NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072323

Metagenome / Metatranscriptome Family F072323

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072323
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 101 residues
Representative Sequence MVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGKKGECYVCY
Number of Associated Samples 106
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 2.48 %
% of genes near scaffold ends (potentially truncated) 12.40 %
% of genes from short scaffolds (< 2000 bps) 87.60 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (41.322 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(21.488 % of family members)
Environment Ontology (ENVO) Unclassified
(66.116 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(77.686 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 11.76%    β-sheet: 41.18%    Coil/Unstructured: 47.06%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF14743DNA_ligase_OB_2 0.83
PF04542Sigma70_r2 0.83
PF01068DNA_ligase_A_M 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.83
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.83
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.83
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.83
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.83
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.73 %
UnclassifiedrootN/A27.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000928|OpTDRAFT_10148298All Organisms → Viruses → Predicted Viral1396Open in IMG/M
3300000929|NpDRAFT_10108180All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon998Open in IMG/M
3300001450|JGI24006J15134_10076380All Organisms → Viruses → Predicted Viral1267Open in IMG/M
3300001460|JGI24003J15210_10027886All Organisms → Viruses → Predicted Viral2081Open in IMG/M
3300001460|JGI24003J15210_10112324All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon758Open in IMG/M
3300001685|JGI24024J18818_10014329All Organisms → Viruses → Predicted Viral3238Open in IMG/M
3300001963|GOS2229_1036403All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon825Open in IMG/M
3300003580|JGI26260J51721_1027384All Organisms → Viruses → Predicted Viral1066Open in IMG/M
3300005820|Ga0078747_103950All Organisms → Viruses → Predicted Viral4177Open in IMG/M
3300005821|Ga0078746_1057143All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon853Open in IMG/M
3300005821|Ga0078746_1059944All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon835Open in IMG/M
3300006029|Ga0075466_1024790All Organisms → Viruses → Predicted Viral1912Open in IMG/M
3300006484|Ga0070744_10147787All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon674Open in IMG/M
3300006920|Ga0070748_1069112All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1377Open in IMG/M
3300007539|Ga0099849_1315293All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon562Open in IMG/M
3300007542|Ga0099846_1175151All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon765Open in IMG/M
3300007543|Ga0102853_1061739All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon667Open in IMG/M
3300007555|Ga0102817_1066897Not Available785Open in IMG/M
3300007647|Ga0102855_1124214All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon691Open in IMG/M
3300007708|Ga0102859_1127946All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon739Open in IMG/M
3300007718|Ga0102852_1001351All Organisms → Viruses → Predicted Viral4119Open in IMG/M
3300007756|Ga0105664_1063679Not Available525Open in IMG/M
3300007758|Ga0105668_1140817All Organisms → Viruses → Predicted Viral1530Open in IMG/M
3300007871|Ga0111032_1032260All Organisms → Viruses → Predicted Viral1502Open in IMG/M
3300007900|Ga0111031_1052460All Organisms → Viruses → Predicted Viral1135Open in IMG/M
3300008517|Ga0111034_1083516All Organisms → Viruses → Predicted Viral1606Open in IMG/M
3300008999|Ga0102816_1077541All Organisms → Viruses → Predicted Viral1004Open in IMG/M
3300009002|Ga0102810_1068756All Organisms → Viruses → Predicted Viral1120Open in IMG/M
