NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072294

Metagenome / Metatranscriptome Family F072294

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072294
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 62 residues
Representative Sequence MPDLHCPECGKERFERSLTMKVKDGETYYVEGQCECGAQMKLTNPKTGVANLGRMTSHGQSY
Number of Associated Samples 83
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.48 %
% of genes near scaffold ends (potentially truncated) 28.10 %
% of genes from short scaffolds (< 2000 bps) 66.12 %
Associated GOLD sequencing projects 65
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (47.107 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(48.760 % of family members)
Environment Ontology (ENVO) Unclassified
(71.901 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.603 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 18.89%    Coil/Unstructured: 81.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF08291Peptidase_M15_3 4.13
PF00535Glycos_transf_2 3.31
PF01391Collagen 2.48
PF01041DegT_DnrJ_EryC1 2.48
PF00534Glycos_transf_1 1.65
PF13524Glyco_trans_1_2 1.65
PF00754F5_F8_type_C 0.83
PF13391HNH_2 0.83
PF09206ArabFuran-catal 0.83
PF00069Pkinase 0.83
PF14602Hexapep_2 0.83
PF13712Glyco_tranf_2_5 0.83
PF01510Amidase_2 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.31
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 2.48
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 2.48
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 2.48
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 2.48
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 2.48
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 2.48


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.46 %
UnclassifiedrootN/A35.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000947|BBAY92_10007626All Organisms → cellular organisms → Bacteria2851Open in IMG/M
3300000947|BBAY92_10171038Not Available568Open in IMG/M
3300000949|BBAY94_10078192All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.911Open in IMG/M
3300000973|BBAY93_10009887All Organisms → cellular organisms → Bacteria2538Open in IMG/M
3300001460|JGI24003J15210_10000317Not Available20615Open in IMG/M
3300001853|JGI24524J20080_1000847All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCGC AAA164-M046214Open in IMG/M
3300001935|GOS2223_1009022All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCGC AAA164-M042265Open in IMG/M
3300002483|JGI25132J35274_1021675All Organisms → Viruses → Predicted Viral1511Open in IMG/M
3300002483|JGI25132J35274_1060062Not Available809Open in IMG/M
3300004457|Ga0066224_1031698Not Available556Open in IMG/M
3300005512|Ga0074648_1038014All Organisms → Viruses → Predicted Viral2282Open in IMG/M
3300005942|Ga0070742_10061771All Organisms → Viruses → Predicted Viral1020Open in IMG/M
3300006025|Ga0075474_10000849Not Available12324Open in IMG/M
3300006025|Ga0075474_10012264All Organisms → cellular organisms → Bacteria3242Open in IMG/M
3300006025|Ga0075474_10058647All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1290Open in IMG/M
3300006026|Ga0075478_10037497All Organisms → Viruses → Predicted Viral1606Open in IMG/M
3300006027|Ga0075462_10001635Not Available7261Open in IMG/M
3300006027|Ga0075462_10080730Not Available1020Open in IMG/M
