| Basic Information | |
|---|---|
| Family ID | F072377 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRG |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 72.50 % |
| % of genes near scaffold ends (potentially truncated) | 35.54 % |
| % of genes from short scaffolds (< 2000 bps) | 76.03 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (42.149 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (38.017 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.587 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.950 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 18.60% Coil/Unstructured: 81.40% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF04098 | Rad52_Rad22 | 6.61 |
| PF13518 | HTH_28 | 3.31 |
| PF16945 | Phage_r1t_holin | 2.48 |
| PF14311 | DUF4379 | 1.65 |
| PF13384 | HTH_23 | 1.65 |
| PF02796 | HTH_7 | 0.83 |
| PF00856 | SET | 0.83 |
| PF13411 | MerR_1 | 0.83 |
| PF00325 | Crp | 0.83 |
| PF01510 | Amidase_2 | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.85 % |
| Unclassified | root | N/A | 42.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10222751 | Not Available | 514 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10234230 | Not Available | 545 | Open in IMG/M |
| 3300000947|BBAY92_10199519 | Not Available | 521 | Open in IMG/M |
| 3300005512|Ga0074648_1007330 | Not Available | 7953 | Open in IMG/M |
| 3300006025|Ga0075474_10026223 | All Organisms → Viruses → Predicted Viral | 2076 | Open in IMG/M |
| 3300006025|Ga0075474_10120693 | Not Available | 836 | Open in IMG/M |
| 3300006026|Ga0075478_10033953 | All Organisms → Viruses → Predicted Viral | 1696 | Open in IMG/M |
| 3300006027|Ga0075462_10007478 | All Organisms → Viruses → Predicted Viral | 3550 | Open in IMG/M |
| 3300006027|Ga0075462_10157039 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 693 | Open in IMG/M |
| 3300006027|Ga0075462_10237094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 542 | Open in IMG/M |
| 3300006400|Ga0075503_1656406 | Not Available | 566 | Open in IMG/M |
| 3300006404|Ga0075515_10933290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300006425|Ga0075486_1727182 | Not Available | 820 | Open in IMG/M |
| 3300006637|Ga0075461_10092501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 954 | Open in IMG/M |
| 3300006637|Ga0075461_10260767 | Not Available | 507 | Open in IMG/M |
| 3300006735|Ga0098038_1000067 | All Organisms → cellular organisms → Bacteria | 40349 | Open in IMG/M |
| 3300006735|Ga0098038_1005367 | All Organisms → cellular organisms → Bacteria | 5219 | Open in IMG/M |
| 3300006752|Ga0098048_1011077 | All Organisms → Viruses → Predicted Viral | 3183 | Open in IMG/M |
| 3300006793|Ga0098055_1333250 | Not Available | 565 | Open in IMG/M |
| 3300006802|Ga0070749_10008528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 6671 | Open in IMG/M |
| 3300006802|Ga0070749_10671157 | Not Available | 555 | Open in IMG/M |
| 3300006810|Ga0070754_10259323 | Not Available | 791 | Open in IMG/M |
| 3300006870|Ga0075479_10113837 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300006874|Ga0075475_10072414 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300006919|Ga0070746_10006057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 7043 | Open in IMG/M |
| 3300006919|Ga0070746_10387702 | Not Available | 628 | Open in IMG/M |
| 3300006920|Ga0070748_1281242 | Not Available | 594 | Open in IMG/M |
| 3300006924|Ga0098051_1058928 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300007229|Ga0075468_10146240 | Not Available | 718 | Open in IMG/M |
| 3300007236|Ga0075463_10054714 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
