| Basic Information | |
|---|---|
| Family ID | F072335 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRMNGGLQAHWQDEWILLKRKWNSWNRMHPNEQVKWEDYYDANRK |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 28.10 % |
| % of genes near scaffold ends (potentially truncated) | 15.70 % |
| % of genes from short scaffolds (< 2000 bps) | 81.82 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.463 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (21.488 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.207 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (98.347 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.47% β-sheet: 0.00% Coil/Unstructured: 57.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF04545 | Sigma70_r4 | 21.49 |
| PF04542 | Sigma70_r2 | 9.09 |
| PF00140 | Sigma70_r1_2 | 4.13 |
| PF00154 | RecA | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 13.22 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 9.09 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 9.09 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 9.09 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.46 % |
| All Organisms | root | All Organisms | 35.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10026897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3231 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10031051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2360 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10020966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3189 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10072543 | Not Available | 1393 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10034069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2439 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10058529 | Not Available | 1636 | Open in IMG/M |
| 3300001460|JGI24003J15210_10125580 | Not Available | 693 | Open in IMG/M |
| 3300001589|JGI24005J15628_10074047 | Not Available | 1220 | Open in IMG/M |
| 3300001959|GOS2247_1012670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1314 | Open in IMG/M |
| 3300002482|JGI25127J35165_1007303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2868 | Open in IMG/M |
| 3300002482|JGI25127J35165_1008215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2702 | Open in IMG/M |
| 3300002482|JGI25127J35165_1079403 | Not Available | 676 | Open in IMG/M |
| 3300002482|JGI25127J35165_1086358 | Not Available | 642 | Open in IMG/M |
| 3300006025|Ga0075474_10016606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2720 | Open in IMG/M |
| 3300006027|Ga0075462_10155819 | Not Available | 697 | Open in IMG/M |
| 3300006484|Ga0070744_10029055 | Not Available | 1637 | Open in IMG/M |
| 3300006484|Ga0070744_10078027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
| 3300006735|Ga0098038_1040827 | Not Available | 1703 | Open in IMG/M |
| 3300006735|Ga0098038_1140153 | Not Available | 811 | Open in IMG/M |
| 3300006737|Ga0098037_1243916 | Not Available | 578 | Open in IMG/M |
| 3300006737|Ga0098037_1264913 | Not Available | 548 | Open in IMG/M |
| 3300006749|Ga0098042_1009248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3151 | Open in IMG/M |