3300006027|Ga0075462_10104097All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium880Open in IMG/M
3300006027|Ga0075462_10147229All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium720Open in IMG/M
3300006637|Ga0075461_10019063All Organisms → Viruses → Predicted Viral2266Open in IMG/M
3300006735|Ga0098038_1004274Not Available5898Open in IMG/M
3300006750|Ga0098058_1139247Not Available644Open in IMG/M
3300006790|Ga0098074_1022160Not Available1911Open in IMG/M
3300006790|Ga0098074_1081209All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium874Open in IMG/M
3300006802|Ga0070749_10011600Not Available5679Open in IMG/M
3300006802|Ga0070749_10216336All Organisms → Viruses → Predicted Viral1093Open in IMG/M
3300006802|Ga0070749_10342053Not Available832Open in IMG/M
3300006802|Ga0070749_10473030All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium685Open in IMG/M
3300006802|Ga0070749_10535448All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium636Open in IMG/M
3300006810|Ga0070754_10066402Not Available1855Open in IMG/M
3300006810|Ga0070754_10098750All Organisms → Viruses → Predicted Viral1446Open in IMG/M
3300006810|Ga0070754_10253357Not Available803Open in IMG/M
3300006810|Ga0070754_10272269All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium767Open in IMG/M
3300006810|Ga0070754_10277084All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium759Open in IMG/M
3300006810|Ga0070754_10285563All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium744Open in IMG/M
3300006810|Ga0070754_10330887All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium678Open in IMG/M
3300006810|Ga0070754_10429862All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium575Open in IMG/M
3300006810|Ga0070754_10499065All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium524Open in IMG/M
3300006874|Ga0075475_10291436All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium675Open in IMG/M
3300006874|Ga0075475_10291444All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium675Open in IMG/M
3300006919|Ga0070746_10266383All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon795Open in IMG/M
3300006923|Ga0098053_1004695Not Available3444Open in IMG/M
3300006947|Ga0075444_10088191Not Available1379Open in IMG/M
3300007276|Ga0070747_1001923Not Available10023Open in IMG/M
3300007344|Ga0070745_1171560Not Available813Open in IMG/M
3300007344|Ga0070745_1294771All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium579Open in IMG/M
3300007345|Ga0070752_1245772All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium697Open in IMG/M
3300007346|Ga0070753_1157393Not Available858Open in IMG/M
3300007538|Ga0099851_1305374All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium561Open in IMG/M
3300007539|Ga0099849_1024316All Organisms → Viruses → Predicted Viral2622Open in IMG/M
3300007539|Ga0099849_1025956Not Available2527Open in IMG/M
3300007539|Ga0099849_1239918All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium669Open in IMG/M
3300007539|Ga0099849_1297619All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300007542|Ga0099846_1109955All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1010Open in IMG/M
3300007640|Ga0070751_1047246Not Available1902Open in IMG/M
3300007640|Ga0070751_1281790All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium623Open in IMG/M
