| Basic Information | |
|---|---|
| Family ID | F072283 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MQTMQDLIDLIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 77.69 % |
| % of genes near scaffold ends (potentially truncated) | 18.18 % |
| % of genes from short scaffolds (< 2000 bps) | 68.60 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.810 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (34.711 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.074 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.504 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.73% β-sheet: 16.33% Coil/Unstructured: 46.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF09954 | DUF2188 | 5.79 |
| PF13578 | Methyltransf_24 | 4.96 |
| PF02767 | DNA_pol3_beta_2 | 4.13 |
| PF00145 | DNA_methylase | 2.48 |
| PF07659 | DUF1599 | 1.65 |
| PF00565 | SNase | 1.65 |
| PF03796 | DnaB_C | 0.83 |
| PF10263 | SprT-like | 0.83 |
| PF01930 | Cas_Cas4 | 0.83 |
| PF02467 | Whib | 0.83 |
| PF04545 | Sigma70_r4 | 0.83 |
| PF08281 | Sigma70_r4_2 | 0.83 |
| PF12705 | PDDEXK_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 4.13 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.48 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.83 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.83 |
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.81 % |
| All Organisms | root | All Organisms | 37.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002835|B570J40625_100934950 | Not Available | 747 | Open in IMG/M |
| 3300004240|Ga0007787_10223669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300005527|Ga0068876_10133807 | Not Available | 1464 | Open in IMG/M |
| 3300005527|Ga0068876_10171805 | Not Available | 1267 | Open in IMG/M |
| 3300005527|Ga0068876_10227854 | Not Available | 1074 | Open in IMG/M |
| 3300005581|Ga0049081_10027121 | Not Available | 2175 | Open in IMG/M |
| 3300005581|Ga0049081_10073636 | Not Available | 1284 | Open in IMG/M |
| 3300005662|Ga0078894_11677910 | Not Available | 522 | Open in IMG/M |
| 3300005739|Ga0076948_1003887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4656 | Open in IMG/M |
| 3300005805|Ga0079957_1112492 | Not Available | 1457 | Open in IMG/M |
| 3300006639|Ga0079301_1028289 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300006805|Ga0075464_10709799 | Not Available | 622 | Open in IMG/M |
| 3300007162|Ga0079300_10056515 | Not Available | 1227 | Open in IMG/M |
| 3300007735|Ga0104988_10544 | Not Available | 17416 | Open in IMG/M |
| 3300007735|Ga0104988_10826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 32227 | Open in IMG/M |
| 3300008055|Ga0108970_10111306 | Not Available | 531 | Open in IMG/M |
| 3300008107|Ga0114340_1018049 | Not Available | 3357 | Open in IMG/M |
| 3300008107|Ga0114340_1112865 | Not Available | 1065 | Open in IMG/M |
| 3300008107|Ga0114340_1150465 | Not Available | 858 | Open in IMG/M |
| 3300008107|Ga0114340_1184699 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
| 3300008107|Ga0114340_1258075 | Not Available | 527 | Open in IMG/M |
| 3300008116|Ga0114350_1059324 | Not Available | 1352 | Open in IMG/M |
| 3300008119|Ga0114354_1121460 | Not Available | 1009 | Open in IMG/M |