3300009058|Ga0102854_1253225Not Available506Open in IMG/M
3300009071|Ga0115566_10513516All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon678Open in IMG/M
3300009071|Ga0115566_10774045All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon529Open in IMG/M
3300009076|Ga0115550_1092475All Organisms → Viruses → Predicted Viral1132Open in IMG/M
3300009077|Ga0115552_1434927Not Available516Open in IMG/M
3300009135|Ga0118736_10073220Not Available900Open in IMG/M
3300009136|Ga0118735_10044376All Organisms → Viruses → Predicted Viral1363Open in IMG/M
3300009193|Ga0115551_1305319All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon695Open in IMG/M
3300009423|Ga0115548_1091735All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1002Open in IMG/M
3300009425|Ga0114997_10566729Not Available600Open in IMG/M
3300009425|Ga0114997_10709585Not Available526Open in IMG/M
3300009428|Ga0114915_1018754Not Available2508Open in IMG/M
3300009428|Ga0114915_1067104All Organisms → Viruses → Predicted Viral1119Open in IMG/M
3300009433|Ga0115545_1179129All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon729Open in IMG/M
3300009443|Ga0115557_1260840All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon661Open in IMG/M
3300009447|Ga0115560_1280176All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon636Open in IMG/M
3300009449|Ga0115558_1372564Not Available560Open in IMG/M
3300009472|Ga0115554_1249732All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon709Open in IMG/M
3300009476|Ga0115555_1306347All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon639Open in IMG/M
3300009512|Ga0115003_10281471All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium987Open in IMG/M
3300009512|Ga0115003_10539167Not Available682Open in IMG/M
3300009786|Ga0114999_10454771All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon996Open in IMG/M
3300010392|Ga0118731_106842529All Organisms → Viruses → Predicted Viral2214Open in IMG/M
3300010392|Ga0118731_113128175All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon971Open in IMG/M
3300010430|Ga0118733_100455835All Organisms → Viruses → Predicted Viral2537Open in IMG/M
3300011118|Ga0114922_10836417Not Available751Open in IMG/M
3300011126|Ga0151654_1034518All Organisms → Viruses → Predicted Viral3111Open in IMG/M
3300011128|Ga0151669_106118All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon936Open in IMG/M
3300011247|Ga0151657_1008179All Organisms → Viruses → Predicted Viral2280Open in IMG/M
3300011261|Ga0151661_1009537All Organisms → Viruses → Predicted Viral1905Open in IMG/M
3300014903|Ga0164321_10785748All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon503Open in IMG/M
3300017710|Ga0181403_1017529Not Available1526Open in IMG/M
3300017713|Ga0181391_1017147All Organisms → cellular organisms → Bacteria1823Open in IMG/M
3300017713|Ga0181391_1134014Not Available552Open in IMG/M
3300017717|Ga0181404_1177655Not Available510Open in IMG/M
3300017724|Ga0181388_1116030All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon637Open in IMG/M
3300017725|Ga0181398_1118887Not Available630Open in IMG/M
3300017727|Ga0181401_1103518Not Available722Open in IMG/M
3300017727|Ga0181401_1104550All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon718Open in IMG/M
3300017731|Ga0181416_1164839Not Available535Open in IMG/M
3300017741|Ga0181421_1183003Not Available538Open in IMG/M
3300017742|Ga0181399_1074957All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon856Open in IMG/M
3300017748|Ga0181393_1056329All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1064Open in IMG/M
3300017748|Ga0181393_1112176Not Available696Open in IMG/M
3300017749|Ga0181392_1192787All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon588Open in IMG/M
3300017753|Ga0181407_1095259All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon752Open in IMG/M
3300017755|Ga0181411_1039700All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1472Open in IMG/M
3300017762|Ga0181422_1127899Not Available785Open in IMG/M