3300009001|Ga0102963_1105399All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1148Open in IMG/M
3300009441|Ga0115007_10040783Not Available2892Open in IMG/M
3300010155|Ga0098047_10306809Not Available599Open in IMG/M
3300010296|Ga0129348_1129781All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium878Open in IMG/M
3300010296|Ga0129348_1310712All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium526Open in IMG/M
3300010297|Ga0129345_1174455All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium770Open in IMG/M
3300012920|Ga0160423_10003311Not Available13425Open in IMG/M
3300012920|Ga0160423_10404201Not Available933Open in IMG/M
3300016747|Ga0182078_10914395All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium518Open in IMG/M
3300017706|Ga0181377_1002281Not Available5865Open in IMG/M
3300017949|Ga0181584_10314628All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium998Open in IMG/M
3300017951|Ga0181577_10005723Not Available9518Open in IMG/M
3300017951|Ga0181577_10081469Not Available2260Open in IMG/M
3300017952|Ga0181583_10015181All Organisms → cellular organisms → Bacteria5613Open in IMG/M
3300017956|Ga0181580_10038555Not Available3662Open in IMG/M
3300017964|Ga0181589_10276217All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1141Open in IMG/M
3300017967|Ga0181590_10416978Not Available951Open in IMG/M
3300017968|Ga0181587_10677180All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium653Open in IMG/M
3300018415|Ga0181559_10343761All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium826Open in IMG/M
3300018420|Ga0181563_10023704All Organisms → cellular organisms → Bacteria4727Open in IMG/M
3300018420|Ga0181563_10053417All Organisms → Viruses → Predicted Viral2837Open in IMG/M
3300019707|Ga0193989_1025978All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium661Open in IMG/M
3300019708|Ga0194016_1003287Not Available1559Open in IMG/M
3300019751|Ga0194029_1011137All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1293Open in IMG/M
3300019765|Ga0194024_1004535Not Available2852Open in IMG/M
3300019765|Ga0194024_1051574All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon912Open in IMG/M
3300021356|Ga0213858_10004080All Organisms → cellular organisms → Bacteria6865Open in IMG/M
3300021356|Ga0213858_10006256All Organisms → cellular organisms → Bacteria5612Open in IMG/M
3300021364|Ga0213859_10000887Not Available13586Open in IMG/M
3300021959|Ga0222716_10742145All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium516Open in IMG/M
3300022065|Ga0212024_1033601All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium876Open in IMG/M
3300022067|Ga0196895_1000548All Organisms → Viruses → Predicted Viral3882Open in IMG/M
3300022069|Ga0212026_1043454All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium674Open in IMG/M
3300022071|Ga0212028_1079241All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium614Open in IMG/M
3300022187|Ga0196899_1044466All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1486Open in IMG/M
3300022187|Ga0196899_1048953All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1395Open in IMG/M
3300022187|Ga0196899_1203137All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium524Open in IMG/M
3300022200|Ga0196901_1241488All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium564Open in IMG/M