| 3300008266|Ga0114363_1056038 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300008266|Ga0114363_1074963 | All Organisms → Viruses → Predicted Viral | 1275 | Open in IMG/M |
| 3300008266|Ga0114363_1125292 | Not Available | 886 | Open in IMG/M |
| 3300008448|Ga0114876_1154964 | Not Available | 830 | Open in IMG/M |
| 3300008450|Ga0114880_1040509 | Not Available | 2024 | Open in IMG/M |
| 3300008450|Ga0114880_1047395 | Not Available | 1833 | Open in IMG/M |
| 3300008962|Ga0104242_1015325 | Not Available | 1340 | Open in IMG/M |
| 3300009068|Ga0114973_10020903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4069 | Open in IMG/M |
| 3300009151|Ga0114962_10210022 | Not Available | 1131 | Open in IMG/M |
| 3300009155|Ga0114968_10012407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 6080 | Open in IMG/M |
| 3300009158|Ga0114977_10217694 | Not Available | 1113 | Open in IMG/M |
| 3300009159|Ga0114978_10168766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1399 | Open in IMG/M |
| 3300009160|Ga0114981_10678154 | Not Available | 546 | Open in IMG/M |
| 3300009180|Ga0114979_10163572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1359 | Open in IMG/M |
| 3300010354|Ga0129333_10060671 | All Organisms → Viruses → Predicted Viral | 3527 | Open in IMG/M |
| 3300010354|Ga0129333_10864121 | Not Available | 767 | Open in IMG/M |
| 3300010354|Ga0129333_11419364 | Not Available | 570 | Open in IMG/M |
| 3300012000|Ga0119951_1018851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 2519 | Open in IMG/M |
| 3300012000|Ga0119951_1126474 | Not Available | 579 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10224777 | All Organisms → Viruses → Predicted Viral | 1160 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10569161 | Not Available | 612 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10646289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → unclassified Methylotenera → Methylotenera sp. | 563 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10672285 | Not Available | 548 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10163860 | Not Available | 1461 | Open in IMG/M |
| 3300017736|Ga0181365_1098366 | Not Available | 709 | Open in IMG/M |
| 3300017754|Ga0181344_1201691 | Not Available | 558 | Open in IMG/M |
| 3300017780|Ga0181346_1245671 | Not Available | 627 | Open in IMG/M |
| 3300017788|Ga0169931_10062205 | All Organisms → Viruses → Predicted Viral | 3874 | Open in IMG/M |
| 3300017788|Ga0169931_10276817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1343 | Open in IMG/M |
| 3300017788|Ga0169931_10653150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
| 3300017788|Ga0169931_10812480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300019784|Ga0181359_1077633 | Not Available | 1249 | Open in IMG/M |
| 3300020172|Ga0211729_10237820 | Not Available | 729 | Open in IMG/M |
| 3300020183|Ga0194115_10054697 | Not Available | 2491 | Open in IMG/M |
| 3300020549|Ga0207942_1021542 | Not Available | 823 | Open in IMG/M |
| 3300021438|Ga0213920_1002986 | Not Available | 7491 | Open in IMG/M |
| 3300021963|Ga0222712_10013610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7150 | Open in IMG/M |