| 3300007344|Ga0070745_1223530 | Not Available | 688 | Open in IMG/M |
| 3300007345|Ga0070752_1226816 | Not Available | 735 | Open in IMG/M |
| 3300007538|Ga0099851_1095919 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300007540|Ga0099847_1079086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1013 | Open in IMG/M |
| 3300007542|Ga0099846_1090887 | All Organisms → Viruses → Predicted Viral | 1130 | Open in IMG/M |
| 3300009000|Ga0102960_1051729 | All Organisms → Viruses → Predicted Viral | 1513 | Open in IMG/M |
| 3300009000|Ga0102960_1090362 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300009001|Ga0102963_1162454 | Not Available | 898 | Open in IMG/M |
| 3300009001|Ga0102963_1394988 | Not Available | 542 | Open in IMG/M |
| 3300009027|Ga0102957_1411033 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 507 | Open in IMG/M |
| 3300009124|Ga0118687_10036476 | All Organisms → Viruses → Predicted Viral | 1625 | Open in IMG/M |
| 3300010300|Ga0129351_1050948 | All Organisms → Viruses → Predicted Viral | 1693 | Open in IMG/M |
| 3300010300|Ga0129351_1253184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 673 | Open in IMG/M |
| 3300010368|Ga0129324_10254783 | Not Available | 699 | Open in IMG/M |
| 3300010389|Ga0136549_10123553 | All Organisms → Viruses → Predicted Viral | 1190 | Open in IMG/M |
| 3300011118|Ga0114922_11215028 | Not Available | 609 | Open in IMG/M |
| 3300011118|Ga0114922_11687520 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 508 | Open in IMG/M |
| 3300012525|Ga0129353_1769648 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300017714|Ga0181412_1066884 | Not Available | 883 | Open in IMG/M |
| 3300017818|Ga0181565_10011145 | All Organisms → cellular organisms → Bacteria | 6771 | Open in IMG/M |
| 3300017952|Ga0181583_10208363 | Not Available | 1279 | Open in IMG/M |
| 3300017956|Ga0181580_10275159 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
| 3300017956|Ga0181580_10751193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 617 | Open in IMG/M |
| 3300017956|Ga0181580_11050385 | Not Available | 501 | Open in IMG/M |
| 3300017962|Ga0181581_10688995 | Not Available | 615 | Open in IMG/M |
| 3300017963|Ga0180437_10250114 | All Organisms → Viruses → Predicted Viral | 1368 | Open in IMG/M |
| 3300017967|Ga0181590_10157141 | All Organisms → Viruses → Predicted Viral | 1736 | Open in IMG/M |
| 3300017969|Ga0181585_10275855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1177 | Open in IMG/M |
| 3300018416|Ga0181553_10207006 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300018416|Ga0181553_10613194 | Not Available | 574 | Open in IMG/M |
| 3300018420|Ga0181563_10718101 | Not Available | 551 | Open in IMG/M |
| 3300018421|Ga0181592_10142547 | All Organisms → Viruses → Predicted Viral | 1833 | Open in IMG/M |
| 3300018424|Ga0181591_10962540 | Not Available | 582 | Open in IMG/M |
| 3300018424|Ga0181591_10984858 | Not Available | 574 | Open in IMG/M |
| 3300018424|Ga0181591_10986087 | Not Available | 573 | Open in IMG/M |
| 3300018426|Ga0181566_10165389 | Not Available | 1654 | Open in IMG/M |
| 3300019751|Ga0194029_1095585 | Not Available | 519 | Open in IMG/M |
| 3300020439|Ga0211558_10014525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 4067 | Open in IMG/M |
| 3300020460|Ga0211486_10119581 | All Organisms → Viruses → Predicted Viral | 1172 | Open in IMG/M |
| 3300021347|Ga0213862_10000089 | All Organisms → cellular organisms → Bacteria | 34710 | Open in IMG/M |
| 3300021356|Ga0213858_10015782 | All Organisms → Viruses → Predicted Viral | 3583 | Open in IMG/M |