| 3300006749|Ga0098042_1020717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1937 | Open in IMG/M |
| 3300006749|Ga0098042_1150217 | Not Available | 571 | Open in IMG/M |
| 3300006802|Ga0070749_10065646 | Not Available | 2184 | Open in IMG/M |
| 3300006810|Ga0070754_10309314 | Not Available | 707 | Open in IMG/M |
| 3300006867|Ga0075476_10218555 | Not Available | 688 | Open in IMG/M |
| 3300006874|Ga0075475_10252497 | Not Available | 739 | Open in IMG/M |
| 3300006916|Ga0070750_10129984 | Not Available | 1151 | Open in IMG/M |
| 3300006919|Ga0070746_10269026 | Not Available | 791 | Open in IMG/M |
| 3300007234|Ga0075460_10082172 | Not Available | 1174 | Open in IMG/M |
| 3300007344|Ga0070745_1188376 | Not Available | 767 | Open in IMG/M |
| 3300007345|Ga0070752_1344216 | Not Available | 560 | Open in IMG/M |
| 3300007346|Ga0070753_1038059 | Not Available | 2031 | Open in IMG/M |
| 3300007346|Ga0070753_1148781 | Not Available | 888 | Open in IMG/M |
| 3300007555|Ga0102817_1045875 | Not Available | 958 | Open in IMG/M |
| 3300007647|Ga0102855_1147525 | Not Available | 629 | Open in IMG/M |
| 3300009079|Ga0102814_10028049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3204 | Open in IMG/M |
| 3300009433|Ga0115545_1237596 | Not Available | 614 | Open in IMG/M |
| 3300009436|Ga0115008_10470472 | Not Available | 896 | Open in IMG/M |
| 3300010148|Ga0098043_1132997 | Not Available | 711 | Open in IMG/M |
| 3300010148|Ga0098043_1181939 | Not Available | 587 | Open in IMG/M |
| 3300010300|Ga0129351_1031229 | Not Available | 2203 | Open in IMG/M |
| 3300010300|Ga0129351_1317779 | Not Available | 587 | Open in IMG/M |
| 3300012920|Ga0160423_10192627 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1422 | Open in IMG/M |
| 3300012936|Ga0163109_10156969 | All Organisms → Viruses → Predicted Viral | 1672 | Open in IMG/M |
| 3300012953|Ga0163179_10871803 | Not Available | 777 | Open in IMG/M |
| 3300017697|Ga0180120_10284121 | Not Available | 665 | Open in IMG/M |
| 3300017706|Ga0181377_1021118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1427 | Open in IMG/M |
| 3300017708|Ga0181369_1121799 | Not Available | 529 | Open in IMG/M |
| 3300017713|Ga0181391_1096417 | Not Available | 669 | Open in IMG/M |
| 3300017720|Ga0181383_1066733 | Not Available | 966 | Open in IMG/M |
| 3300017720|Ga0181383_1070577 | Not Available | 938 | Open in IMG/M |
| 3300017720|Ga0181383_1191903 | Not Available | 544 | Open in IMG/M |
| 3300017724|Ga0181388_1036047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1209 | Open in IMG/M |
| 3300017726|Ga0181381_1125611 | Not Available | 536 | Open in IMG/M |
| 3300017737|Ga0187218_1133574 | Not Available | 589 | Open in IMG/M |
| 3300017745|Ga0181427_1015956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1881 | Open in IMG/M |
| 3300017748|Ga0181393_1140307 | Not Available | 606 | Open in IMG/M |
| 3300017749|Ga0181392_1090717 | Not Available | 917 | Open in IMG/M |
| 3300017756|Ga0181382_1143290 | Not Available | 627 | Open in IMG/M |
| 3300017763|Ga0181410_1199910 | Not Available | 547 | Open in IMG/M |
| 3300017765|Ga0181413_1177123 | Not Available | 639 | Open in IMG/M |