| 3300021963|Ga0222712_10621611 | Not Available | 621 | Open in IMG/M |
| 3300022179|Ga0181353_1009907 | All Organisms → Viruses → Predicted Viral | 2378 | Open in IMG/M |
| 3300022752|Ga0214917_10153782 | Not Available | 1211 | Open in IMG/M |
| 3300022752|Ga0214917_10156113 | Not Available | 1197 | Open in IMG/M |
| 3300022752|Ga0214917_10343388 | Not Available | 642 | Open in IMG/M |
| 3300023174|Ga0214921_10039312 | Not Available | 4407 | Open in IMG/M |
| 3300023174|Ga0214921_10157344 | Not Available | 1523 | Open in IMG/M |
| 3300023174|Ga0214921_10425757 | Not Available | 665 | Open in IMG/M |
| 3300023174|Ga0214921_10462798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300023174|Ga0214921_10554995 | Not Available | 527 | Open in IMG/M |
| 3300023179|Ga0214923_10280371 | Not Available | 919 | Open in IMG/M |
| 3300027499|Ga0208788_1038200 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300027608|Ga0208974_1009801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3141 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1154907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1051225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2224 | Open in IMG/M |
| 3300027734|Ga0209087_1058095 | Not Available | 1742 | Open in IMG/M |
| 3300027760|Ga0209598_10010936 | Not Available | 5876 | Open in IMG/M |
| 3300027763|Ga0209088_10021228 | Not Available | 3357 | Open in IMG/M |
| 3300027763|Ga0209088_10060930 | All Organisms → Viruses → Predicted Viral | 1807 | Open in IMG/M |
| 3300027777|Ga0209829_10417768 | Not Available | 515 | Open in IMG/M |
| 3300027816|Ga0209990_10165289 | Not Available | 1040 | Open in IMG/M |
| 3300027963|Ga0209400_1009988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 6063 | Open in IMG/M |
| 3300028025|Ga0247723_1000181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 40218 | Open in IMG/M |
| 3300028025|Ga0247723_1004625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6435 | Open in IMG/M |
| 3300028025|Ga0247723_1004762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6300 | Open in IMG/M |
| 3300028025|Ga0247723_1005062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6019 | Open in IMG/M |
| 3300028025|Ga0247723_1006239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5239 | Open in IMG/M |
| 3300028025|Ga0247723_1008445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4250 | Open in IMG/M |
| 3300028025|Ga0247723_1037581 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
| 3300028025|Ga0247723_1040435 | Not Available | 1392 | Open in IMG/M |
| 3300031758|Ga0315907_10235044 | Not Available | 1525 | Open in IMG/M |
| 3300031787|Ga0315900_10042029 | All Organisms → cellular organisms → Bacteria | 4925 | Open in IMG/M |
| 3300031857|Ga0315909_10048813 | All Organisms → Viruses → Predicted Viral | 3936 | Open in IMG/M |
| 3300031951|Ga0315904_10272717 | Not Available | 1604 | Open in IMG/M |
| 3300032092|Ga0315905_10141737 | Not Available | 2400 | Open in IMG/M |
| 3300032092|Ga0315905_10230224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1809 | Open in IMG/M |
| 3300032116|Ga0315903_10184262 | Not Available | 1874 | Open in IMG/M |