| 3300021356|Ga0213858_10176191 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| 3300021356|Ga0213858_10255074 | Not Available | 844 | Open in IMG/M |
| 3300021356|Ga0213858_10596848 | Not Available | 502 | Open in IMG/M |
| 3300021364|Ga0213859_10099219 | All Organisms → Viruses → Predicted Viral | 1381 | Open in IMG/M |
| 3300021364|Ga0213859_10204685 | Not Available | 914 | Open in IMG/M |
| 3300021368|Ga0213860_10065952 | All Organisms → Viruses → Predicted Viral | 1560 | Open in IMG/M |
| 3300021958|Ga0222718_10031337 | All Organisms → Viruses → Predicted Viral | 3554 | Open in IMG/M |
| 3300021958|Ga0222718_10044355 | Not Available | 2869 | Open in IMG/M |
| 3300021958|Ga0222718_10070672 | All Organisms → Viruses → Predicted Viral | 2135 | Open in IMG/M |
| 3300021958|Ga0222718_10224245 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300021958|Ga0222718_10330108 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 782 | Open in IMG/M |
| 3300021958|Ga0222718_10524506 | Not Available | 568 | Open in IMG/M |
| 3300021959|Ga0222716_10386362 | Not Available | 817 | Open in IMG/M |
| 3300021959|Ga0222716_10681822 | Not Available | 548 | Open in IMG/M |
| 3300021960|Ga0222715_10022873 | All Organisms → Viruses → Predicted Viral | 4637 | Open in IMG/M |
| 3300021961|Ga0222714_10082552 | All Organisms → Viruses → Predicted Viral | 2089 | Open in IMG/M |
| 3300021961|Ga0222714_10390096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
| 3300021964|Ga0222719_10030793 | All Organisms → Viruses → Predicted Viral | 4211 | Open in IMG/M |
| 3300021964|Ga0222719_10037142 | All Organisms → Viruses → Predicted Viral | 3785 | Open in IMG/M |
| 3300021964|Ga0222719_10836510 | Not Available | 502 | Open in IMG/M |
| 3300022050|Ga0196883_1014451 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 940 | Open in IMG/M |
| 3300022057|Ga0212025_1089991 | Not Available | 526 | Open in IMG/M |
| 3300022149|Ga0196907_110943 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 500 | Open in IMG/M |
| 3300022183|Ga0196891_1080185 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 579 | Open in IMG/M |
| 3300022187|Ga0196899_1091553 | Not Available | 914 | Open in IMG/M |
| 3300022187|Ga0196899_1151790 | Not Available | 643 | Open in IMG/M |
| 3300022208|Ga0224495_10289372 | Not Available | 662 | Open in IMG/M |
| 3300023170|Ga0255761_10342194 | Not Available | 764 | Open in IMG/M |
| 3300023170|Ga0255761_10528213 | Not Available | 551 | Open in IMG/M |
| 3300023180|Ga0255768_10526907 | Not Available | 591 | Open in IMG/M |
| 3300025070|Ga0208667_1000077 | All Organisms → cellular organisms → Bacteria | 41571 | Open in IMG/M |
| 3300025070|Ga0208667_1011645 | All Organisms → Viruses → Predicted Viral | 1972 | Open in IMG/M |
| 3300025674|Ga0208162_1004476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 6535 | Open in IMG/M |
| 3300025674|Ga0208162_1006874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 5100 | Open in IMG/M |
| 3300025759|Ga0208899_1005100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 8111 | Open in IMG/M |
| 3300025759|Ga0208899_1011377 | All Organisms → Viruses → Predicted Viral | 4905 | Open in IMG/M |
| 3300025759|Ga0208899_1080842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1268 | Open in IMG/M |
| 3300025759|Ga0208899_1110453 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300025759|Ga0208899_1234736 | Not Available | 556 | Open in IMG/M |
| 3300025759|Ga0208899_1236804 | Not Available | 552 | Open in IMG/M |
| 3300025769|Ga0208767_1094916 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
| 3300025803|Ga0208425_1143692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 533 | Open in IMG/M |