| 3300017765|Ga0181413_1263334 | Not Available | 506 | Open in IMG/M |
| 3300017768|Ga0187220_1061158 | Not Available | 1132 | Open in IMG/M |
| 3300017769|Ga0187221_1225896 | Not Available | 534 | Open in IMG/M |
| 3300017781|Ga0181423_1205223 | Not Available | 745 | Open in IMG/M |
| 3300017782|Ga0181380_1061230 | Not Available | 1334 | Open in IMG/M |
| 3300018413|Ga0181560_10397430 | Not Available | 633 | Open in IMG/M |
| 3300018416|Ga0181553_10090883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1906 | Open in IMG/M |
| 3300018417|Ga0181558_10346711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300020165|Ga0206125_10026423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3286 | Open in IMG/M |
| 3300020176|Ga0181556_1082028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1532 | Open in IMG/M |
| 3300020378|Ga0211527_10182423 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 590 | Open in IMG/M |
| 3300020419|Ga0211512_10106966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
| 3300020428|Ga0211521_10279057 | Not Available | 746 | Open in IMG/M |
| 3300020463|Ga0211676_10113731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1760 | Open in IMG/M |
| 3300020469|Ga0211577_10211277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1272 | Open in IMG/M |
| 3300021335|Ga0213867_1041409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1790 | Open in IMG/M |
| 3300021375|Ga0213869_10180996 | Not Available | 962 | Open in IMG/M |
| 3300021378|Ga0213861_10215359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
| 3300021957|Ga0222717_10099402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1819 | Open in IMG/M |
| 3300021957|Ga0222717_10693789 | Not Available | 521 | Open in IMG/M |
| 3300021960|Ga0222715_10501832 | Not Available | 644 | Open in IMG/M |
| 3300022055|Ga0224898_100839 | Not Available | 552 | Open in IMG/M |
| 3300022068|Ga0212021_1018877 | Not Available | 1271 | Open in IMG/M |
| 3300022068|Ga0212021_1066534 | Not Available | 738 | Open in IMG/M |
| 3300022069|Ga0212026_1035598 | Not Available | 738 | Open in IMG/M |
| 3300022071|Ga0212028_1052470 | Not Available | 762 | Open in IMG/M |
| 3300022074|Ga0224906_1004314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6114 | Open in IMG/M |
| 3300022074|Ga0224906_1011063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3480 | Open in IMG/M |
| 3300024188|Ga0228602_1068154 | Not Available | 594 | Open in IMG/M |
| 3300024228|Ga0228633_1070265 | Not Available | 851 | Open in IMG/M |
| 3300024230|Ga0228638_1156600 | Not Available | 521 | Open in IMG/M |
| 3300024266|Ga0228661_1007885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1828 | Open in IMG/M |
| 3300024292|Ga0228630_1097599 | Not Available | 604 | Open in IMG/M |
| 3300024346|Ga0244775_10065026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3138 | Open in IMG/M |
| 3300025086|Ga0208157_1035722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1407 | Open in IMG/M |
| 3300025101|Ga0208159_1010132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2571 | Open in IMG/M |
| 3300025102|Ga0208666_1079325 | Not Available | 848 | Open in IMG/M |
| 3300025120|Ga0209535_1049845 | Not Available | 1794 | Open in IMG/M |