| 3300032173|Ga0315268_11873820 | Not Available | 613 | Open in IMG/M |
| 3300033993|Ga0334994_0082564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1924 | Open in IMG/M |
| 3300033993|Ga0334994_0090633 | All Organisms → Viruses → Predicted Viral | 1815 | Open in IMG/M |
| 3300033994|Ga0334996_0037869 | Not Available | 3052 | Open in IMG/M |
| 3300033994|Ga0334996_0394488 | Not Available | 652 | Open in IMG/M |
| 3300034012|Ga0334986_0039175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3077 | Open in IMG/M |
| 3300034012|Ga0334986_0117883 | Not Available | 1569 | Open in IMG/M |
| 3300034012|Ga0334986_0253726 | Not Available | 954 | Open in IMG/M |
| 3300034061|Ga0334987_0502092 | Not Available | 739 | Open in IMG/M |
| 3300034062|Ga0334995_0043649 | Not Available | 3724 | Open in IMG/M |
| 3300034066|Ga0335019_0580222 | Not Available | 659 | Open in IMG/M |
| 3300034073|Ga0310130_0000263 | Not Available | 42757 | Open in IMG/M |
| 3300034092|Ga0335010_0584233 | Not Available | 570 | Open in IMG/M |
| 3300034101|Ga0335027_0011763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7566 | Open in IMG/M |
| 3300034101|Ga0335027_0021656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 5446 | Open in IMG/M |
| 3300034101|Ga0335027_0085344 | Not Available | 2444 | Open in IMG/M |
| 3300034101|Ga0335027_0157274 | Not Available | 1661 | Open in IMG/M |
| 3300034102|Ga0335029_0121211 | Not Available | 1822 | Open in IMG/M |
| 3300034102|Ga0335029_0629823 | Not Available | 595 | Open in IMG/M |
| 3300034104|Ga0335031_0312024 | Not Available | 1019 | Open in IMG/M |
| 3300034104|Ga0335031_0464260 | Not Available | 779 | Open in IMG/M |
| 3300034106|Ga0335036_0005203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11012 | Open in IMG/M |
| 3300034106|Ga0335036_0234578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1252 | Open in IMG/M |
| 3300034272|Ga0335049_0524907 | Not Available | 749 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 34.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.09% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.26% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 6.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.31% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.48% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.65% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.65% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.83% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.83% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.83% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.83% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.83% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_1009349501 | 3300002835 | Freshwater | MQTMQDLIDLIKPILPNALIIDTDSGILIETGLELGLGGLIQT |
| Ga0007787_102236691 | 3300004240 | Freshwater Lake | MQTMQDLINAIKPILPNALIIDTDEGIMIETNLELGIGGLLQPMETEGE* |
| Ga0068876_101338072 | 3300005527 | Freshwater Lake | MQTMQDLIDQIKTILPNALVIDTDSGILIETGLELGLGGLLQTIERD* |
| Ga0068876_101718051 | 3300005527 | Freshwater Lake | MNTMQDLINAIKPILPNALIIDTDTGILIETGLEPGLGGLLQTIEREGE* |
| Ga0068876_102278546 | 3300005527 | Freshwater Lake | VNTMQDLINAIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE* |