3300022909|Ga0255755_1345304All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium502Open in IMG/M
3300022929|Ga0255752_10023546Not Available4466Open in IMG/M
3300023116|Ga0255751_10026961All Organisms → Viruses → Predicted Viral4291Open in IMG/M
3300023116|Ga0255751_10160374All Organisms → Viruses → Predicted Viral1306Open in IMG/M
(restricted) 3300023210|Ga0233412_10002482Not Available8939Open in IMG/M
(restricted) 3300023276|Ga0233410_10294624Not Available529Open in IMG/M
(restricted) 3300024052|Ga0255050_10083782All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium719Open in IMG/M
3300025048|Ga0207905_1004216All Organisms → Viruses → Predicted Viral2786Open in IMG/M
3300025093|Ga0208794_1012544Not Available1994Open in IMG/M
3300025103|Ga0208013_1001140Not Available12916Open in IMG/M
3300025108|Ga0208793_1019942All Organisms → Viruses → Predicted Viral2383Open in IMG/M
3300025151|Ga0209645_1071060All Organisms → Viruses → Predicted Viral1174Open in IMG/M
3300025630|Ga0208004_1039665All Organisms → Viruses → Predicted Viral1323Open in IMG/M
3300025647|Ga0208160_1022595Not Available1974Open in IMG/M
3300025671|Ga0208898_1000696Not Available24938Open in IMG/M
3300025671|Ga0208898_1079164Not Available1063Open in IMG/M
3300025671|Ga0208898_1111596All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium808Open in IMG/M
3300025674|Ga0208162_1093358All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium908Open in IMG/M
3300025694|Ga0209406_1017643All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3256Open in IMG/M
3300025751|Ga0208150_1211924All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium595Open in IMG/M
3300025759|Ga0208899_1010491All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Imitervirales → Mimiviridae → unclassified Mimiviridae → Mimiviridae sp. ChoanoV15172Open in IMG/M
3300025759|Ga0208899_1028126All Organisms → Viruses2675Open in IMG/M
3300025853|Ga0208645_1180974Not Available767Open in IMG/M
3300025889|Ga0208644_1380659All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium526Open in IMG/M
3300027704|Ga0209816_1086001Not Available1269Open in IMG/M
3300034374|Ga0348335_030356All Organisms → Viruses → Predicted Viral2391Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous48.76%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.05%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh13.22%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface3.31%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater2.48%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.48%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.48%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.48%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.65%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.65%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.65%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.83%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.83%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.83%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.83%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.83%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.83%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001853Marine viral communities from the Subarctic Pacific Ocean - LP-49EnvironmentalOpen in IMG/M
