
| PF04402 | SIMPL | 6.61 |
| PF11164 | DUF2948 | 0.83 |
| PF03061 | 4HBT | 0.83 |
| PF13599 | Pentapeptide_4 | 0.83 |
| PF00171 | Aldedh | 0.83 |
| PF00326 | Peptidase_S9 | 0.83 |
| PF04389 | Peptidase_M28 | 0.83 |
| PF13578 | Methyltransf_24 | 0.83 |
| PF13148 | DUF3987 | 0.83 |
| PF01619 | Pro_dh | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 6.61 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 6.61 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 6.61 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.83 |
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 0.83 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.83 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.17 % |
| Unclassified | root | N/A | 19.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100100437 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis | 1076 | Open in IMG/M |
| 3300000559|F14TC_101011406 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis | 1572 | Open in IMG/M |
| 3300000559|F14TC_106276650 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 883 | Open in IMG/M |
| 3300000881|JGI10215J12807_1266883 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis | 978 | Open in IMG/M |
| 3300000953|JGI11615J12901_12830148 | Not Available | 508 | Open in IMG/M |
| 3300000955|JGI1027J12803_105945118 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1034 | Open in IMG/M |
| 3300000956|JGI10216J12902_119905286 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1064 | Open in IMG/M |
| 3300000956|JGI10216J12902_122001901 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 620 | Open in IMG/M |
| 3300002100|JGI24809J26612_1053704 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 610 | Open in IMG/M |
| 3300005290|Ga0065712_10214837 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300005338|Ga0068868_101108140 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005456|Ga0070678_100733292 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300005526|Ga0073909_10084160 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1228 | Open in IMG/M |
| 3300005536|Ga0070697_101725053 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 560 | Open in IMG/M |
| 3300005543|Ga0070672_100051614 | All Organisms → cellular organisms → Bacteria | 3208 | Open in IMG/M |
| 3300005543|Ga0070672_100219449 | Not Available | 1594 | Open in IMG/M |
| 3300005543|Ga0070672_100365782 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1232 | Open in IMG/M |
| 3300005577|Ga0068857_100175432 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1950 | Open in IMG/M |
| 3300005616|Ga0068852_100551005 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300005617|Ga0068859_100034338 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 5090 | Open in IMG/M |
| 3300005617|Ga0068859_103102459 | Not Available | 507 | Open in IMG/M |
| 3300005834|Ga0068851_10111690 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300005840|Ga0068870_10179595 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1269 | Open in IMG/M |
| 3300005840|Ga0068870_11361991 | Not Available | 519 | Open in IMG/M |
| 3300005841|Ga0068863_100614385 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella yeongjuensis | 1077 | Open in IMG/M |
| 3300005844|Ga0068862_100471156 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1187 | Open in IMG/M |