| Ga0049081_100271213 | 3300005581 | Freshwater Lentic | MQTMQDLIEAIKPILPNALVIDTDSGILIETNLELGLGGLLQTIEREGE* |
| Ga0049081_100736364 | 3300005581 | Freshwater Lentic | VRERVQTMQDLIDLIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEGEGA* |
| Ga0078894_116779102 | 3300005662 | Freshwater Lake | MQTMQDLINAIKPILPNALVIDTDTGILIETGLELGLGGLLQTIEREGE* |
| Ga0076948_100388714 | 3300005739 | Lake Water | MQTMQDLIDLIKPILPNALIIDTDEGILIETGLELDLGGLLRPIEREGESE* |
| Ga0079957_11124923 | 3300005805 | Lake | MQTMQDLIEAIRPILPNALVIDTDDGVLIETGLELDLGGILQPMEREEE* |
| Ga0079301_10282893 | 3300006639 | Deep Subsurface | MNTMQDLINAIKPILPNALIIDTDTGILIETGLELGLGGLLQTLEREEA* |
| Ga0075464_107097991 | 3300006805 | Aqueous | AIKPILPNALVIDTDSGILIETNLELGLGGLLQAIEREGE* |
| Ga0079300_100565152 | 3300007162 | Deep Subsurface | MQTMQDLINAIKPILPNALIIDTDSGILIETGLELGLGGLLQTIEREGA* |
| Ga0104988_1054433 | 3300007735 | Freshwater | MNTMQDLIDLIKPILPNALIIDTDEGVLIETGLELDLGGLLQPIEREGASK* |
| Ga0104988_1082646 | 3300007735 | Freshwater | MQTMQDLIDAIKPILPNALVIDTDEGILIETNLELGLGGLLQPMETEGD* |
| Ga0108970_101113062 | 3300008055 | Estuary | MQTMQDLIDLIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREEA* |
| Ga0114340_10180497 | 3300008107 | Freshwater, Plankton | MQDLINAIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE* |
| Ga0114340_11128653 | 3300008107 | Freshwater, Plankton | MQTMQDLIDQIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE* |
| Ga0114340_11504651 | 3300008107 | Freshwater, Plankton | MQDLIDQIKTILPNALVIDTDSGILIETGLELGLG |
| Ga0114340_11846993 | 3300008107 | Freshwater, Plankton | MQTMQDLIDAIKPILPNALIIDTDEGVLIETNLQLGLGGLLEPMEPEGE* |
| Ga0114340_12580752 | 3300008107 | Freshwater, Plankton | QTMQDLIDQIKTILPNALVIDTDSGILIETGLELGLGGLLQTIERD* |
| Ga0114350_10593243 | 3300008116 | Freshwater, Plankton | MQDLIDQIKTILPNALVIDTDSGILIETGLELGLGGLLQTIERD* |
| Ga0114354_11214605 | 3300008119 | Freshwater, Plankton | MQDLIDLIKPILPKALIIDTDDGILIETGLELGLGGLLQTIEREGA* |
| Ga0114363_10560387 | 3300008266 | Freshwater, Plankton | MQTMQDLIDLIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREGE* |
| Ga0114363_10749631 | 3300008266 | Freshwater, Plankton | MNTMQDLIDAIKPILPNALVIDTDEGILIETNLELGLG |
| Ga0114363_11252922 | 3300008266 | Freshwater, Plankton | MQDLIDQIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE* |
| Ga0114876_11549642 | 3300008448 | Freshwater Lake | MQTMQDLIDQIKPILPNALVIDTDSGILIETGLELGLGGLLQTLEREGE* |
| Ga0114880_10405097 | 3300008450 | Freshwater Lake | MQTMQDLIDQIKTILPNALVIDTDSGILIETGLELGLGGLLQ |
| Ga0114880_10473952 | 3300008450 | Freshwater Lake | MQTMQDLIDQIKTILPNALVIDTDSGILIETGLELGLGGLLQTIDRD* |
| Ga0104242_10153252 | 3300008962 | Freshwater | MNTMQDLINAIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE* |
| Ga0114973_100209039 | 3300009068 | Freshwater Lake | MNTMQDLIDLIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREEA* |
| Ga0114962_102100222 | 3300009151 | Freshwater Lake | MQTMQDLIDLIKPILPNALIIDTDTGILIETGLELGLGGLLQTIEREGE* |
| Ga0114968_1001240710 | 3300009155 | Freshwater Lake | MQTMQDLINAIKPILPNALVIDTDTGILIETGLELSLGGLLQTIEREGE* |
| Ga0114977_102176945 | 3300009158 | Freshwater Lake | MNTMQDLINAIKPILPNALIIDTDTGILIETGLELGLGGLLQTLEREGA* |