3300017763|Ga0181410_1092737All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon881Open in IMG/M
3300017765|Ga0181413_1107110All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon850Open in IMG/M
3300017770|Ga0187217_1165987All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon736Open in IMG/M
3300017773|Ga0181386_1270650All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon500Open in IMG/M
3300017776|Ga0181394_1057333All Organisms → Viruses → Predicted Viral1298Open in IMG/M
3300017776|Ga0181394_1232769All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon554Open in IMG/M
3300017781|Ga0181423_1216288Not Available722Open in IMG/M
3300017782|Ga0181380_1293176All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon533Open in IMG/M
3300020165|Ga0206125_10114755All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1121Open in IMG/M
3300020438|Ga0211576_10093793All Organisms → Viruses → Predicted Viral1664Open in IMG/M
3300021371|Ga0213863_10002117Not Available14215Open in IMG/M
3300021375|Ga0213869_10174170All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon987Open in IMG/M
3300021958|Ga0222718_10235754All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon979Open in IMG/M
(restricted) 3300022938|Ga0233409_10042200All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1306Open in IMG/M
(restricted) 3300024052|Ga0255050_10099110All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon670Open in IMG/M
3300024262|Ga0210003_1091298All Organisms → Viruses → Predicted Viral1407Open in IMG/M
3300024262|Ga0210003_1275766All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon654Open in IMG/M
(restricted) 3300024324|Ga0233443_1308824Not Available522Open in IMG/M
(restricted) 3300024338|Ga0255043_10064306All Organisms → Viruses → Predicted Viral1151Open in IMG/M
3300024343|Ga0244777_10042833All Organisms → Viruses → Predicted Viral2889Open in IMG/M
3300024346|Ga0244775_10794716Not Available757Open in IMG/M
3300024346|Ga0244775_11051643All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon640Open in IMG/M
(restricted) 3300024518|Ga0255048_10009990All Organisms → cellular organisms → Bacteria5044Open in IMG/M
3300025120|Ga0209535_1005116All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium8083Open in IMG/M
3300025120|Ga0209535_1077085All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1282Open in IMG/M
3300025138|Ga0209634_1236260Not Available671Open in IMG/M
3300025276|Ga0208814_1028236All Organisms → Viruses → Predicted Viral1800Open in IMG/M
3300025276|Ga0208814_1122546All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon621Open in IMG/M
3300025594|Ga0209094_1122925Not Available569Open in IMG/M
3300025652|Ga0208134_1001078Not Available16509Open in IMG/M
3300025694|Ga0209406_1179614All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon649Open in IMG/M
3300025816|Ga0209193_1058847All Organisms → Viruses → Predicted Viral1043Open in IMG/M
3300025869|Ga0209308_10261904Not Available737Open in IMG/M
3300025890|Ga0209631_10113212All Organisms → Viruses → Predicted Viral1535Open in IMG/M
3300027195|Ga0208676_1005324All Organisms → Viruses → Predicted Viral1190Open in IMG/M
3300027206|Ga0208023_1003796All Organisms → Viruses → Predicted Viral2794Open in IMG/M
3300027631|Ga0208133_1131271Not Available580Open in IMG/M
3300027779|Ga0209709_10356932Not Available597Open in IMG/M
3300027820|Ga0209578_10404934Not Available622Open in IMG/M
3300027847|Ga0209402_10321102All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon959Open in IMG/M
(restricted) 3300027856|Ga0255054_10515414Not Available579Open in IMG/M
3300027858|Ga0209013_10519813Not Available637Open in IMG/M
(restricted) 3300027881|Ga0255055_10096506All Organisms → Viruses → Predicted Viral1632Open in IMG/M
3300028125|Ga0256368_1083108All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon543Open in IMG/M