| 3300025127|Ga0209348_1009434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3966 | Open in IMG/M |
| 3300025127|Ga0209348_1009917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3843 | Open in IMG/M |
| 3300025127|Ga0209348_1039589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1641 | Open in IMG/M |
| 3300025127|Ga0209348_1094971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
| 3300025543|Ga0208303_1096922 | Not Available | 629 | Open in IMG/M |
| 3300025610|Ga0208149_1019165 | Not Available | 1968 | Open in IMG/M |
| 3300025751|Ga0208150_1249233 | Not Available | 536 | Open in IMG/M |
| 3300025806|Ga0208545_1033212 | Not Available | 1643 | Open in IMG/M |
| 3300026471|Ga0247602_1054382 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1113 | Open in IMG/M |
| 3300026491|Ga0228641_1008869 | Not Available | 2858 | Open in IMG/M |
| 3300027186|Ga0208797_1027156 | Not Available | 754 | Open in IMG/M |
| 3300027367|Ga0208801_1065128 | Not Available | 537 | Open in IMG/M |
| 3300028111|Ga0233397_1031211 | Not Available | 1676 | Open in IMG/M |
| 3300028126|Ga0228648_1040181 | Not Available | 859 | Open in IMG/M |
| 3300029448|Ga0183755_1012560 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 3211 | Open in IMG/M |
| 3300029448|Ga0183755_1024980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1876 | Open in IMG/M |
| 3300029448|Ga0183755_1105355 | Not Available | 544 | Open in IMG/M |
| 3300029787|Ga0183757_1016626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1868 | Open in IMG/M |
| 3300032047|Ga0315330_10048048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2853 | Open in IMG/M |
| 3300034418|Ga0348337_183356 | Not Available | 544 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.49% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.18% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 17.36% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 9.92% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.44% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.13% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.31% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.48% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.48% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.48% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.65% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.83% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.83% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001959 | Mangrove swamp microbial communities from Isabella Island, Equador - GS032 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022055 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300024188 | Seawater microbial communities from Monterey Bay, California, United States - 2D | Environmental | Open in IMG/M |
| 3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
| 3300024230 | Seawater microbial communities from Monterey Bay, California, United States - 48D | Environmental | Open in IMG/M |
| 3300024266 | Seawater microbial communities from Monterey Bay, California, United States - 75D | Environmental | Open in IMG/M |