3300001935Marine microbial communities from Northern Gulf of Maine, Canada - GS007EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006923Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300016747Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019707Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_0-1_MGEnvironmentalOpen in IMG/M
3300019708Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MGEnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022909Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024052 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5EnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025093Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BBAY92_1000762653300000947Macroalgal SurfaceMPDLHCPDCGKERFERHLTMKIKDGKTYYVEGQCECGAQMELTNPKTGAPGFKRMGRFGRSY*
BBAY92_1017103813300000947Macroalgal SurfaceMPDLHCPECGKERFERTLTMKVKNGETYYMEGQCECGAQMKLTNPKSGVANLGRMNPHGQSY*
BBAY94_1007819233300000949Macroalgal SurfaceMPDLHCPDCGKERFEKNLTMRVKDGETYYVEGQCECGTQMKLTNPKTGAPGFGKMGRFGRSY*
BBAY93_1000988753300000973Macroalgal SurfaceMPDLHCPDCGKERFERHLTMKIKDGKTYYELTNPKTGAPGFKRMGRFGRSY*
JGI24003J15210_10000317253300001460MarineMPDLYCPDCGKERFEKSLTMRVKDGETYYVEGQCECGSQMKLTNPKKGVPSLSRMNSHGQSY*
JGI24524J20080_100084743300001853MarineMPDLYCPDCGKEKYEKSLTMRVKDDKAYYVEGTCECGSQMKLTNPKKGIPSLARMNKLGSSY*
GOS2223_100902233300001935MarineMPDLNCPDCGKEKHEKSLTMRVKNGEAYYVEGICECGSHMKLTNPKKGVPNLGRMNPHGQSY*
JGI25132J35274_102167523300002483MarineMPDLHCSECGKERFERTLTMKVKDGETYYAEGQCECGAQMELTNPKTGAPGFKRMGRFGRSY*
JGI25132J35274_106006213300002483MarineMPDLHCPECGKERFERTLTMKVKDGETYYVEGQCECGAQMKLTNPKTGAPGFGKMGRFGRSY*
Ga0066224_103169813300004457MarineMPDLNCPDCGKEKYEKSLTMRVKDGQAYYVEGTCECGSQMKLTNPKKGVPNLGRMNPHGQSY*
Ga0074648_103801463300005512Saline Water And SedimentMPDLHCPECGKERFERSLTMKVKDGDTYYVEGQCECGEQMQLTNPKTGVANLGRMNPHGQSY*
Ga0070742_1006177123300005942EstuarineMPDLHCPDCGKERFEKSLTMRVRDGDTYYVEGECECGSQMKLTNPKTGMPHLGRMNKHGQSF*
Ga0075474_1000084953300006025AqueousMPDLHCPECGSERFERSLTMKVKDGEAYYVEGQCECGAQMELTNPKTGAPGFKRMGRFGRSY*
Ga0075474_1001226483300006025AqueousMPDLHCPECGKERFERSLTMKVKDGETYYVEGSCECGAQMELTNPKTGVAALGKMGKFGRSY*
Ga0075474_1005864733300006025AqueousMPDLYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGKSY*
Ga0075478_1003749753300006026AqueousMPDLHCPECGSQRFERNLTMKVKDGKTYYVEGQCECGAQMELTNPKTGAPGFKGMGRFGRSY*
Ga0075462_1000163573300006027AqueousMPDLHCPECGKERFERSLTMKVKDGETYYVEGQCECGAQMKLTNPKTGVANLGRMTSHGQSY*
Ga0075462_1008073033300006027AqueousMPDLHCPECGKERFERTLTMKVKDGEAYYVEGQCECGAQMKLTNPKTGVANLGRMTPHGQSY*
Ga0075462_1010409743300006027AqueousVYKLNLNNMPDLYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGKSY*
Ga0075462_1014722923300006027AqueousMPDLHCPECGKERFERSLTMKVKDGETYYVEGQCECGAQMKLTNPKKGVAALGRMNPHGQSY*
Ga0075461_1001906323300006637AqueousMPDLYCPECGKERFERSLTMKVKDGSTYFLEGECECGTQMKLSNPKTGVPSIGKMDKFGRSY*
Ga0098038_100427453300006735MarineMPDLHCPECGKERFERNLTMKVKDGKTYYVEGQCECGAQMELTNPKTGAPGFKRMGRFGRSY*
Ga0098058_113924733300006750MarineMPDLHCPDCGKERFEKSLTMRVRDGDTYYVEGECECGSQMKLTNPRKGVANLGRMGRNGSSY*
Ga0098074_102216023300006790MarineMPDLHCPECGKERFERNLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFKRMGRFGRSY*
Ga0098074_108120923300006790MarineMPDLHCPDCGKERFERSLTMKVKDGETYYVEGQCECGAQMKLTNPKSGVANLGRMNPHGQSY*