3300028600|Ga0265303_10425688All Organisms → Viruses → Predicted Viral1058Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater21.49%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine13.22%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.74%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine9.09%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment6.61%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.96%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.13%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean3.31%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.31%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface2.48%
Background SeawaterEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater1.65%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.65%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.65%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.65%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.65%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.65%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine1.65%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine1.65%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.83%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.83%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.83%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.83%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.83%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.83%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.83%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.83%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001685Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2EnvironmentalOpen in IMG/M
3300001963Marine microbial communities from Nags Head, North Carolina, USA - GS013EnvironmentalOpen in IMG/M
3300003580Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNAEnvironmentalOpen in IMG/M
3300005820Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, PM2EnvironmentalOpen in IMG/M
3300005821Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007647Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007756Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007758Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007871Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf. Combined Assembly of MM2PM2EnvironmentalOpen in IMG/M
3300007900Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf. Combined Assembly of MM1PM1EnvironmentalOpen in IMG/M
3300008517Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009135Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsfEnvironmentalOpen in IMG/M
3300009136Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsfEnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011126Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300011128Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02EnvironmentalOpen in IMG/M
3300011247Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_3, 0.02EnvironmentalOpen in IMG/M
3300011261Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02EnvironmentalOpen in IMG/M
3300014903Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cmEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300024052 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024324 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MGEnvironmentalOpen in IMG/M
3300024338 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025594Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300027195Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027206Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027858Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes)EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
OpTDRAFT_1014829823300000928Freshwater And MarineMNLSMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNELICDGTNHEGGDGVNGECYVCY*
NpDRAFT_1010818013300000929Freshwater And MarineMNLSMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNELTCDGTNHEGGDGVNGECYVCY*
JGI24006J15134_1007638043300001450MarineMVTSLTIALAISLTGQVDDKVCYKKCTGHTKDVIKKARVDKLTVRTGNTVADYVEAGYDEDVYEWICQGEAQGFKHSITNKLTCDGTNHEEWEKYGKIGECYVCY*