| 3300025806|Ga0208545_1107628 | Not Available | 718 | Open in IMG/M |
| 3300025853|Ga0208645_1194351 | Not Available | 725 | Open in IMG/M |
| 3300025889|Ga0208644_1091097 | All Organisms → Viruses → Predicted Viral | 1528 | Open in IMG/M |
| 3300026187|Ga0209929_1005327 | All Organisms → Viruses → Predicted Viral | 4401 | Open in IMG/M |
| 3300027901|Ga0209427_10092064 | All Organisms → Viruses → Predicted Viral | 2731 | Open in IMG/M |
| 3300027917|Ga0209536_100087256 | All Organisms → Viruses → Predicted Viral | 3988 | Open in IMG/M |
| 3300027917|Ga0209536_100088220 | All Organisms → Viruses → Predicted Viral | 3964 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 38.02% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 16.53% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 11.57% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 6.61% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.79% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 4.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 2.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.48% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.65% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.65% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.65% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.83% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.83% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.83% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.83% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.83% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.83% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006404 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022149 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_102227513 | 3300000115 | Marine | MSYVNQIDWNCGCMRMTEFDYRTHKERTVGRSYCKKKNCDRRLQKI* |
| DelMOWin2010_102342302 | 3300000117 | Marine | MXYVNXIDWNCGCMRMTEFNXRTHKERTVGRSYCNKKXCDRRLKKI* |
| BBAY92_101995193 | 3300000947 | Macroalgal Surface | MSYVNQIDWICGCMRMTEFNFMSGKERTVGRSYCRKQDCDRKEK* |
| Ga0074648_10073309 | 3300005512 | Saline Water And Sediment | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK* |
| Ga0075474_100262232 | 3300006025 | Aqueous | MSYVNQIDWNCGCMRMTEFDYRTHKERTVGRSYCNKKNCDRRLQKI* |
| Ga0075474_101206933 | 3300006025 | Aqueous | MSYVNQIDWNCGCMRMTEFNYRTHKERTVGRSYCNKKDCDRRLKKI* |
| Ga0075478_100339534 | 3300006026 | Aqueous | RRQVMSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK* |
| Ga0075462_100074786 | 3300006027 | Aqueous | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKKDCDRKVTQ* |
| Ga0075462_101570392 | 3300006027 | Aqueous | MSYVNQIDWNCGCMRMTEFNYRTHKERTVGRSYCNKKNCDRRLQKI* |
| Ga0075462_102370943 | 3300006027 | Aqueous | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRG* |
| Ga0075503_16564062 | 3300006400 | Aqueous | SEREVMSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK* |
| Ga0075515_109332903 | 3300006404 | Aqueous | CGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK* |
| Ga0075486_17271821 | 3300006425 | Aqueous | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK* |
| Ga0075461_100925011 | 3300006637 | Aqueous | IDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK* |
| Ga0075461_102607672 | 3300006637 | Aqueous | TCGCMRMTEFDYRSGKERTVGRSYCRKKDCDRKVTQ* |
| Ga0098038_100006726 | 3300006735 | Marine | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRK* |
| Ga0098038_100536713 | 3300006735 | Marine | MSFVNQIDWNCGCMRMTEFNYRTHKERTVGRSYCNKKNCDRRLQKI* |
| Ga0098048_10110779 | 3300006752 | Marine | MSFVNQIDWNCGCMRMTEFNYRTHKERTVGRSYCNKKNCDRRL |