Ga0070749_1001160033300006802AqueousMPDLYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGRSF*
Ga0070749_1021633623300006802AqueousMPDLHCPECGKERFERSLTMKVKDGKAYYVEGRCECGAQMELTNPKTGVASLGKMGRFGRSY*
Ga0070749_1034205323300006802AqueousMPDLHCPECGKERFERSLTMKVKNGETYYVEGQCECGEQMQLTNPKTGVANLGRMNPHGQSY*
Ga0070749_1047303023300006802AqueousMPDLHCPECGKERFEKSLTMRVKDGDTYYLEGECECGSQMKLTNPKTGVANLGRMNPHGQSY*
Ga0070749_1053544823300006802AqueousMPDLHCPNCGKERFEKTLTMRVKDGDTYYVEGECECGTQMKLTNPKTGVANLGRMNPHGQSY*
Ga0070754_1006640273300006810AqueousMPDLHCPECGKERFERSLTMKVKDGKTYYVEGSCECGAQMELTNPKTGVAALGKMGKFGRSY*
Ga0070754_1009875053300006810AqueousMPDLHCPECGKERFERSLTMKVKDGETYYVEGQCECGAQMELTNPKTGVASLGKMGRFGRSF*
Ga0070754_1025335723300006810AqueousMPDLHCPECGKERFERTLTMKVKDGETYYVEGQCECGAQMKLTNPKTGVANLGRMTPHGQSY*
Ga0070754_1027226933300006810AqueousMPDLHCPECGKERFERSLTMKIKDGETYYVEGQCECGEQMQLTNPKTGFASLGKMGRFGKSY*
Ga0070754_1027708413300006810AqueousMPDLHCPECGKERFERSLTMKVKEGKTYYVEGSCECGAQMELTNPKTGVASLGKMGRFGRSY*
Ga0070754_1028556323300006810AqueousMPDLHCPECGKERFERSLTMKVKDGKTYYVEGSCECGAQMELTNPKTGVASLGKMGKFGRSY*
Ga0070754_1033088723300006810AqueousMPDLHCPECGAERFERNLTMKVKDGKTYYVEGQCECGAQMELTNPKTGAPGFGKMGRFGRSY*
Ga0070754_1042986223300006810AqueousMPDLHCPECGKERFERSLTMKVKDGNTYYVEGRCECGAQMELTNPKTGVASLGKMGRFGRSY*
Ga0070754_1049906523300006810AqueousLYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGVASLGKMGRFGKSY*
Ga0075475_1029143613300006874AqueousYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGVASLGKMGRFGKSY*
Ga0075475_1029144413300006874AqueousYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGKSY*
Ga0070746_1026638343300006919AqueousLELNLNNMPDLYCPECGKERFERSLTLKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGK
Ga0098053_100469533300006923MarineMPDLHCPDCGKERFEKSLTMRVRDGDTYYVEGEYECGSQMKLTNPRKGVANLGRMGRNGSSY*
Ga0075444_1008819143300006947MarineMPDLNCPDCGKERYERSLTMRVKNGEAYYVEGTCECGSQMKLTNPKKGVPNLGRMNPHGQSY*
Ga0070747_100192313300007276AqueousQIKLTTMPDLYCPDCGKERFEKNLTMRVKDGETYYVEGQCECGSQMKLTNPKKGVPSLNRMNSHGQSY*
Ga0070745_117156023300007344AqueousMPDLSCPECGKERFERNLTMKVKDGETYYVEGQCECGAQMELSNPKTGAPAFK
Ga0070745_129477123300007344AqueousMPDLHCPECGKERFERTLTMKVKDGETYYMEGQCECGTQMKLTNPKKGIASLGRMTSHGQSY*
Ga0070752_124577223300007345AqueousMPDLHCPECGSERFERSLTMKVKNGETYYMEGQCECGAQMKLTNPKSGVASLGRMNPHGQSY*
Ga0070753_115739323300007346AqueousMPDLSCPECGKERFERNLTMKVKDGETYYVEGQCECGAQMELSNPKTGAPAFKRMGRFGRSY*
Ga0099851_130537413300007538AqueousPECGSERFERSLTMKVKDGEAYYVEGQCECGAQMELTNPKTGAPGFKRMGRFGRSY*
Ga0099849_102431623300007539AqueousMPDLHCPECGRERFERSLTMKVRDGKTYYVEGSCECGAQMELTNPKTGVASLGKMGKFGRSY*
Ga0099849_102595623300007539AqueousMPDLHCPECGKERFERNLTMKVKDGETYYVEGQCECGAQMELTNPKTGAPGFKRMGRFGRSY*
Ga0099849_123991823300007539AqueousVGVPNRIKLNNMPDLHCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMQLTNPKTGVANLGRMNPHGQSY*
Ga0099849_129761923300007539AqueousMPDLHCPECGKERFERNLTMKVKDGETYYVEGQCECGAQMKLTNPKTGVASLGRMGKFGRSL*
Ga0099846_110995523300007542AqueousCPECGKERFERSLTMKVKDGETYYTEGQCECGAQMKLTNPKKGVAALGRMNPHGQSY*
Ga0070751_104724613300007640AqueousMPDLHCPECGKERFERSLTMKVKDGETYYVEGSCECGAQMELTNPKTGVAALGK
Ga0070751_128179023300007640AqueousLYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMQLTNPKTGVANLGRMNPHGQSY*