| 3300024292 | Seawater microbial communities from Monterey Bay, California, United States - 37D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026471 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026491 | Seawater microbial communities from Monterey Bay, California, United States - 52D | Environmental | Open in IMG/M |
| 3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
| 3300027367 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300028111 | Seawater microbial communities from Monterey Bay, California, United States - 35D | Environmental | Open in IMG/M |
| 3300028126 | Seawater microbial communities from Monterey Bay, California, United States - 60D | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100268976 | 3300000101 | Marine | MNGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK* |
| DelMOSum2011_100310514 | 3300000115 | Marine | MKMNGGLQAHWQDEWILLKRKWSYWNKMHPKDQIDWNEYYDTNRK* |
| DelMOSpr2010_100209666 | 3300000116 | Marine | MKMNGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK* |
| DelMOSpr2010_100725431 | 3300000116 | Marine | MKMNGGLQAHWQDEWILLKRKWSYWNKMHPKDQIDWNEYYDANR |
| DelMOWin2010_100340694 | 3300000117 | Marine | MNGGLQAHWQDEWILLKRKWNSWNRMHPNEEVKWEDYYDANRK* |
| DelMOWin2010_100585295 | 3300000117 | Marine | MRMNGGLQAHWQDEWILLKRKWNSWNRMHPNEQVKWEDYYDANRK* |
| JGI24003J15210_101255803 | 3300001460 | Marine | MNGGLQAHWQDEYILLKRKWSYWNRMHPKDQIDWNEYYDEHRK* |
| JGI24005J15628_100740474 | 3300001589 | Marine | MNGGLQAHWQDEWILLKRKWSYWNRMHPKDQIDWNEYYDEHRK* |
| GOS2247_10126704 | 3300001959 | Marine | MNGGLQAQWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK* |
| JGI25127J35165_10073036 | 3300002482 | Marine | MRMNGGLQASWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK* |
| JGI25127J35165_10082153 | 3300002482 | Marine | MRLNGGLLASHWQDEWILLKRKWNMMHPHERGKWEDYYDANRK* |
| JGI25127J35165_10794031 | 3300002482 | Marine | MNGGLQASWQDEFILLKRKWNNLKLMHPNLKIEWEDYYNENRK* |
| JGI25127J35165_10863582 | 3300002482 | Marine | MRLNGGLQASWQDEWILLKRKWNNLKLMHPNXKIXWEDYYNENRK* |
| Ga0075474_100166064 | 3300006025 | Aqueous | MKMNGGLQASWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK* |
| Ga0075462_101558192 | 3300006027 | Aqueous | MKMNGGLQASWQDEWILLKRKWNSWNRMHPNEEVKWEDYYDANRK* |
| Ga0070744_100290552 | 3300006484 | Estuarine | MRMNGGLQAHWQDEYILLKRKWSYWNRMNPKDQIDWNEYYDEHRK* |
| Ga0070744_100780271 | 3300006484 | Estuarine | MRMNGGLQAHWQDEWILLKRKWSYWNRMHPKDQIDWNEYYDEHRK* |
| Ga0098038_10408272 | 3300006735 | Marine | MRLNGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK* |
| Ga0098038_11401533 | 3300006735 | Marine | MKMNGGLQASWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK* |
| Ga0098037_12439163 | 3300006737 | Marine | IKIKVMRLNGGLQAHWQDEWILLKRKWNMMQPDKRGKWEDYYDEHRK* |
| Ga0098037_12649131 | 3300006737 | Marine | MKMNGGLQAHWQDEWILLKRKWNMMQPDERSKWEDYYDANRK* |
| Ga0098042_10092486 | 3300006749 | Marine | MKMNGGLQAAWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK* |
| Ga0098042_10207173 | 3300006749 | Marine | MNGGLQAHWQDEWILLKRKWNMMQPDKRGKWEDYYDANRK* |
| Ga0098042_11502173 | 3300006749 | Marine | MKMNGGLQASWQDEFILLKRKWNNLKLMHPNLKIEWEDYYNENRK* |
| Ga0070749_100656465 | 3300006802 | Aqueous | MKMNGGLQASWQDEWILLKRKWNYINTHSPHLKIKWEDYYNENRK* |