| 3300005844|Ga0068862_100900427 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella yeongjuensis | 870 | Open in IMG/M |
| 3300006031|Ga0066651_10276900 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300006358|Ga0068871_101049577 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300006844|Ga0075428_100036139 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella | 5443 | Open in IMG/M |
| 3300006844|Ga0075428_100113391 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella | 2953 | Open in IMG/M |
| 3300006844|Ga0075428_100308297 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300006844|Ga0075428_100663524 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella yeongjuensis | 1112 | Open in IMG/M |
| 3300006844|Ga0075428_101022073 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300006876|Ga0079217_10195004 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1029 | Open in IMG/M |
| 3300006894|Ga0079215_10203448 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300006894|Ga0079215_10247758 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 942 | Open in IMG/M |
| 3300007004|Ga0079218_10066094 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2328 | Open in IMG/M |
| 3300009094|Ga0111539_10618689 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1261 | Open in IMG/M |
| 3300009094|Ga0111539_11017868 | Not Available | 963 | Open in IMG/M |
| 3300009100|Ga0075418_11145397 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300009147|Ga0114129_10284985 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300009156|Ga0111538_10308274 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2003 | Open in IMG/M |
| 3300009156|Ga0111538_11164639 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300009176|Ga0105242_11386838 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300009553|Ga0105249_10059900 | All Organisms → cellular organisms → Bacteria | 3492 | Open in IMG/M |
| 3300009553|Ga0105249_11285955 | Not Available | 803 | Open in IMG/M |
| 3300009609|Ga0105347_1073772 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300009610|Ga0105340_1074426 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1341 | Open in IMG/M |
| 3300010037|Ga0126304_10106294 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300011333|Ga0127502_10535065 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 733 | Open in IMG/M |
| 3300011333|Ga0127502_11129250 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 858 | Open in IMG/M |
| 3300011442|Ga0137437_1256192 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 603 | Open in IMG/M |
| 3300012231|Ga0137465_1261005 | Not Available | 510 | Open in IMG/M |
| 3300012882|Ga0157304_1011661 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012882|Ga0157304_1014193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 937 | Open in IMG/M |
| 3300012883|Ga0157281_1019152 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300012883|Ga0157281_1043560 | Not Available | 665 | Open in IMG/M |
| 3300012891|Ga0157305_10207518 | Not Available | 566 | Open in IMG/M |
| 3300012896|Ga0157303_10010513 | Not Available | 1387 | Open in IMG/M |
| 3300012910|Ga0157308_10426813 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 521 | Open in IMG/M |
| 3300012911|Ga0157301_10061419 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300012912|Ga0157306_10457523 | Not Available | 514 | Open in IMG/M |