| Ga0098055_13332501 | 3300006793 | Marine | MAHVNQIDWNCGCMRMTEFNYRTHKERTVGRSYCNKKNCDRRLQKI* |
| Ga0070749_1000852816 | 3300006802 | Aqueous | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQNCDRRNSV* |
| Ga0070749_106711571 | 3300006802 | Aqueous | LYGGRIIYYVNKIDWNCGCMRMTEFDYRTHKERTVGRSYCNKKNCDRRLQKI* |
| Ga0070754_102593231 | 3300006810 | Aqueous | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRNNG* |
| Ga0075479_101138373 | 3300006870 | Aqueous | MSYVNQIDWTCGWMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK* |
| Ga0075475_100724145 | 3300006874 | Aqueous | WTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRG* |
| Ga0070746_100060578 | 3300006919 | Aqueous | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCKKQNCDRRNSV* |
| Ga0070746_103877022 | 3300006919 | Aqueous | WTCGCMRMTEFDYRSGKERTVGRSYCRKKDCDRKVTQ* |
| Ga0070748_12812423 | 3300006920 | Aqueous | MSFVNQIDWSCGCMRMTEFDYRSGKERTVGRSYCRKQDCNRKGK* |
| Ga0098051_10589283 | 3300006924 | Marine | MAHVNQIDWNCGCMRMTEFNYRTHKERTVGRSYCNKKNCDRRLKKI* |
| Ga0075468_101462401 | 3300007229 | Aqueous | RIMSYVNQIDWNCGCMRMTEFDYRTHKERTVGRSYCNKKNCDRRLQKI* |
| Ga0075463_100547141 | 3300007236 | Aqueous | VNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKKDCDRKVTQ* |
| Ga0070745_12235304 | 3300007344 | Aqueous | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRK |
| Ga0070752_12268161 | 3300007345 | Aqueous | VNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRNNG* |
| Ga0099851_10959194 | 3300007538 | Aqueous | MSYVNQIDWTCGCMRMTEFDYRSGRERTVGRSYCRKQDCDRRNNG* |
| Ga0099847_10790863 | 3300007540 | Aqueous | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCNRRNNG* |
| Ga0099846_10908873 | 3300007542 | Aqueous | MSYVNQIDWTCGCMKMTEFDYRSGKERTVGRSYCRKQDCDRRNNG* |
| Ga0102960_10517295 | 3300009000 | Pond Water | MANVNQIDWNCGCMRMTEFNYRTHTERTVGRSYCNKNNCDRRLQKI* |
| Ga0102960_10903624 | 3300009000 | Pond Water | MAYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCERRKNND* |
| Ga0102963_11624543 | 3300009001 | Pond Water | MAYVNQIDWNCGCMRMTEFDYRSGKERTVGRSYCRKQGCDRRNNG* |
| Ga0102963_13949882 | 3300009001 | Pond Water | MSYVNQIDWTCGCMRMTEFNYRSGKERTVGRSYCRKKDCDRRNNGRRLY* |
| Ga0102957_14110331 | 3300009027 | Pond Water | MANVNQIDWNCGCMRMTEFNYRTHTERTVGRSYCNKNNCD |
| Ga0118687_100364761 | 3300009124 | Sediment | WTCGCMRMTEFDYRSGKERTVGRSYCRKQGCDRRNNG* |
| Ga0129351_10509482 | 3300010300 | Freshwater To Marine Saline Gradient | MSYVNQIDWTCGCMRMTEFDYRTGRERTVGRSYCRKQDCDRRRK* |
| Ga0129351_12531841 | 3300010300 | Freshwater To Marine Saline Gradient | YKTTKSRGGRMSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRNNG* |
| Ga0129324_102547832 | 3300010368 | Freshwater To Marine Saline Gradient | MSYVNQIDWTCGCMRMTEFDYTSGKERTVGRSYCRKQDCDRKGK* |
| Ga0136549_101235535 | 3300010389 | Marine Methane Seep Sediment | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGKSYCRKQDCDRKGK* |
| Ga0114922_112150284 | 3300011118 | Deep Subsurface | MSFVNQIDWNCGCMRMTEFDYRTHKERTVGRSYCNKK |
| Ga0114922_116875201 | 3300011118 | Deep Subsurface | GGRIMSYVNQIDWNCGCMRMTEFDYRTHKERTVGRSYCNKKNCDRRLQKI* |
| Ga0129353_17696483 | 3300012525 | Aqueous | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRNNG* |
| Ga0181412_10668844 | 3300017714 | Seawater | MAHVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKKDCDRRNNG |
| Ga0181565_1001114516 | 3300017818 | Salt Marsh | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGKSYCRKQDCDRRG |
| Ga0181583_102083633 | 3300017952 | Salt Marsh | MSFVNQLDWPCGCMRMTEFDYRSNKERTIGRSYCKKQDCDRRNNADL |
| Ga0181580_102751592 | 3300017956 | Salt Marsh | MSFVNQLDWPCGCMRMTEFDYRSNKERTIGRSYCKKQDCDRRNNGMGIN |