Ga0102963_110539923300009001Pond WaterMPDLHCPECGKDRFERTLTMKLKDGETYYVEGQCECGAQMKLTNPKKGVARLARMDNHGQSY*
Ga0115007_1004078393300009441MarineMPDLYCPDCGKEKYEKSLTMRAKDDKAYDVEGDCECGSQMKLTNLKKGLPSLGRMNK
Ga0098047_1030680933300010155MarineMPDLHCPDCGKERFEKSLTMRVRDGDTYYVEGECECGSQMKLTNPRKGVANLGRMGRNGS
Ga0129348_112978133300010296Freshwater To Marine Saline GradientMPDLHCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGKSY*
Ga0129348_131071213300010296Freshwater To Marine Saline GradientMPDLHCPECGKERFERSLTMKVKDGETYYTEGQCECGAQMKLTNPKKGVAALGRMNPHGQSY*
Ga0129345_117445523300010297Freshwater To Marine Saline GradientMPDLHCPECGNERFERSLTMKVKNGETYYVEGQCECGEQMQLTNPKTGVANLGRMNPHGQSY*
Ga0160423_1000331153300012920Surface SeawaterMPDLHCPECGAERFERNLTMKVKDGKTYYVEGQCECGSQMELTNPKTGAPGFKRMGRFGRSY*
Ga0160423_1040420143300012920Surface SeawaterMPDLHCPECGSERFERSLTMKVKDGETYYIEGQCECGAQMKLTNPKKGVAKLGRMNGYGQSY*
Ga0182078_1091439523300016747Salt MarshMPDLHCPECGKERFERSLTMKVKDGKTYYVEGRCECGAQMELTNPKTGVASLGKMGRFGRSF
Ga0181377_100228113300017706MarineIKLTTMPDLYCPDCGKERFEKSLTMRVKDGETYYVEGQCECGSQMKLTNPKKGVPSLSRMNSHGQSY
Ga0181584_1031462823300017949Salt MarshMPDLHCPECGKERFERSLTMKVKDGKTYYVEGSCECGAQMELTNPKTGVASLGKMGRFGRSY
Ga0181577_10005723153300017951Salt MarshMPDLHCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMQLTNPKTGVANLGRMNPHGQSY
Ga0181577_1008146973300017951Salt MarshMPDLYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGKSY
Ga0181583_10015181113300017952Salt MarshMPDLHCPECGKERFERSLTMKVKDGKTYYVEGSCECGAQMELTNPKTGVAALGKMGKFGRSY
Ga0181580_1003855553300017956Salt MarshMPDLHCPECGKERFERSLTMKVKDGKTYYVEGRCECGAQMELTNPKTGVASLGKMGRFGRSY
Ga0181589_1027621713300017964Salt MarshRRSQVRILSGVRIKLNNMPDLHCPECGKERFERSLTMKVKDGKTYYVEGRCECGAQMELTNPKTGVASLGKMGRFGRSY
Ga0181590_1041697813300017967Salt MarshMPDLHCPECGKERFERSLTMKVKDGKTYYAEGRCECGAQMELTNPKTGVASLGKMGRFGRSY
Ga0181587_1067718023300017968Salt MarshCGKERFERSLTMKVKDGETYYVEGSCECGAQMELTNPKTGVAALGKMGKFGRSY
Ga0181559_1034376123300018415Salt MarshMPDLHCPECGKERFERSLTMKVKNGETYYVEGQCECGEQMQLTNPKTGVANLGRMNPHGQSY
Ga0181563_1002370423300018420Salt MarshMPDLYCPECGKERFERSLTMKVKDGETYYVEGQCECGAQMKLSNPKKGVASLGRMTSHGQSY
Ga0181563_1005341773300018420Salt MarshMPDLHCPECGSERFERSLTMRVKDGKTYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGRSY
Ga0193989_102597823300019707SedimentLHCPECGKERFERSLTMKVKDGETYYVEGQCECGAQMKLTNPKSGVANLGRMNPHGQSY
Ga0194016_100328723300019708SedimentMPDLHCPECGKERFEKSLTMRVKDGDTYYLEGECECGSQMKLTNPKTGVANLGRMNPHGQSY
Ga0194029_101113723300019751FreshwaterMPDLHCPECGKERFERSLTMKVKDGETYYVEGQCECGAQMKLTNPKSGVANLGRMNPHGQSY
Ga0194024_100453593300019765FreshwaterMPDLHCPECGKERFERSLTMKIKDGETYYVEGQCECGEQMQLTNPKTGFASLGKMGRFGKSY
Ga0194024_105157413300019765FreshwaterMPDLHCPECGKERFERSLTMKVKDGKTYYVEGQCECGEQMQLTNPKTGFASLGKMGRF
Ga0213858_1000408033300021356SeawaterMPDLHCPDCGKERFERHLTMKIKDGKTYYVEGQCECGAQMELTNPKTGAPGFKRMGRFGRSY
Ga0213858_10006256133300021356SeawaterMPDLHCPECGKERFEKTLTMRIKDGEAYYVEGECECGTQMKLTNPKKGVAALGRMNPHGQSY
Ga0213859_10000887313300021364SeawaterMPDLHCPNCGKERFERSLTMKVKDGETYYMEGQCECGAQMKLTNPKSGVANLGRMNPHGQSY
Ga0222716_1074214513300021959Estuarine WaterGCSDVNAIYSKLLVMPDLYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGKSY
Ga0212024_103360113300022065AqueousPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGKSY
Ga0196895_100054893300022067AqueousMPDLHCPECGSERFERSLTMKVKDGEAYYVEGQCECGAQMELTNPKTGAPGFKRMGRFGRSY