| 3300012914|Ga0157297_10037466 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300012984|Ga0164309_10840322 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012987|Ga0164307_10078393 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium PMP191F | 1999 | Open in IMG/M |
| 3300013308|Ga0157375_11082657 | Not Available | 938 | Open in IMG/M |
| 3300014157|Ga0134078_10185815 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300014326|Ga0157380_11218219 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 797 | Open in IMG/M |
| 3300014326|Ga0157380_11849209 | Not Available | 664 | Open in IMG/M |
| 3300014875|Ga0180083_1075498 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 720 | Open in IMG/M |
| 3300015371|Ga0132258_10598964 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2766 | Open in IMG/M |
| 3300017792|Ga0163161_10449441 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium PMP191F | 1041 | Open in IMG/M |
| 3300017792|Ga0163161_11289007 | Not Available | 635 | Open in IMG/M |
| 3300018031|Ga0184634_10422994 | Not Available | 604 | Open in IMG/M |
| 3300018469|Ga0190270_10032938 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3398 | Open in IMG/M |
| 3300018476|Ga0190274_10001516 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 13597 | Open in IMG/M |
| 3300018476|Ga0190274_10409237 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300018476|Ga0190274_11635529 | Not Available | 737 | Open in IMG/M |
| 3300018481|Ga0190271_11680713 | Not Available | 749 | Open in IMG/M |
| 3300018920|Ga0190273_11270141 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 632 | Open in IMG/M |
| 3300019263|Ga0184647_1487134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 659 | Open in IMG/M |
| 3300019356|Ga0173481_10082020 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300019361|Ga0173482_10132806 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 948 | Open in IMG/M |
| 3300019361|Ga0173482_10372522 | Not Available | 654 | Open in IMG/M |
| 3300019884|Ga0193741_1009767 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2515 | Open in IMG/M |
| 3300019884|Ga0193741_1054514 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1031 | Open in IMG/M |
| 3300019884|Ga0193741_1112383 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 693 | Open in IMG/M |
| 3300019884|Ga0193741_1160530 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 549 | Open in IMG/M |
| 3300020009|Ga0193740_1023160 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 983 | Open in IMG/M |
| 3300020020|Ga0193738_1000093 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 56285 | Open in IMG/M |
| 3300020020|Ga0193738_1000454 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 21527 | Open in IMG/M |
| 3300020020|Ga0193738_1031649 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1639 | Open in IMG/M |
| 3300021415|Ga0193694_1000001 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1862607 | Open in IMG/M |
| 3300022756|Ga0222622_10592005 | Not Available | 800 | Open in IMG/M |
| 3300022886|Ga0247746_1034030 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300022899|Ga0247795_1021091 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1051 | Open in IMG/M |
| 3300022899|Ga0247795_1066847 | Not Available | 616 | Open in IMG/M |
| 3300024055|Ga0247794_10101204 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 857 | Open in IMG/M |