| Ga0070754_103093142 | 3300006810 | Aqueous | MNGGLQAHWQDEWILLKRKWNSWNRMHPNEQVKWEDYYDANRK* |
| Ga0075476_102185551 | 3300006867 | Aqueous | MNGGLQAHWQDEWILLKRKWNMMHPDERGKWEDYYDTNRK* |
| Ga0075475_102524973 | 3300006874 | Aqueous | MNGGLQAHWQDEYILLKRKWSYWNRMNPKDQIDWNEYYDEHRK* |
| Ga0070750_101299844 | 3300006916 | Aqueous | MKMNGGLQASWQDEWILLQRKWNSWNRMHINDEVKWEDYYDANRK* |
| Ga0070746_102690263 | 3300006919 | Aqueous | MKLNGSLQAHWQTDMDEWILLKRKWNSWNTMHPNEQVSWNEYYRANRK* |
| Ga0075460_100821724 | 3300007234 | Aqueous | LKNLKNRDMKMNGGLQASWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK* |
| Ga0070745_11883761 | 3300007344 | Aqueous | LKNLKNRDMRMNGGLQAHWQDEWILLKRKWNSWNRMHPNEQVKWEDYYDANRK* |
| Ga0070752_13442162 | 3300007345 | Aqueous | MKLNGNLQAHWQTDMDEWILLKRKWNSWNMMHPNEQVSWNEYYRANRK* |
| Ga0070753_10380592 | 3300007346 | Aqueous | LKNLKNRDMKMNGGLQASWQDEWILLKRKWNYINTHSPHLKIKWEDYYNENRK* |
| Ga0070753_11487813 | 3300007346 | Aqueous | MKMNGGLQAHWQDEWILLKRKWNSWNRMHPNEEVKWEDYYDANRK* |
| Ga0102817_10458753 | 3300007555 | Estuarine | LKNLKNRDMRMNGGLQAHWQDEYILLKRKWSYWNRMNPKDQIDWNEYYDEHRK* |
| Ga0102855_11475253 | 3300007647 | Estuarine | MRMNGGLQAHWQDEYILLKRKLSYWNRMNPKYQIDWNEYYDEHRK* |
| Ga0102814_100280496 | 3300009079 | Estuarine | MKMNGGLQAQWQDEYILLKRKWSYWNRMHPKDQIDWNEYYDEHRK* |
| Ga0115545_12375962 | 3300009433 | Pelagic Marine | LKNLKNRDMTMNGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK* |
| Ga0115008_104704724 | 3300009436 | Marine | MKINGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK* |
| Ga0098043_11329973 | 3300010148 | Marine | LKNLKNRDMKMNGGLQAHWQDEWILLKRKWNSWNMMHPNEQVKWEDYYDANRK* |
| Ga0098043_11819393 | 3300010148 | Marine | MKMNGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDANRK* |
| Ga0129351_10312297 | 3300010300 | Freshwater To Marine Saline Gradient | MKMNGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDTNR |
| Ga0129351_13177791 | 3300010300 | Freshwater To Marine Saline Gradient | NRDMKMNGGLQAHWQDEWILLKRKWSYWNKMHPKDQIDWNEYYDTNRK* |
| Ga0160423_101926273 | 3300012920 | Surface Seawater | MKLNGSLQAHWQDEWILLKRKWNSWNMMHPKEQVSWEDYYKANKK* |
| Ga0163109_101569693 | 3300012936 | Surface Seawater | MRLNGGLQASWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK* |
| Ga0163179_108718032 | 3300012953 | Seawater | LKNLKNRDMKMNGGLQAHWQDEWILLRRKWNSWNRMHPNEEVKWEDYYDANRK* |
| Ga0180120_102841211 | 3300017697 | Freshwater To Marine Saline Gradient | MNGGLQAHWQDEWILLKRKWSYWNKMHPKDQIDWNEYYDEHRK |
| Ga0181377_10211181 | 3300017706 | Marine | NGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK |
| Ga0181369_11217992 | 3300017708 | Marine | MKMNGGLQAHWQDEFILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0181391_10964172 | 3300017713 | Seawater | MNGGLQAHWQDEWILLKRKWNNLKLMHPNLKIEWEDYYDENRK |
| Ga0181383_10667332 | 3300017720 | Seawater | MNGGLQAHWQDEWILLKRKWNMMRPDERGKWEDYYDTNRK |
| Ga0181383_10705773 | 3300017720 | Seawater | MNGGLQAHWQDEWILLRRKWSYWNRMNPKDQVDWNEYYDEHRK |
| Ga0181383_11919033 | 3300017720 | Seawater | MKMNGGLQAHWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0181388_10360473 | 3300017724 | Seawater | NNRDMRMNGGLQAHWQDEYILLKRKWSYWNRMNPKDQIDWNEYYDEHRK |