Ga0212026_104345413300022069AqueousCGKERFERSLTMKVKDGKTYYVEGSCECGAQMELTNPKTGVAALGKMGKFGRSY
Ga0212028_107924123300022071AqueousMPDLHCPECGKERFERSLTMKVKDGETYYVEGSCECGAQMELTNPKTGVAALGKMGKFGRSY
Ga0196899_104446623300022187AqueousMPDLHCPECGKERFERSLTMKVKDGETYYVEGQCECGAQMELTNPKTGVASLGKMGRFGRSF
Ga0196899_104895343300022187AqueousMPDLHCPECGKERFERSLTMKVKEGKTYYVEGSCECGAQMELTNPKTGVASLGKMGRFGRSY
Ga0196899_120313723300022187AqueousMPDLHCPECGSERFERSLTMKVKNGETYYMEGQCECGAQMKLTNPKSGVASLGRMNPHGQSY
Ga0196901_124148823300022200AqueousMPDLHCPECGKERFERNLTMKVKDGETYYVEGQCECGAQMELTNPKTGAPGFKRMGRFGRSY
Ga0255755_134530413300022909Salt MarshCSDVNAIYSKLLVMPDLYCPECGKERFERSLTMKVKDGETYYVEGQCECGAQMKLSNPKKGVASLGRMTSHGQSY
Ga0255752_1002354623300022929Salt MarshMPDLYCPECGKERFERSLTMKVKDGDTYYVEGQCECGSQMKLSNPKKGVASLGRMTSHGQSY
Ga0255751_1002696193300023116Salt MarshMPDLHRPECGKERFERSLTMKVKDGKTYYVEGRCECGAQMELTNPKTGVASLGKMGRFGRSY
Ga0255751_1016037423300023116Salt MarshMPDLHCPECGSERFERSLTMKVKDGETYYVEGSCECGAQMELTNPKTGVAALGKMGKFGRSY
(restricted) Ga0233412_1000248253300023210SeawaterMPDLHCPDCGKERFEKSLTMRVRDGDTYYVEGECECGSQMKLTNPKTGMPHLGRMNKHGQSF
(restricted) Ga0233410_1029462443300023276SeawaterMPDLHCPDCGKERFEKSLTMRVRDGDTYYVEGECECGSQMKLTNPKTGMPHLGRMNKHGQ
(restricted) Ga0255050_1008378223300024052SeawaterDCGKEPFEKSLTMRVRDGDTYYVEGECECGSQMKLTNQKTGMPHLGRMNKHGQSF
Ga0207905_100421623300025048MarineMPDLYCPDCGKEKYEKSLTMRVKDDKAYYVEGTCECGSQMKLTNPKKGIPSLARMNKLGSSY
Ga0208794_101254423300025093MarineMPDLHCPDCGKERFERSLTMKVKDGETYYVEGQCECGAQMKLTNPKSGVANLGRMNPHGQSY
Ga0208013_1001140103300025103MarineMPDLHCPDCGKERFEKSLTMRVRDGDTYYVEGECECGSQMKLTNPRKGVANLGRMGRNGSSY
Ga0208793_101994213300025108MarineNPCGCTIKLNNMPDLHCPDCGKERFEKSLTMRVRDGDTYYVEGECECGSQMKLTNPRKGVANLGRMGRNGSSY
Ga0209645_107106053300025151MarineMPDLHCPECGSERFERSLTMKVKDGETYYVEGQCECGAQMKLTNPKKGVAKLGRMNGYGQSY
Ga0208004_103966523300025630AqueousMPDLYCPECGKERFERSLTMKVKDGSTYFLEGECECGTQMKLSNPKTGVPSIGKMDKFGRSY
Ga0208160_102259513300025647AqueousVYKLNLNNMPDLYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGKSY
Ga0208898_1000696143300025671AqueousMPDLYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGRSF
Ga0208898_107916413300025671AqueousMPDLHCPECGSERFERSLTMKVKNGETYYMEGQCECGAQMKLTNPKSGVASL
Ga0208898_111159613300025671AqueousLNLNNMPDLYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGKSY
Ga0208162_109335833300025674AqueousMPDLHCPECGKERFERSLTMKVKDGETYYTEGQCECGAQMKLTNPKKGVAALGRMNPHGQSY
Ga0209406_101764333300025694Pelagic MarineMPDLYCPDCGKEKYEKSLTMRVKDDKAYYVEGACECGSQMKLTNPKGVPSLGRMNKLGSS
Ga0208150_121192423300025751AqueousESCRVYKLNLNNMPDLYCPECGKERFERSLTMKVKDGETYYVEGQCECGEQMKLTNPKTGAPGFGKMGRFGKSY
Ga0208899_101049133300025759AqueousMPDLHCPECGKERFERTLTMKVKDGEAYYVEGQCECGAQMKLTNPKTGVANLGRMTPHGQSY
Ga0208899_102812613300025759AqueousVRILSGVRIKLNNMPDLHCPECGKERFERSLTMKVKDGETYYVEGQCECGAQMKLTNPKKGVAALGRMNPHGQSY
Ga0208645_118097413300025853AqueousSRRSQVRILSGVRIKLTNMPDLHCPECGKERFERTLTMKVKDGETYYVEGQCECGAQMKLTNPKTGVANLGRMTPHGQSY
Ga0208644_138065923300025889AqueousMPDLHCPECGKERFERSLTMKVKDGKAYYVEGRCECGAQMELTNPKTGVASLGKMGRFGRSY
Ga0209816_108600123300027704MarineMPDLNCPDCGKERYERSLTMRVKNGEAYYVEGTCECGSQMKLTNPKKGVPNLGRMNPHGQSY
Ga0348335_030356_1_1593300034374AqueousMPDLHCPECGKERFERSLTMKVKDGETYYVEGQCECGAQMELTNPKTGVASLG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.