| 3300025899|Ga0207642_10797468 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 600 | Open in IMG/M |
| 3300025903|Ga0207680_10144319 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300025922|Ga0207646_11498406 | Not Available | 584 | Open in IMG/M |
| 3300025961|Ga0207712_10015921 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4860 | Open in IMG/M |
| 3300025961|Ga0207712_10185030 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300025981|Ga0207640_10564512 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300026095|Ga0207676_10233639 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1645 | Open in IMG/M |
| 3300027639|Ga0209387_1052187 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 903 | Open in IMG/M |
| 3300027735|Ga0209261_10020552 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300027840|Ga0209683_10001200 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 10042 | Open in IMG/M |
| 3300027880|Ga0209481_10009401 | All Organisms → cellular organisms → Bacteria | 4183 | Open in IMG/M |
| 3300027886|Ga0209486_10045010 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2188 | Open in IMG/M |
| 3300027886|Ga0209486_11153277 | Not Available | 529 | Open in IMG/M |
| 3300028380|Ga0268265_10040674 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3435 | Open in IMG/M |
| 3300031538|Ga0310888_10290037 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300031538|Ga0310888_11104436 | Not Available | 502 | Open in IMG/M |
| 3300031858|Ga0310892_10430734 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031913|Ga0310891_10249361 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 613 | Open in IMG/M |
| 3300031995|Ga0307409_101349494 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300032180|Ga0307471_101542261 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 822 | Open in IMG/M |
| 3300034115|Ga0364945_0157554 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 683 | Open in IMG/M |
| 3300034675|Ga0314800_062408 | Not Available | 552 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.48% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.65% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002100 | Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020009 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034675 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1001004372 | 3300000559 | Soil | MKAVIYDKVSLKFKVILIASIGVLATVIALGEMGII* |
| F14TC_1010114062 | 3300000559 | Soil | MKAVIYDKVSLRFKIFLVAAIGVLATVIALGEMGII* |
| F14TC_1062766501 | 3300000559 | Soil | MKAVIYDKVSLKFKIILVVSIGVLATVIALGEMGII* |
| JGI10215J12807_12668832 | 3300000881 | Soil | MKAEIYDKVSLRFKILLAASIGILATVIVLGELGII* |
| JGI11615J12901_128301482 | 3300000953 | Soil | MKAVIYEKVNLKFKVFLVVAIGVLATVITLGELGII* |
| JGI1027J12803_1059451181 | 3300000955 | Soil | MKAVIYDKVSLRFKIILIASIGVLATVIALGEMGI |
| JGI10216J12902_1199052862 | 3300000956 | Soil | MKAVIYDKVNTKFKVLLIAAIGVLAAVITLGEMGII* |
| JGI10216J12902_1220019012 | 3300000956 | Soil | MKAVIYDKVSMKFKLLLVASIGILATVIVLGELGII* |
| JGI24809J26612_10537042 | 3300002100 | Soil | MKAEIYDKVDLKFKILVLAAASMLAAVIALGELGII* |
| Ga0065712_102148371 | 3300005290 | Miscanthus Rhizosphere | CFCMKAEINDQMGIKFKILLAASIGILLAVIALGETGII* |
| Ga0068868_1011081401 | 3300005338 | Miscanthus Rhizosphere | VFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII* |
| Ga0070678_1007332921 | 3300005456 | Miscanthus Rhizosphere | NVFIMQEETYDQLGTKFKIILVASIGILVAVIALGEMGII* |