| Ga0181381_11256111 | 3300017726 | Seawater | MNGGLQAHWQDEWILLKRKWNSWNMMHPNEQVKWEDYYEANRK |
| Ga0187218_11335743 | 3300017737 | Seawater | MKMNGGLQAHWQDEWILLKRKWNNLKLMHPNLKIEWEDYYDENRK |
| Ga0181427_10159562 | 3300017745 | Seawater | MRINGGLLCHSDSEWLELRRKWSSWNTMHPKDQIDWNEYYDEHRK |
| Ga0181393_11403072 | 3300017748 | Seawater | MKLNGSLQAHWQDEWILLKRKWNSWNMMHPNEQVKWEDYYGANRK |
| Ga0181392_10907172 | 3300017749 | Seawater | MKLNGSLQSHWQDEWILLKRKWNSWNMMHPNEQVKWEDYYEANRK |
| Ga0181382_11432902 | 3300017756 | Seawater | MRMNGGLQAHWQDEWILLRRKWSYWNRMNPKDQVDWNEYYDEHRK |
| Ga0181410_11999101 | 3300017763 | Seawater | MKINGGLQAHWQDEYILLKRKWSYWNRMHPKDQIDWNEY |
| Ga0181413_11771234 | 3300017765 | Seawater | MRMDGGLQAHWQDVYILLIRKWSYWNRMNHKDQIDWNEYYDEHRK |
| Ga0181413_12633343 | 3300017765 | Seawater | MNGGLQSHWQDEWISLKRKRHNLKLMHPNLKIEWEDYYNENRK |
| Ga0187220_10611581 | 3300017768 | Seawater | MRMNGGLQAHWQDEWILLKRKWNNLKLMHPNLKIEWED |
| Ga0187221_12258962 | 3300017769 | Seawater | MRMNGGLQAHWQDEWILLKRKWNNLKLMHPNLKIEWEDYYDENRK |
| Ga0181423_12052232 | 3300017781 | Seawater | MRMNGGLQAHWQDEWILLRRKWSYWNRMNLKDQIDWNEYYDEHKK |
| Ga0181380_10612302 | 3300017782 | Seawater | MKMNGGLQARWQDEWILLKRKWNNLKLMHPNFKIEWEDYYNENRK |
| Ga0181560_103974303 | 3300018413 | Salt Marsh | MKMNGGLQASWQDEWILLKRKWNNLKSMHPNLKIKWEDYYNENRK |
| Ga0181553_100908832 | 3300018416 | Salt Marsh | MKMNGGLQASWQDEWILLKRKWNNLKSMHPNLKIEWEDYYNENRK |
| Ga0181558_103467113 | 3300018417 | Salt Marsh | MKMNGGLQAAWQDEWILLKRKWNNLKSMHPNLKIEWEDYYNENRK |
| Ga0206125_100264238 | 3300020165 | Seawater | MTMNGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK |
| Ga0181556_10820283 | 3300020176 | Salt Marsh | MKMNGGLQAAWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0211527_101824231 | 3300020378 | Marine | MRLNGGLQASWQDEWILLKRKWNMMHPDERGKWEDYYDANRK |
| Ga0211512_101069663 | 3300020419 | Marine | MNGGLQASWQDEWILLKRKWNYINTHSPHLKIKWEDYYNENRK |
| Ga0211521_102790571 | 3300020428 | Marine | MKMNGGLQASWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0211676_101137316 | 3300020463 | Marine | MNGGLQAHWQDEWILLKRKWNMLQPDERGKWEDYYDTNRK |
| Ga0211577_102112771 | 3300020469 | Marine | MNGGLQAHWQDEWILLKRKWNMMHPDERGKWEDYYDTNRK |
| Ga0213867_10414094 | 3300021335 | Seawater | MKMNGGLQASWQDEWILLKRKWNYINTHSPHLKIKWEDYYNENRK |
| Ga0213869_101809963 | 3300021375 | Seawater | MNGGLQAHWQDEWILLKRKWNSWNRMHPNEEVKWEDYYDANRK |
| Ga0213861_102153594 | 3300021378 | Seawater | LNNRDMKMNGGLQAHWQDEWILLKRKWNSWNRMHPNEEVKWEDYYDANRK |
| Ga0222717_100994025 | 3300021957 | Estuarine Water | MRMNGGLQAQWQDEYILLKRKWSSWNRMHPKDQIDWNEYYDEHRK |
| Ga0222717_106937892 | 3300021957 | Estuarine Water | MKMNGGLQAQWQDEYILLKRKWSYWNRMHPKDQIDWNEYYDEHRK |
| Ga0222715_105018324 | 3300021960 | Estuarine Water | LKNLKNRDMKMNGGLQAQWQDEYILLKRKWSYWNRMHPKDQIDWNEYYDEHRK |
| Ga0224898_1008392 | 3300022055 | Seawater | MKMNGGLQARWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0212021_10188774 | 3300022068 | Aqueous | MKMNGGLQAHWQDEWILLKRKWNSWNRMHPNEEVKWEDYYDANRK |
| Ga0212021_10665341 | 3300022068 | Aqueous | MKMNGGLQASWQDEWILLKRKWNYINTHSPHLKIKWEDY |
| Ga0212026_10355983 | 3300022069 | Aqueous | MRMNGGLQAHWQDEWILLKRKWNMMHPDERGKWEDYYDTNRK |