JGI24003J15210_1002788683300001460MarineMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGANHEEWEKYGKKGECYVCY*
JGI24003J15210_1011232423300001460MarineMVTNLTIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNELICDGTNHEGGDGVNGECYVCY*
JGI24024J18818_1001432973300001685MarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEADYDEDVYEWICQGEAQGFKHSVTNTITCDGTNHEEWEKYGKIGECYVCY*
GOS2229_103640313300001963MarineVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVMCDGTNHEEWEK
JGI26260J51721_102738423300003580MarineMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNELTCDGTNHEGGDGVNGECYVCY*
Ga0078747_10395063300005820Marine SedimentMITNITIALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVMCDGTNHEEWQKYGKMGECYVCY*
Ga0078746_105714323300005821Marine SedimentMVTNLTIALAISLTGQVDDKVCYKKCTGHTDDVIKKARVDKLTVRTGNTVADYVEAKYDEDVYEWVCQGEAEGFKHSITNKLTCDGTNHEEWEKYGNKGECYVCF*
Ga0078746_105994423300005821Marine SedimentMNLSMVTNLAIALAISLTGQVEDDKVCYKKCTGHTKDVIKVTGYAGTKYDTVQDYVDAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY*
Ga0075466_102479033300006029AqueousVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVTCDGTNHEEWEKYGNKGECYVCY*
Ga0070744_1014778723300006484EstuarineMVTNLTIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGNKGECYVCY*
Ga0070748_106911243300006920AqueousVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVMCDGTNHEEWEKYGNKGECYVCY*
Ga0099849_131529323300007539AqueousVSSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVTCDGTNHEEWEKYGNKGECYVCY*
Ga0099846_117515113300007542AqueousVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVTCDGTNHEEWEKY
Ga0102853_106173923300007543EstuarineMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKVTGYPGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGNKGECYVCY*
Ga0102817_106689723300007555EstuarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGSNHEDWEKYGKTGECYVCY*
Ga0102855_112421423300007647EstuarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIKVTGYPGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGNKGECYVCY*
Ga0102859_112794643300007708EstuarineMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTN
Ga0102852_1001351103300007718EstuarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIRITGNAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGCNHEDWEKYGKTGECYVCY*
Ga0105664_106367923300007756Background SeawaterMVTNLTIALAISLTGTGDDKVCYKKCTGHTKDVIKVTGYPGTKYDTVQDYVEAGYGEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGKKGECYVCY*
Ga0105668_114081743300007758Background SeawaterMVTNLTIALAISLTGTGDDKVCYKKCTGHTKDVIKVTGYPGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGNKGECYVCY*
Ga0111032_103226023300007871Marine SedimentMITNITIALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYAEDVYEWVCQGEAQGFKHRVTNKITCDGTNHEEWEKHGKLGECYVCY*
Ga0111031_105246043300007900Marine SedimentMVTNLAIALAISLTGQVEDDKVCYKKCTGHTKDVIKVTGYAGTKYDTVQDYVDAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY*
Ga0111034_108351623300008517Marine SedimentMITNLTIALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYAEDVYEWVCQGEAQGFKHRVTNKITCDGTNHEEWEKHGKLGECYVCY*
Ga0102816_107754123300008999EstuarineMVTSLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGSNHEDWEKYGKTGECYVCY*
Ga0102810_106875643300009002EstuarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIRITGNAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGSNHEDWEKYGKTGECYVCY*
Ga0102854_125322523300009058EstuarineMVTNLTIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGNKGECYVCY*
Ga0115566_1051351623300009071Pelagic MarineVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIKVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVMCDGSNHEEWQKHGKLGECYVCY*
Ga0115566_1077404523300009071Pelagic MarineMVTNLTIALAISLTGQVEDNKVCYKKCTGHTKDVIRITGYAETKYDTVQDYVDAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY*
Ga0115550_109247523300009076Pelagic MarineVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIRITGYAETKYDTVQDYVDAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY*