| Ga0073909_100841602 | 3300005526 | Surface Soil | MKAEINDQMGTKFKILLVASIGILLAVIALGEMGII* |
| Ga0070697_1017250531 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SFNVFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII* |
| Ga0070672_1000516142 | 3300005543 | Miscanthus Rhizosphere | MRAEIHDKVSGKFILLLVASLGVLATVIALGEMGII* |
| Ga0070672_1002194493 | 3300005543 | Miscanthus Rhizosphere | MKAEINDQMSTKFKILLVASIGILAAVIALGEMGII* |
| Ga0070672_1003657822 | 3300005543 | Miscanthus Rhizosphere | MKAEINDQMSTKFKILLVASIGVLAVVIALGEMGII* |
| Ga0068857_1001754322 | 3300005577 | Corn Rhizosphere | MKAVIYDKVSLRFKVIVAAAIGILIAVIALGETGII* |
| Ga0068852_1005510052 | 3300005616 | Corn Rhizosphere | MKAEINDQMSTRFKILLVASIGILAAVIALGEMGII* |
| Ga0068859_1000343384 | 3300005617 | Switchgrass Rhizosphere | MKAVIYDKVSLRFKLILVASIGVLATVIALGEMGII* |
| Ga0068859_1031024592 | 3300005617 | Switchgrass Rhizosphere | MKAEINDQMGIKFKILLAASIGILLAVIALGETGII* |
| Ga0068851_101116901 | 3300005834 | Corn Rhizosphere | KAEINDQMGTKFKILLVASIGILLAVIALGEMGII* |
| Ga0068870_101795952 | 3300005840 | Miscanthus Rhizosphere | MKAVIYDKVGLRFKVVLIAAIGVLATVIALGEMGII* |
| Ga0068870_113619911 | 3300005840 | Miscanthus Rhizosphere | MKAEINDQMSTKFKILLVASIGVLAAVIALGEMGII* |
| Ga0068863_1006143852 | 3300005841 | Switchgrass Rhizosphere | MKAVIYDKVSLKFKIILVASIGVLATVIALGEMGII* |
| Ga0068862_1004711562 | 3300005844 | Switchgrass Rhizosphere | MRAEIYDRVSLKFKIILAASIGILATVIALGEMGII* |
| Ga0068862_1009004272 | 3300005844 | Switchgrass Rhizosphere | MKAEINDQMSTKFKILLVASIGILVAVIALGEMGII* |
| Ga0066651_102769002 | 3300006031 | Soil | MQEETYDQLGTKFKIILVASIGILVAVIALGEMGII* |
| Ga0068871_1010495771 | 3300006358 | Miscanthus Rhizosphere | IMQEETYDQLGTKFKIILVASIGILVTVIALGEMGII* |
| Ga0075428_1000361396 | 3300006844 | Populus Rhizosphere | MRAEIHDKIPLKFKLLLAASIGLLATVIALGELGII* |
| Ga0075428_1001133912 | 3300006844 | Populus Rhizosphere | MRAEIFDRLGWKFKVLLAASIGLLATVIALGEMGII* |
| Ga0075428_1003082972 | 3300006844 | Populus Rhizosphere | MKAVIYDKVSLKFKIILLASIGVLAAVIALGEMGII* |
| Ga0075428_1006635242 | 3300006844 | Populus Rhizosphere | MKAEINDQMGMKFKILLAASIGILLAVIALGETGII* |
| Ga0075428_1010220732 | 3300006844 | Populus Rhizosphere | MKAVIYDKVSWKFKVILIASIGVLATVIALGEMGII* |
| Ga0079217_101950042 | 3300006876 | Agricultural Soil | MRAEIFDRVSLKFKVLLAAAIGLLASVIVLGELGII* |
| Ga0079215_102034483 | 3300006894 | Agricultural Soil | MRAEIFDKVSLKFKVLLAAAIGLLASVIVLGELGII* |
| Ga0079215_102477582 | 3300006894 | Agricultural Soil | MRAEIFDKISLKFKVLLAAAIGLLASVIVLGELGII* |
| Ga0079218_100660943 | 3300007004 | Agricultural Soil | LYLTFNVFIMKEEIYDQMGTKFKILLAASIGILVAVIALGEMGII* |
| Ga0111539_106186892 | 3300009094 | Populus Rhizosphere | MKAEIYDKVSLKFKIILVASIGVLATVIALGEMGII* |
| Ga0111539_110178682 | 3300009094 | Populus Rhizosphere | MKAQIYDKVRFKFKVMLIASIGVLATVIALGEMGII* |
| Ga0075418_111453971 | 3300009100 | Populus Rhizosphere | KLAFMKAEIYDRVDTRFKVLVAVSMALLATVVALGEMGII* |
| Ga0114129_102849852 | 3300009147 | Populus Rhizosphere | MKAEIYDKVDTKFKVLVAVSIGFLAAVIALGEMGII* |
| Ga0111538_103082742 | 3300009156 | Populus Rhizosphere | MKAEIYDRVSLKFKIILVASIGVLATVIALGEMGII* |
| Ga0111538_111646392 | 3300009156 | Populus Rhizosphere | MKAEIYDKVSLKFKIILVASIGVLAAVIALGEMGII* |
| Ga0105242_113868381 | 3300009176 | Miscanthus Rhizosphere | VFIMKAEINDQMGTKFKILLVASIGILLAVIALGEMGII* |
| Ga0105249_100599004 | 3300009553 | Switchgrass Rhizosphere | MKAEIYDKVSLRFKVLVAASIGILATVIALGEMGII* |