| Ga0114978_101687661 | 3300009159 | Freshwater Lake | LMQTMQDLIDLIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREEA* |
| Ga0114981_106781542 | 3300009160 | Freshwater Lake | MNTMQDLINAIKPILPNALIIDTDTGILIETGLELGLGGLLQTLEREGE* |
| Ga0114979_101635726 | 3300009180 | Freshwater Lake | LIDLIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREEA* |
| Ga0129333_100606718 | 3300010354 | Freshwater To Marine Saline Gradient | MNTMQDLIDAIKPILPNALVIDTDEGILIETNLELGLGGLLQPIEEGK* |
| Ga0129333_108641212 | 3300010354 | Freshwater To Marine Saline Gradient | MQTMQDLIDLIKPILPNALVIDTDEGILIETGLELGLGGLLQTIEGE* |
| Ga0129333_114193642 | 3300010354 | Freshwater To Marine Saline Gradient | MQTMQDLINAIKPILPNALVIDTDEGILIETNLELGLGGLLQPMETEDD* |
| Ga0119951_10188514 | 3300012000 | Freshwater | MNTMQDLINAIKPILPNALVIDTDTGILIETGLELGLGGLLQTIEREGE* |
| Ga0119951_11264741 | 3300012000 | Freshwater | MQDLIDLIKPILPNALVIDTDTGILIETGLELGLGGLLQTIEREGEE* |
| (restricted) Ga0172367_102247773 | 3300013126 | Freshwater | MQTMQDLINAIKPILPNALVIDTDQGILIETNLELGLGGLLQPMETEGD* |
| (restricted) Ga0172367_105691613 | 3300013126 | Freshwater | MQDLIDLIKPILPNALIIDTDEGVLIETGLELDLGGLLQPIEREGESE* |
| (restricted) Ga0172367_106462891 | 3300013126 | Freshwater | MQDLIDLIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE* |
| (restricted) Ga0172367_106722851 | 3300013126 | Freshwater | IKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE* |
| (restricted) Ga0172376_101638605 | 3300014720 | Freshwater | MQTMQDLIDLIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE* |
| Ga0181365_10983662 | 3300017736 | Freshwater Lake | MQTMQDLIDLIKPILPNALIIDTDSGILIETGLELGLGSLLQTIEREGE |
| Ga0181344_12016913 | 3300017754 | Freshwater Lake | MSTMQDLIDLIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE |
| Ga0181346_12456712 | 3300017780 | Freshwater Lake | MNTMQDLINAIKPILPNALIIDTDTGILIETGLELGLGGLLQTIEREGA |
| Ga0169931_100622054 | 3300017788 | Freshwater | MQTMQDLINAIKPILPNALVIDTDQGILIETNLELGLGGLLQPMETEGD |
| Ga0169931_102768173 | 3300017788 | Freshwater | MQTMQDLIDLIKPILPNALIIDTDEGVLIETGLELDLGGLLQPIERERDE |
| Ga0169931_106531502 | 3300017788 | Freshwater | MQDLIDLIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE |
| Ga0169931_108124803 | 3300017788 | Freshwater | MQTMQDLIDLIKPILPNALIIDTDEGVLIETGLELDLGGLLQPKEREGECELHN |
| Ga0181359_10776332 | 3300019784 | Freshwater Lake | MNTMQDLINAIKPILPNALIIDTDTGILIETGLELGLGGLLQTLEREEA |
| Ga0211729_102378204 | 3300020172 | Freshwater | MQTMQDLIDKIKPILPNALIIDTDTGILIETGLELGLGGLLQA |
| Ga0194115_100546975 | 3300020183 | Freshwater Lake | MQTMQDLIDLIKPILPNALVIDTDSGILIETGLELGLGGLLQTIERGSR |
| Ga0207942_10215422 | 3300020549 | Freshwater | MNTMQDLINAIKPILPNALIIDTDSGILIETGLELGLGGLLQTIEREGA |
| Ga0213920_100298614 | 3300021438 | Freshwater | MNTMQDLIEAVRTILPNALIVDTDEGILIETNLQLGLGGLLEPYERDEE |
| Ga0222712_1001361016 | 3300021963 | Estuarine Water | MQTMQDLINAIKPILPNALIIDTDTGILIETGLELGLGGLLQTLEIEGE |
| Ga0222712_106216111 | 3300021963 | Estuarine Water | MQTMQDLIDLIKPILPNALIIDTDEGILIETGLELGLGGLLQTLEREGE |
| Ga0181353_10099077 | 3300022179 | Freshwater Lake | MQTMQDLINAIKPILPNALIIDTDEGIMIETNLELGIGGLLQPMETEGE |