Ga0115552_143492723300009077Pelagic MarineMVTNLAIALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY*
Ga0118736_1007322033300009135Marine SedimentMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDKSKLNTVQDYVNANYDEDVYEWICQGEAQGFKHSITNKLTCDGTNHEEWEKYGKMGECYVCY*
Ga0118735_1004437613300009136Marine SedimentGDDKVCYKKCTGHTKDVIKKTKIDKSKLNTVQDYVNANYDEDVYEWICQGEAQGFKHSITNKLTCDGTNHEEWEKYGKMGECYVCY*
Ga0115551_130531923300009193Pelagic MarineVNSLVVALAISLTGQVKDDKVCYKKCTGHTKDVIKVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY*
Ga0115548_109173533300009423Pelagic MarineMVTNLTIALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAETKYDTVQDYVDAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY*
Ga0114997_1056672913300009425MarineMIALAISLTGQVDDKVCYKKCTGHTDDVIKKARVDKLTVRTGNTVADYVEAKYDEDVYEWVCQGEAEGFKHSITNKLTCDGTNHEDWETEGKYGECYVCY*
Ga0114997_1070958523300009425MarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTNDVIKKARVDKLTVRTGNTVADYVEAGYDEDVYEWICQGEAEGFKHSITNKLTCDGTNHEDWETEGKYGECYVCY*
Ga0114915_101875433300009428Deep OceanMSSILLAVAISLTGTGDDKVCYKECTGHTKDVIRVTGYAGTKYDTVQDYVNAGYDEDVYEWVCQGEAEGFKHSVTNKVVCDGTNHEDWQKHGKLGECYVCY*
Ga0114915_106710433300009428Deep OceanMVTSLTIALAISLTGQVDDKVCYKSCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAEGFKHSVTNKVMCDGTNHEEWQKYGKMGECYVCY*
Ga0115545_117912933300009433Pelagic MarineVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIKVTGYAGTKYNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVMCDGSNHEEWQKHGKLGECYVCY*
Ga0115557_126084023300009443Pelagic MarineVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY*
Ga0115560_128017613300009447Pelagic MarineVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIKVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVMCDGSNHEEWQKH
Ga0115558_137256423300009449Pelagic MarineVNSLVVAIAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY*
Ga0115554_124973233300009472Pelagic MarineVNSLVVALAISLTGQVEDDKVCYKKCTGHSKDVIRVTGYAGTKYDTVQDYVDAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY*
Ga0115555_130634723300009476Pelagic MarineVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIKVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY*
Ga0115003_1028147143300009512MarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTNDVIKKARVDKLTVRTGNTVADYVEAGYDEDVYEWICQGEAEGFKHSITNKLICDGTNHEDWETEGKYGECYVCY*
Ga0115003_1053916713300009512MarineMIALAISLTGQVDDKVCYKKCTGHTDDVIKKARVDKLTVRTGNTVADYVEAGYDEDVYEWVCQGEAEGFKHSITNKLTCDGTNHEDWKKYGKMGECYVCY*
Ga0114999_1045477133300009786MarineMIALAISLTGQVDDKVCYKKCTGHTDDVIKKARVDKLTVRTGNTVADYVEAGYDEDVYEWVCQGEAEGFKHSITNKLTCDGTNHEDWEKYGKMGECYVCY*
Ga0118731_10684252933300010392MarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIRVTGHAGTKYDTVQDYVEAGYDEDVYEWVCQSEAQGFKHSITNKLTCDGTNHEDWETEGKYGECYVCY*
Ga0118731_11312817523300010392MarineMVTNLTIALAISLTGQIEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVMCDGTNHEEWEKYGNKGECYVCY*
Ga0118733_10045583543300010430Marine SedimentMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIRVTGHAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSITNKLTCDGTNHEDWETEGKYGECYVCY*
Ga0114922_1083641713300011118Deep SubsurfaceMVTNLTIALAISLTGQVDDKVCYKKCTGHTDDVIKKARVDKLTVRTGNTVADYVEAKYDEDVYEWVCQGEAEGFKHSITNKLTCDGTNHEEWEKHRKKGERYVCF*
Ga0151654_103451843300011126MarineMVTSLTIALAISLTGQVDDKVCYKKCTGHNKDVIKKTKIDNSKLNTVKDYVNANYDEDVYEWVCQGEAEGFKHTITNELICDGTNHEEWEKYGKKGECYVCY*
Ga0151669_10611833300011128MarineMVTSLTIALAISLTGQVDDKVCYKKCTGHNKDVIKKTKIDNSKLNTVKDYVNANYDEDVYEWVCQGEAEGFKHTITNELICDGTNHEGGDGVNGECYVCY*
Ga0151657_100817943300011247MarineMVTSLTIALAISLTGQVDDKVCYKKCTSHNDDVIHLDVKYNSNLNTVKDYVNANYDEDVYEWVCQGEDEGFKHTITNKLTCDGTNHEEWEKYGNKGECYVCY*
Ga0151661_100953723300011261MarineMVTSLTIALAISLTGIGDDKVCYKKCTCHTDDVIKKTKIDNCQLNTVKDYVNANYDEDVYEWVCQGEAEGFKHTITNELICDGTNHEEWEKYGNKGECYVCY*
Ga0164321_1078574813300014903Marine SedimentMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGKMGECYVCY*
Ga0181403_101752933300017710SeawaterVNSLVIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKKGECYVCY
Ga0181391_101714733300017713SeawaterMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEADYDEDVYEWICQGEAQGFKHSVTNTITCDGTNHEEWEKYGKIGECYVCY