| Ga0105249_112859552 | 3300009553 | Switchgrass Rhizosphere | MKAVIYDKVSLKFKLILVASIGVLATVIALGEMGII* |
| Ga0105347_10737722 | 3300009609 | Soil | MKEETFDQMGTKFKILLAASIGILVAVIALGETGII* |
| Ga0105340_10744262 | 3300009610 | Soil | MKAEIYDKVSLKFKIILVASIGVLATVIALGEMGI |
| Ga0126304_101062941 | 3300010037 | Serpentine Soil | MKEEIFDQMGTKFKILLAASIGILIAVIALGETGII* |
| Ga0127502_105350652 | 3300011333 | Soil | MKAEINDQMSMKFKVLLAASIGILLTVIALGETGII* |
| Ga0127502_111292503 | 3300011333 | Soil | MRAEIFDRLGLKFKVLLVASIGVLAAVIALGEMGII* |
| Ga0137437_12561921 | 3300011442 | Soil | MKAVIYDKVSLKFKLILVASIGLLAAVIALGEMGII* |
| Ga0137465_12610051 | 3300012231 | Soil | MKAVIYDKVNMKFKVFLVAAIGVLATVIALGEMGII* |
| Ga0157304_10116611 | 3300012882 | Soil | FNVFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII* |
| Ga0157304_10141932 | 3300012882 | Soil | MQEETYDQLGTKFKIALVASIGILVAVIALGEMGII* |
| Ga0157281_10191522 | 3300012883 | Soil | MKAVIYDKVSLKFKVILIASIGVLATVIVLGEMGII* |
| Ga0157281_10435601 | 3300012883 | Soil | MKAEINDQMSTKFKILLVASIGVLAAVIVLGEMGII* |
| Ga0157305_102075181 | 3300012891 | Soil | MKAEIYDKVSLKFKIILVASIGILVAVIALGEMGII* |
| Ga0157303_100105131 | 3300012896 | Soil | MQEETYDQLGTKFKIVLVASIGILVAVIALGEMGII* |
| Ga0157308_104268132 | 3300012910 | Soil | FIMQEETYDQLGTKFKIILVASIGILITVIALGEMGII* |
| Ga0157301_100614192 | 3300012911 | Soil | FMKAEIYDKVSLKFKIILVASIGVLATVIALGEMGII* |
| Ga0157306_104575232 | 3300012912 | Soil | MRAEIYDRVSLKFKILLAASIGILAAVIVLGELGII* |
| Ga0157297_100374661 | 3300012914 | Soil | AEINDQMSTKFKILLVASIGVLAAVIVLGEMGII* |
| Ga0164309_108403221 | 3300012984 | Soil | NSKYSYMRAEIHDKVSGKFILLLVASLGVLATVIALGEMGII* |
| Ga0164307_100783932 | 3300012987 | Soil | MRAEIQDKVSGKFILLLVASLGVLATVIALGEMGII* |
| Ga0157375_110826571 | 3300013308 | Miscanthus Rhizosphere | MKAVIYDKVSLKFKIILVASIGVLATVIALGEMGI |
| Ga0134078_101858151 | 3300014157 | Grasslands Soil | NVFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII* |
| Ga0157380_112182191 | 3300014326 | Switchgrass Rhizosphere | MKAEINDQMGTKFKILLVASIGILLAVIALGEIGII* |
| Ga0157380_118492092 | 3300014326 | Switchgrass Rhizosphere | MKAEINDQMSTKFKILLVASIGVLAAVITLGEMGII* |
| Ga0180083_10754981 | 3300014875 | Soil | MKAVIYDKVGLKFKVVLVAAIGVLATVIALGEMGII* |
| Ga0132258_105989643 | 3300015371 | Arabidopsis Rhizosphere | MKAEINDQMSTKFKILLVASIGMLIAVIALGEMGII* |
| Ga0163161_104494412 | 3300017792 | Switchgrass Rhizosphere | MRAEIHDKVSGKFILLLVASLGVLATVIALGEMGII |
| Ga0163161_112890071 | 3300017792 | Switchgrass Rhizosphere | MQEETYDQLGTKFKIILVASIGILVAVIALGEMGII |
| Ga0184634_104229941 | 3300018031 | Groundwater Sediment | MKAEIYDKVSLKFKIILVASIGVLATVIALGEMGII |
| Ga0190270_100329382 | 3300018469 | Soil | MKAEINDQMGMKFKVLLAASIGILLAVIALGETGII |
| Ga0190274_100015162 | 3300018476 | Soil | MKEETFDQLGTKFKILLAASIGILVAVIALGETGII |
| Ga0190274_104092372 | 3300018476 | Soil | MKAEIYDKVSLKFKLILVASIGVLATVIALGEMGII |
| Ga0190274_116355291 | 3300018476 | Soil | MRAEIQDKVSGKFILLLVASLGVLATVIALGEMGI |
| Ga0190271_116807131 | 3300018481 | Soil | MQEETYDQLGTKFKLLLVASIGILVAVITLGEMGII |
| Ga0190273_112701411 | 3300018920 | Soil | MKSVFYDKAHRKFKVILILSIGLLAAVIALGKMGFI |
| Ga0184647_14871341 | 3300019263 | Groundwater Sediment | MKAEIYDKVSLKFKIILVASIGVLAAVIALGEMGII |
| Ga0173481_100820202 | 3300019356 | Soil | MKAVIYDKVSLKFKVILIASIGVLATVIVLGEMGII |
| Ga0173482_101328062 | 3300019361 | Soil | MQEETYDQLGTKFKIALVASIGILVAVIALGEMGII |