| Ga0214917_101537821 | 3300022752 | Freshwater | MQTMQDLIDLIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREGE |
| Ga0214917_101561132 | 3300022752 | Freshwater | MQTMQDLIDLIKPILPNALIIDTDEGILIETGLELDLGGLLQTIEREGA |
| Ga0214917_103433883 | 3300022752 | Freshwater | MQTMQDLIDLIKPILPNALIIDTDSGILIETGLELGLGGLLQTIEREGE |
| Ga0214921_100393127 | 3300023174 | Freshwater | MNTMQDLIEAIKPILPNALVIDTDTGILIETNLELGLGGLLQTIEREGE |
| Ga0214921_101573442 | 3300023174 | Freshwater | MNTMQDLINAIKPILPNALVIDTDTGILIETGLELGLGGLLQTIEREGE |
| Ga0214921_104257571 | 3300023174 | Freshwater | MQTMQDLIDLIKPILPNALVIDTDTGILIETGLELGLGGLLQTIEREGE |
| Ga0214921_104627983 | 3300023174 | Freshwater | KPILPNALIIDTDSGILIETGLELGLGGLLQTLEREGE |
| Ga0214921_105549951 | 3300023174 | Freshwater | ILPNALIIDTDSGILIETGLELGLGGLIQTLEREEA |
| Ga0214923_102803713 | 3300023179 | Freshwater | MQDLIDLIKPILPNALVIDTDTGILIETGLELGLGGLLQTIEREGE |
| Ga0208788_10382001 | 3300027499 | Deep Subsurface | RIMQTMQDLINAIKPILPNALIIDTDTGILIETGLELGLGGLLQTLEREEA |
| Ga0208974_10098019 | 3300027608 | Freshwater Lentic | MQTMQDLIEAIKPILPNALVIDTDSGILIETNLELGLGGLLQTIEREGE |
| (restricted) Ga0247836_11549072 | 3300027728 | Freshwater | MQTMQDLIDLIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGK |
| (restricted) Ga0247833_10512255 | 3300027730 | Freshwater | VQTMQDLIDLIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREEE |
| Ga0209087_10580954 | 3300027734 | Freshwater Lake | MNTMQDLINAIKPILPNALIIDTDTGILIETGLELGLGGLLQTLEREGA |
| Ga0209598_100109365 | 3300027760 | Freshwater Lake | MNTMQDLIDLIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREEA |
| Ga0209088_100212281 | 3300027763 | Freshwater Lake | MQTMQDLIDLIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREEA |
| Ga0209088_100609309 | 3300027763 | Freshwater Lake | ILPNALIIDTDSGILIETGLELGLGGLLQTLEREEA |
| Ga0209829_104177682 | 3300027777 | Freshwater Lake | MQTMQDLIDAIRPILPNSLIIDTDDGIIIETGLELGLGGLLEIQE |
| Ga0209990_101652891 | 3300027816 | Freshwater Lake | MQTMQDLIDQIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE |
| Ga0209400_100998811 | 3300027963 | Freshwater Lake | MQTMQDLINAIKPILPNALVIDTDTGILIETGLELSLGGLLQTIEREGE |
| Ga0247723_10001817 | 3300028025 | Deep Subsurface Sediment | MNTMQDLINAIKLILPNALVIDTDEGILIETNLELGLGGLLQPMETEGD |
| Ga0247723_100462510 | 3300028025 | Deep Subsurface Sediment | MNTMEDLIEAIKPILPNALVIDTDSGILIETNLELGLGGLLQTIEREGE |
| Ga0247723_100476211 | 3300028025 | Deep Subsurface Sediment | MQTMQDLINAIKPILPNALVIDTDTGILIETGLEIGLGGLLQTLEREGE |
| Ga0247723_10050625 | 3300028025 | Deep Subsurface Sediment | MQTMQDLIDLIKPILPNALIIDTDSGILIETGLELGLGGLIQTYEREGE |
| Ga0247723_10062398 | 3300028025 | Deep Subsurface Sediment | MQTMQDLINAIKPILPNALVIDTDTGILIETGLELGLGGLLQTLEREGA |
| Ga0247723_100844512 | 3300028025 | Deep Subsurface Sediment | MQTMQDLIDQIKTILPNALIIDTDSGILIETGLELGLGGLLQTLEREGE |
| Ga0247723_10375811 | 3300028025 | Deep Subsurface Sediment | MNTMQDLIEAIKPILPNALVIDTDSGILIETNLELGLGGLLQTIE |
| Ga0247723_10404353 | 3300028025 | Deep Subsurface Sediment | MNTMQDLIDKIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREGE |
| Ga0315907_102350441 | 3300031758 | Freshwater | MQTMQDLIDQIKTILPNALVIDTDSGILIETGLELGLGGLLQTIDRD |