| Ga0212028_10524703 | 3300022071 | Aqueous | MKLNGSLQAHWQTDMDEWILLKRKWNSWNMMHPNEQVSWNEYYRANRK |
| Ga0224906_10043146 | 3300022074 | Seawater | MRINGGLLCHSDSEWLELRRKWSSWNTMHPLDQVDWNEYYDEHRK |
| Ga0224906_10110632 | 3300022074 | Seawater | MNGGLQAHWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0228602_10681543 | 3300024188 | Seawater | MKMNGGLQAHWQDEWILLKRKWNMMHPDERGKWEDYYDTNRK |
| Ga0228633_10702653 | 3300024228 | Seawater | MRINGGLQAHWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0228638_11566002 | 3300024230 | Seawater | MKMNGGLQAHWQDEYILLKRKWSYWNRMHPKDQIDWNEYYDEHRK |
| Ga0228661_10078851 | 3300024266 | Seawater | INGGLQAHWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0228630_10975993 | 3300024292 | Seawater | MNGGLQAHWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNEN |
| Ga0244775_100650264 | 3300024346 | Estuarine | MRMNGGLQAHWQDEWILLKRKWSYWNRMHPKDQIDWNEYYDEHRK |
| Ga0208157_10357223 | 3300025086 | Marine | MKMNGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK |
| Ga0208159_10101323 | 3300025101 | Marine | MNGGLQAHWQDEWILLKRKWNMMQPDKRGKWEDYYDANRK |
| Ga0208666_10793254 | 3300025102 | Marine | MRLNGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK |
| Ga0209535_10498453 | 3300025120 | Marine | MRMNGGLQAHWQDEYILLKRKWSYWNRMNPKDQIDWNEYYDEHRK |
| Ga0209348_100943412 | 3300025127 | Marine | MRMNGGLQASWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0209348_10099177 | 3300025127 | Marine | MRLNGGLLASHWQDEWILLKRKWNMMHPHERGKWEDYYDANRK |
| Ga0209348_10395893 | 3300025127 | Marine | MNGGLQASWQDEFILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0209348_10949714 | 3300025127 | Marine | MRLNGGLQASWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0208303_10969221 | 3300025543 | Aqueous | MNGGLQAHWQDEWILLKRKWNSWNRMHPNEEVKWE |
| Ga0208149_10191655 | 3300025610 | Aqueous | MKMNGGLQASWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK |
| Ga0208150_12492333 | 3300025751 | Aqueous | GGLQAHWQDEWILLKRKWNSWNRMHPNEQVKWEDYYDANRK |
| Ga0208545_10332122 | 3300025806 | Aqueous | MNGGLQAHWQDEWILLKRKWNMMQPDERGKWEDYYDTNRK |
| Ga0247602_10543821 | 3300026471 | Seawater | MKLNGSLQAHWQDEWILLKRKWNSWNMMHPNEQVKWEDYYEANRK |
| Ga0228641_10088691 | 3300026491 | Seawater | MRMNGGLQAHWQDEWILLKRKWSYWNRMNPKDQIDWNEYYDEHRK |
| Ga0208797_10271562 | 3300027186 | Estuarine | MNGGLQAHWQDEYILLKRKWSYWNRMNPKDQIDWNEYYDEHRK |
| Ga0208801_10651282 | 3300027367 | Estuarine | MNGGLQAHWQDEWILLKRKWSYWNRMHPKDQIDWNEYYDEHRK |
| Ga0233397_10312114 | 3300028111 | Seawater | MRINGGLQAHWQDEWILLKRKWNMMHPDERGKWEDYYDTNRK |
| Ga0228648_10401812 | 3300028126 | Seawater | MRMNGGLQAHWQDEWILLKRKWNNLKLMHPNLKIEWEDYYNENRK |
| Ga0183755_10125601 | 3300029448 | Marine | MRLNGGLLVHLQDEWILLKRKWNSWNMMHPNEQVKWEDYYEANRK |
| Ga0183755_10249801 | 3300029448 | Marine | GGLQAHWQDEWILLKRKWNSWNRMHPNEEVKWEDYYDANRK |
| Ga0183755_11053551 | 3300029448 | Marine | MNINGGLQAHWQDEWILLRRKWSYWNKLHPKDQIDWEDYYDEHRK |
| Ga0183757_10166264 | 3300029787 | Marine | MTMNGGLQAHWQDEWILLRRKWSYWNKLHPKDQIDWEDYYDEHRK |
| Ga0315330_100480481 | 3300032047 | Seawater | RDMRMNGGLQAHWQDEWILLKRKWNNLKLMHPNLKIEWEDYYDENRK |
| Ga0348337_183356_2_124 | 3300034418 | Aqueous | MKLNGNLQAHWQTDMDEWILLKRKWNSWNMMHPNEQVSWNE |
| ⦗Top⦘ |