Ga0181391_113401413300017713SeawaterMNLLMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKVTGYPGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKKGECYVCY
Ga0181404_117765523300017717SeawaterMNLSMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKKGECYVCY
Ga0181388_111603023300017724SeawaterMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGGAQGFKHSVTNKITCDGTNHEDWEKYGKMGECYVCY
Ga0181398_111888713300017725SeawaterMVNNIAIALAISLTGQVEDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWKKHGKKGECYVCY
Ga0181401_110351833300017727SeawaterMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTFQDYVEADYDEDVYEWICQGEAQGFKHSVTNTITCDGTNHEEWEKYGKIGECYVCY
Ga0181401_110455023300017727SeawaterMNLLMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWKKHGKKGECYVCY
Ga0181416_116483923300017731SeawaterMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKMGECYVCY
Ga0181421_118300313300017741SeawaterMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTIQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKKGECYVCY
Ga0181399_107495733300017742SeawaterVNSLVIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGKMGECYVCY
Ga0181393_105632933300017748SeawaterMNLLMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGNKGECYVCF
Ga0181393_111217633300017748SeawaterSLTGAGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCKGEAQGFKHSVTNKITCNGTNHEEWEKYGKMGECYVCY
Ga0181392_119278723300017749SeawaterVNSLVIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGKIGECYVCY
Ga0181407_109525933300017753SeawaterVNSLVIALAISLTGTGDDKVCYKKCTGHTKDVIKVTGYPGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKKGECYVCY
Ga0181411_103970023300017755SeawaterMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKKGECYVCY
Ga0181422_112789913300017762SeawaterNNIAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKKGECYVCY
Ga0181410_109273733300017763SeawaterMVTNLTIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKKGECYVCY
Ga0181413_110711033300017765SeawaterMVTNLAIALAISSTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGKMGECYVCY
Ga0187217_116598733300017770SeawaterMNLLMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKMGECYVCY
Ga0181386_127065013300017773SeawaterMNLLMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGT
Ga0181394_105733313300017776SeawaterVNSLVIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGNKGECYVCF
Ga0181394_123276923300017776SeawaterMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWICQGEAQGFKHSVTNTITCDGTNHEEWKKYGKMGECYVCY
Ga0181423_121628813300017781SeawaterKKTMNLLMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITRYAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKKGECYVCY
Ga0181380_129317613300017782SeawaterMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIRITGYAGTRYDTVQDYVEAGYDEDVYEWVCQSEAQGFKHSVTNKITCDGNNHEDWEKYGKK
Ga0206125_1011475533300020165SeawaterMVTNLTIALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY
Ga0211576_1009379333300020438MarineMNLLMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEDWEKYGKKGECYVCY
Ga0213863_10002117183300021371SeawaterVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVTCDGTNHEEWEKYGNKGECYVCY
Ga0213869_1017417033300021375SeawaterVNSLVVALAISLTGQIEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVMCDGTNHEEWEKYGNKGECYVCY
Ga0222718_1023575423300021958Estuarine WaterMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQGYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGNKGECYVCY
(restricted) Ga0233409_1004220033300022938SeawaterMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNELTCDGTNHEGGDGVNGECYVCY
(restricted) Ga0255050_1009911033300024052SeawaterMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNELICDGTNHEGGDGVNGECYVCY
Ga0210003_109129853300024262Deep SubsurfaceMIAVAISLTGQVDDKVCYKKCTGHTNDVIKKARVDKLTVRTGNTVADYVEAKYDEDVYEWVCQGEAEGFKHSITNKLTCDGTNHEDWETEGKYGECNVCY
Ga0210003_127576623300024262Deep SubsurfaceMIALAISLTGQVDDKVCYKKCTGHTDDVIKKARVDKLTVRTGNTVADYVEAKYDEDVYEWVCQGEAEGFKHSITNKLTCDGTNHEDWETEGKYGECYVCY