| Ga0315900_1004202912 | 3300031787 | Freshwater | VNTMQDLINAIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE |
| Ga0315909_100488138 | 3300031857 | Freshwater | MNTMQDLIDAIKPILPNALVIDTDEGILIETNLELGLGGLLQPIEEVK |
| Ga0315904_102727171 | 3300031951 | Freshwater | MQTMQDLIEAIRPILPNALVIDTDDGILIETGLELDLGGILQPMERE |
| Ga0315905_101417371 | 3300032092 | Freshwater | MQTMQDLIDLIKPILPKALIIDTDDGILIETGLELGLGGLLQTIEREGA |
| Ga0315905_102302246 | 3300032092 | Freshwater | MQTMQDLIDLIKPILPNALIIDTDEGILIETGLELGLGGLLQTIEREGE |
| Ga0315903_101842622 | 3300032116 | Freshwater | VNTMQDLIDQIKTILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE |
| Ga0315268_118738202 | 3300032173 | Sediment | METMQDLIDKIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE |
| Ga0334994_0082564_488_628 | 3300033993 | Freshwater | MQDLIDLIKPILPNALIIDTDSGILIETGLELGLGGLIQTYEREGE |
| Ga0334994_0090633_1_132 | 3300033993 | Freshwater | LIDKIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREGE |
| Ga0334996_0037869_1620_1760 | 3300033994 | Freshwater | MQDLIDLIKPILPNALVIDTDEGILIETGLELGLGGLLQTIEGEEA |
| Ga0334996_0394488_290_439 | 3300033994 | Freshwater | MNTMQDLINAIKPILPNALIIDTDTGILIETGLELGLGGLLQTIEREGE |
| Ga0334986_0039175_1705_1854 | 3300034012 | Freshwater | MNTMQDLIDKIKPILPNALIIDTDTGILIETGLELGLGGLLQTLEREGE |
| Ga0334986_0117883_603_752 | 3300034012 | Freshwater | MNTMQDLIDQIKTILPNALIIDTDSGILIETGLELGLGGLLQTIEREGE |
| Ga0334986_0253726_323_472 | 3300034012 | Freshwater | MNTMQDLINAIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREEA |
| Ga0334987_0502092_2_133 | 3300034061 | Freshwater | LIDQIKTILPNALVIDTDSGILIETGLELGLGGLLQTIEREGA |
| Ga0334995_0043649_913_1053 | 3300034062 | Freshwater | MQDLINAIKPILPNALIIDTDSGILIETGLELGLGGLLQTIEGEEA |
| Ga0335019_0580222_1_129 | 3300034066 | Freshwater | MNTMQDLINAIKPILPNALIIDTDSGILIETGLELGLGGLLQT |
| Ga0310130_0000263_13827_13967 | 3300034073 | Fracking Water | MQDLIEAIRPILPNALVIDTDDGILIETGLELDLGGILQPMEREEE |
| Ga0335010_0584233_125_265 | 3300034092 | Freshwater | MQDLIDKIKPILPNALIIDTDSGILIETGLELGLGGLLQTLEREGE |
| Ga0335027_0011763_3140_3283 | 3300034101 | Freshwater | MQDLINAIKPILPNALIIDTDEGIMIETNLELGIGGLLQPMETEGEE |
| Ga0335027_0021656_1939_2079 | 3300034101 | Freshwater | MQDLIDLIKPILPNALVIDTDEGILIETGLELGLGGLLQPIEGENK |
| Ga0335027_0085344_1967_2107 | 3300034101 | Freshwater | MQDLIDKIKPILPNALIIDTDTGILIETGLELGLGGLLQTLEREGE |
| Ga0335027_0157274_592_732 | 3300034101 | Freshwater | MQDLINAIKPILPNALVIDTDSGILIETGLELGLGGLLQTLEREGE |
| Ga0335029_0121211_556_699 | 3300034102 | Freshwater | MQDLIDLIKPILPNALVIDTDSGILIETGLELGLGGLLQTIEREGAI |
| Ga0335029_0629823_268_417 | 3300034102 | Freshwater | MQTMQDLIDLIKPILPNALVIDTDSGILIETGLELGLGGLLQTLEREKE |
| Ga0335031_0312024_100_249 | 3300034104 | Freshwater | MNTMQDLIDQIKTILPNALVIDTDSGILIETGLELGLGGLLQTIEREGE |
| Ga0335031_0464260_313_453 | 3300034104 | Freshwater | MQDLIDKIKPILPNALIIDTDTGILIETGLELGLGGLLQTLEREEA |
| Ga0335036_0005203_4073_4222 | 3300034106 | Freshwater | MNTMQDLINAIKPILPNALIIDTDSGILIETGLELGLGGLLQTIEREGE |
| Ga0335036_0234578_827_952 | 3300034106 | Freshwater | MQTMQDLIDLIKPILPNALIIDTGLELGLGGLLQTIEREGE |
| Ga0335049_0524907_610_747 | 3300034272 | Freshwater | MNTMQDLINAIKPILPNALIIDTDSGILIETGLELGLGGLLQTLER |
| ⦗Top⦘ |