| Ga0181580_107511931 | 3300017956 | Salt Marsh | VMSYVNQIDWTCGCMRMTEFDYRSGKERTVGKSYCRKQDCDRRG |
| Ga0181580_110503852 | 3300017956 | Salt Marsh | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGN |
| Ga0181581_106889953 | 3300017962 | Salt Marsh | WPCGCMRMTEFDYRSNKERTIGRSYCKKQDCDRRNNGMGIN |
| Ga0180437_102501143 | 3300017963 | Hypersaline Lake Sediment | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK |
| Ga0181590_101571414 | 3300017967 | Salt Marsh | MSFVNQLDWPCGCMRMTEFDYRSNKERTVGRSYCKKQDCDRRNNGMGIN |
| Ga0181590_107926511 | 3300017967 | Salt Marsh | TCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK |
| Ga0181585_102758555 | 3300017969 | Salt Marsh | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGKSYCRKQDCDRRG |
| Ga0181553_102070062 | 3300018416 | Salt Marsh | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGDK |
| Ga0181553_106131941 | 3300018416 | Salt Marsh | RIMSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK |
| Ga0181563_107181011 | 3300018420 | Salt Marsh | MSFVNQIDWTCGCMRMTEFNYRSGKERTVGRSYCRKQDCDRKGK |
| Ga0181592_101425476 | 3300018421 | Salt Marsh | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKKDCDRKVTQ |
| Ga0181591_109625401 | 3300018424 | Salt Marsh | SEREVMSYVNQIDWTCGCMRMKEFDYRSGKERTVGRSYCKKLDCDRKGK |
| Ga0181591_109848584 | 3300018424 | Salt Marsh | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDC |
| Ga0181591_109860872 | 3300018424 | Salt Marsh | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRK |
| Ga0181566_101653892 | 3300018426 | Salt Marsh | MSFVNQLDWPCGCMRMTEFDYRSNKERTVGRSYCKKQDCDRRNNAR |
| Ga0194029_10955853 | 3300019751 | Freshwater | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRNNEKI |
| Ga0211558_100145251 | 3300020439 | Marine | MSFVNQLDWPCGCMRMTEFDYRSGKERTVGKSYCRKQDCDRRSNANL |
| Ga0211486_101195814 | 3300020460 | Marine | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCERKERANA |
| Ga0213862_1000008929 | 3300021347 | Seawater | MSYVNQIDWNCGCMRMTEFDYRTHKERTVGRSYCNKKNCDRRLQKI |
| Ga0213858_100157827 | 3300021356 | Seawater | MSYVNQIDWTCGCMRMTEFDYRTGRERTVGRSYCRKQDCNRRSKI |
| Ga0213858_101761911 | 3300021356 | Seawater | MSYVNQIDWTCGCMRMTEFDYTSGKERTVGRSYCRKQDCDRRNNE |
| Ga0213858_102550743 | 3300021356 | Seawater | MSFVNQLDWPCGCMRMTEFDYRSNKERTVGRSYCKKQDCDRRNNV |
| Ga0213858_105968481 | 3300021356 | Seawater | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCR |
| Ga0213859_100992193 | 3300021364 | Seawater | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQNCDRRNNG |
| Ga0213859_102046851 | 3300021364 | Seawater | MSFVNQIDWTCGCMRMTEFDFMSGKERTVGRSYCRKQDCERKERANA |
| Ga0213860_100659523 | 3300021368 | Seawater | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRNNG |
| Ga0222718_100313378 | 3300021958 | Estuarine Water | MSYVNQIDWTCGCMRMTEFNYRSGKERTVGRSYCRKQDCNRKGK |
| Ga0222718_100443551 | 3300021958 | Estuarine Water | MAYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQG |
| Ga0222718_100706724 | 3300021958 | Estuarine Water | MAHVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKKDCDRRNNRRRLY |
| Ga0222718_102242454 | 3300021958 | Estuarine Water | MAYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQGCDRRNNGLGNI |
| Ga0222718_103301081 | 3300021958 | Estuarine Water | WTCGCMRMTEFDYRSGKERTVGRSYCRKQGCDRRNNGVTNNL |
| Ga0222718_105245064 | 3300021958 | Estuarine Water | MAYVNQIDWNCGCMRMTEFDYRSGKERTVGRSYCRKQGCDRRNNG |
| Ga0222716_103863621 | 3300021959 | Estuarine Water | MAYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQGCDRRNNG |
| Ga0222716_106818222 | 3300021959 | Estuarine Water | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKLDCDRKNNEL |
| Ga0222715_1002287313 | 3300021960 | Estuarine Water | MSFVNQIDWTCGCMRMTEFDYRSDKERTVGRSYCKKQNCDRRNNVQSN |
| Ga0222714_1008255210 | 3300021961 | Estuarine Water | GGIMSFVNQIDWTCGCMRMTEFNYRSGKERTVGRSYCRKQDCDRKGK |
| Ga0222714_103900961 | 3300021961 | Estuarine Water | IDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK |
| Ga0222719_100307939 | 3300021964 | Estuarine Water | MSYVNQIDWTCGCMRMTEFNYRSGKERTVGRSYCRKQDCDRKGK |
| Ga0222719_1003714210 | 3300021964 | Estuarine Water | MAHVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKKDCDRRNNGRRLY |
| Ga0222719_108365103 | 3300021964 | Estuarine Water | MRGGRIMAYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRKNNDST |
| Ga0196883_10144513 | 3300022050 | Aqueous | MAYVNQIDWNCGCMRMTEFNYRTHKERTVGRSYCNKKNCDRRLQKI |
| Ga0212025_10899912 | 3300022057 | Aqueous | MSYVNQIDWNCGCMRMTEFNYRTHKERTVGRSYCNKKDCDRRLKKI |
| Ga0196907_1109433 | 3300022149 | Aqueous | LFGGRIMSYVNQIDWNCGCMRMTEFDYRTHKERTVGRSYCNKKNCDRRLQKI |
| Ga0196891_10801852 | 3300022183 | Aqueous | MSYVNQIDWNCGCMRMTEFNYRTHKERTVGRSYCNKKNCDRRLQKI |
| Ga0196899_10915535 | 3300022187 | Aqueous | SYVNQIDWNCGCMRMTEFNYRTHKERTVGRSYCNKKDCDRRLQKI |
| Ga0196899_11517901 | 3300022187 | Aqueous | QIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK |
| Ga0224495_102893721 | 3300022208 | Sediment | MAYVNQIDWACGCMRMTEFDYRSGKERTVGRSYCRKQGCDRRNNGYIXXVV |
| Ga0255761_103421944 | 3300023170 | Salt Marsh | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQ |
| Ga0255761_105282131 | 3300023170 | Salt Marsh | MSFVNQLDWPCGCMRMTEFDYRSNKERTIGRSYCKKQDCDRRNNGMG |
| Ga0255768_105269073 | 3300023180 | Salt Marsh | MSYVNQIDWTCGCMRMKEFDYRSGKERTVGRSYCKKLDCDRKGK |
| Ga0208667_100007753 | 3300025070 | Marine | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRK |
| Ga0208667_10116452 | 3300025070 | Marine | MSFVNQIDWNCGCMRMTEFNYRTHKERTVGRSYCNKKNCDRRLQKI |
| Ga0208162_100447616 | 3300025674 | Aqueous | MSYVNQIDWTCGCMRMTEFDYRSGRERTVGRSYCRKQDCDRRNNG |
| Ga0208162_10068741 | 3300025674 | Aqueous | GGRMSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRNNG |
| Ga0208899_100510012 | 3300025759 | Aqueous | MSFVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQNCDRRNSV |
| Ga0208899_10113775 | 3300025759 | Aqueous | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRG |
| Ga0208899_10808421 | 3300025759 | Aqueous | REVMSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCNRKGK |
| Ga0208899_11104531 | 3300025759 | Aqueous | WSRSTGGGIMSYVNQIDWNCGCMRMTEFDYRTHKERTVGRSYCNKKNCDRRLQKI |
| Ga0208899_12347362 | 3300025759 | Aqueous | MSYVNQIDWTCGCMRMTEFDYRSVKERTVGRSYCRKQDCNRKGK |
| Ga0208899_12368042 | 3300025759 | Aqueous | MSYVNQIDWTCGCMRMTEFDYTSGKERTVGRSYCRKQDCDRKGK |
| Ga0208767_10949163 | 3300025769 | Aqueous | WTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK |
| Ga0208425_11436921 | 3300025803 | Aqueous | IDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRRG |
| Ga0208545_11076283 | 3300025806 | Aqueous | RIMSYVNQIDWNCGCMRMTEFDYRTHKERTVGRSYCNKKNCDRRLQKI |
| Ga0208645_11943513 | 3300025853 | Aqueous | SEREVMSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK |
| Ga0208644_10910977 | 3300025889 | Aqueous | MSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDR |
| Ga0209929_10053277 | 3300026187 | Pond Water | MANVNQIDWNCGCMRMTEFNYRTHTERTVGRSYCNKNNCDRRLQKI |
| Ga0209427_100920646 | 3300027901 | Marine Sediment | MRNGGGMSYVNQIDWTCGCMRMTEFDYRSGKERTVGRSYCRKQDCDRKGK |
| Ga0209536_1000872562 | 3300027917 | Marine Sediment | MSFVNQLDWPCGCMRMTEFDYRSNKERTIGRSYCKKQDCYRRSNADL |
| Ga0209536_1000882207 | 3300027917 | Marine Sediment | MSYVNQIDWTCGCMRMTEFDYRTGRERTVGRSYCRKQDCDRRRK |
| ⦗Top⦘ |