| Ga0173482_103725221 | 3300019361 | Soil | MKAEINDQMSTKFKILLVASIGVLAAVIVLGEMGII |
| Ga0193741_10097672 | 3300019884 | Soil | MKAVIYDKVSMRFKVVLIAAIGVLVTVIALGEMGII |
| Ga0193741_10545141 | 3300019884 | Soil | MRAEIYDRVPMKFKLLLAASIGVLVAVITLGELGII |
| Ga0193741_11123832 | 3300019884 | Soil | MKAEIYDKVDVKFKVLVAVSFGFLAAVIALGEMGII |
| Ga0193741_11605301 | 3300019884 | Soil | MRAEVYDRVSLKFKVLLAASIAILATVIALGELGII |
| Ga0193740_10231602 | 3300020009 | Soil | MKEEIYDQMGTKFKILLAASIGILVAVIALGEMGII |
| Ga0193738_100009312 | 3300020020 | Soil | MRAEIQDKVSGKFILLLVASLGVLATVIALGEMGII |
| Ga0193738_100045419 | 3300020020 | Soil | MQEETYDQLGTKFKILLVASIGMLVAVITLGEMGII |
| Ga0193738_10316491 | 3300020020 | Soil | MKAEIYDRVSLKFKIILFASIGVLATVIALGEMGII |
| Ga0193694_100000123 | 3300021415 | Soil | MKAEINDQMSTKFKILLVASIGILAAVIALGEMGII |
| Ga0222622_105920051 | 3300022756 | Groundwater Sediment | MKAEINDQMSTKFKILLVASIGVLAAVIALGEMGII |
| Ga0247746_10340301 | 3300022886 | Soil | KYFFMKAVIYDKVSLKFKVILIASIGVLATVIVLGEMGII |
| Ga0247795_10210912 | 3300022899 | Soil | MKAEINDQMGIKFKILLAASIGILLAVIALGETGII |
| Ga0247795_10668471 | 3300022899 | Soil | MKAVIYDKVSLKFKIILVASIGVLATVIALGEMGII |
| Ga0247794_101012042 | 3300024055 | Soil | MKAEINDQMGTKFKILLVASIGILLAVIALGEMGII |
| Ga0207642_107974682 | 3300025899 | Miscanthus Rhizosphere | LNVFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII |
| Ga0207680_101443191 | 3300025903 | Switchgrass Rhizosphere | MKAEINDQMSTRFKILLVASIGILAAVIALGEMGII |
| Ga0207646_114984061 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAVIYDKVSLKFKVIVVAAIGILATVIALGEMGII |
| Ga0207712_100159211 | 3300025961 | Switchgrass Rhizosphere | MKAEIYDKVSLRFKVLVAASIGILATVIALGEMGII |
| Ga0207712_101850302 | 3300025961 | Switchgrass Rhizosphere | MKAVIYDKVSLKFKLILVASIGVLATVIALGEMGII |
| Ga0207640_105645121 | 3300025981 | Corn Rhizosphere | KNSKYFYMRAEIQDKVSGKFILLLVASLGILATVIALGEMGII |
| Ga0207676_102336393 | 3300026095 | Switchgrass Rhizosphere | MKAVIYDKVSLRFKVIVAAAIGILIAVIALGETGII |
| Ga0209387_10521872 | 3300027639 | Agricultural Soil | MRAEIFDKISLKFKVLLAAAIGLLASVIVLGELGII |
| Ga0209261_100205522 | 3300027735 | Wetland Sediment | MKAVNYDKVSLKFKVILVAAIGILAAVIALGEMGIL |
| Ga0209683_100012004 | 3300027840 | Wetland Sediment | MKAVNYDKVSLKFKVILVAAIGILAEVIALGEMGIL |
| Ga0209481_100094013 | 3300027880 | Populus Rhizosphere | MRAEIFDRLGWKFKVLLAASIGLLATVIALGEMGII |
| Ga0209486_100450103 | 3300027886 | Agricultural Soil | MRAEIFDRVSLKFKVLLAAAIGLLASVIVLGELGII |
| Ga0209486_111532772 | 3300027886 | Agricultural Soil | MRAEIFDKVSLKFKVLLAAAIGLLASVIVLGELGII |
| Ga0268265_100406744 | 3300028380 | Switchgrass Rhizosphere | MKAEINDQMSTKFKILLVASIGILVAVIALGEMGII |
| Ga0310888_102900371 | 3300031538 | Soil | MKAVIYDKVSWKFKVILIASIGVLATVIALGEMGII |
| Ga0310888_111044362 | 3300031538 | Soil | MKEETFDQLGTKFKILLAASIGILIAVIALGETGII |
| Ga0310892_104307342 | 3300031858 | Soil | VFIMKAEINDQMSTKFKILLVASIGILAAVIALGEMGII |
| Ga0310891_102493611 | 3300031913 | Soil | MKAVIYDKVSLKFKVILIASIGVLATVIALGEMGII |
| Ga0307409_1013494942 | 3300031995 | Rhizosphere | MKAEINDQMGTKFKILLAASVGILVAVIALGEMGII |
| Ga0307471_1015422612 | 3300032180 | Hardwood Forest Soil | MRAEIYDRVSLRFKVLLAASIGILATVVALGEMGII |
| Ga0364945_0157554_226_336 | 3300034115 | Sediment | MKAVIYDKVSLRFKVVLIAAIGVLATVIALGEMGII |
| Ga0314800_062408_239_349 | 3300034675 | Soil | MIAEINDQMSTKFKILLVASIGILAAVIALGEMGII |
| ⦗Top⦘ |