(restricted) Ga0233443_130882423300024324SeawaterNIAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNELTCDGTNHEGGDGVNGECYVCY
(restricted) Ga0255043_1006430633300024338SeawaterMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGKIGECYVCY
Ga0244777_1004283393300024343EstuarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIRITGNAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGSNHEDWEKYGKTGECYVCY
Ga0244775_1079471633300024346EstuarineMVNLYMVTNLTIALAISLTGTGDDKVCYKKCTGHTKDVIKVTGYPGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGNKGECYVCY
Ga0244775_1105164333300024346EstuarineMNLLMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGKKGECYVCY
(restricted) Ga0255048_1000999033300024518SeawaterMVTNLAIALAISLTGTGDDKVCYKKCTGHIKDVIKKTKIDNSKLNTVQDYVEASYDEDVYEWVCQGEAQGFKHSVTNELICDGTNHEGGYGVNGECYVCY
Ga0209535_100511613300025120MarineMVTNLTIALAISLTGTGDDKVCYKKCTGHTKDVIKVTGYPGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWE
Ga0209535_107708533300025120MarineMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGKKGECYVCY
Ga0209634_123626023300025138MarineMVTSLTIALAISLTGQVDDKVCYKKCTGHTKDVIKKARVDKLTVRTGNTVADYVEAGYDEDVYEWICQGEAQGFKHSITNKLTCDGTNHEEWEKYGKIGECYVCY
Ga0208814_102823633300025276Deep OceanMSSILLAVAISLTGTGDDKVCYKECTGHTKDVIKVTGYAGTKYDTVQDYVNAGYDEDVYEWVCQGEAEGFKHSVTNKVVCDGTNHEDWQKHGKLGECYVCY
Ga0208814_112254623300025276Deep OceanMVTSLTIALAISLTGQVDDKVCYKSCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAEGFKHSVTNKVMCDGTNHEEWQKYGKMGECYVCY
Ga0209094_112292513300025594Pelagic MarineMVTNLTIALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAETKYDTVQDYVDAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY
Ga0208134_1001078133300025652AqueousVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVMCDGTNHEEWEKYGNKGECYVCY
Ga0209406_117961423300025694Pelagic MarineVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIRVTGYAETKYDTVQDYVDAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY
Ga0209193_105884733300025816Pelagic MarineVNSLVVALAISLTGQVEDDKVCYKKCTGHTKDVIKVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKVMCDGSNHEEWQKHGKLGECYVCY
Ga0209308_1026190413300025869Pelagic MarineMVTNLTIALAISLTGQVEDNKVCYKKCTGHTKDVIRITGYAETKYDTVQDYVDAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY
Ga0209631_1011321233300025890Pelagic MarineMVTNLTIALAISLTGQVEDDKVCYKKCTGHTKDVIKVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY
Ga0208676_100532453300027195EstuarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIRITGNAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGNKGECY
Ga0208023_100379673300027206EstuarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGSNHEDWEKYGKTGECYVCY
Ga0208133_113127123300027631EstuarineMVNLYMVTNLTIALAISLTGTGDDKVCYKKCTGHTKDVIRITGHAGTRYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGKKGECYVCY
Ga0209709_1035693223300027779MarineMVTSLTIALAISLTGTGDDKVCYKKCTGHTNDVIKKARVDKLTVRTGNTVADYVEAGYDEDVYEWICQGEAEGFKHSITNKLTCDGTNHEDWETEGKYGECYVCY
Ga0209578_1040493423300027820Marine SedimentMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIRVTGHAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSITNKLTCDGTNHEDWETEGKYGECYVCY
Ga0209402_1032110233300027847MarineMIALAISLTGQVDDKVCYKKCTGHTDDVIKKARVDKLTVRTGNTVADYVEAGYDEDVYEWVCQGEAEGFKHSITNKLTCDGTNHEDWEKYGKMGECYVCY
(restricted) Ga0255054_1051541413300027856SeawaterMVTSLTIALAISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGNKGECYVCY
Ga0209013_1051981333300027858MarineISLTGTGDDKVCYKKCTGHTKDVIKKTKIDNSKLNTVQDYVEADYDEDVYEWICQGEAQGFKHSVTNTITCDGTNHEEWEKYGKIGECYVCY
(restricted) Ga0255055_1009650623300027881SeawaterMVTNLAIALAISLTGTGDDKVCYKKCTGHTKDVIKRTKIDNSKLNTVQDYVEAGYDEDVYEWVCQGEAQGFKHSVTNKITCDGTNHEEWEKYGKIGECYVCY
Ga0256368_108310823300028125Sea-Ice BrineMIALAISLTGQVDDKVCYKKCTGHTDDVIKKARVDKLTVRTGNTVADYVEAGYDEDVYEWVCQGEAEGFKHSITNKLTCDGTNHEDWKKYGKMGECYVCY
Ga0265303_1042568843300028600SedimentMVTNLAIALAISLTGQVEDDKVCYKKCTGHSKDVIRVTGYAGTKYDTVQDYVEAGYDEDVYEWVCQGEAQGFKHSITNKITCDGTNHEEWQKHGKLGECYVCY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.