| Basic Information | |
|---|---|
| Family ID | F072265 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGVT |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.12 % |
| % of genes near scaffold ends (potentially truncated) | 91.74 % |
| % of genes from short scaffolds (< 2000 bps) | 90.08 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.595 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (33.058 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.116 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.942 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.84% β-sheet: 0.00% Coil/Unstructured: 67.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF08448 | PAS_4 | 0.83 |
| PF03237 | Terminase_6N | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.60 % |
| All Organisms | root | All Organisms | 31.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000525|JGI1221J11331_1009659 | All Organisms → Viruses → Predicted Viral | 2637 | Open in IMG/M |
| 3300003277|JGI25908J49247_10150520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300003394|JGI25907J50239_1033105 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300003499|JGI25930J51415_1037529 | Not Available | 858 | Open in IMG/M |
| 3300004095|Ga0007829_10147084 | Not Available | 501 | Open in IMG/M |
| 3300004481|Ga0069718_10117176 | Not Available | 753 | Open in IMG/M |
| 3300005525|Ga0068877_10644310 | Not Available | 572 | Open in IMG/M |
| 3300005527|Ga0068876_10628159 | Not Available | 580 | Open in IMG/M |
| 3300005584|Ga0049082_10085617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
| 3300006111|Ga0007848_1081408 | Not Available | 601 | Open in IMG/M |
| 3300006802|Ga0070749_10366556 | Not Available | 799 | Open in IMG/M |
| 3300006875|Ga0075473_10255787 | Not Available | 708 | Open in IMG/M |
| 3300006875|Ga0075473_10340322 | Not Available | 607 | Open in IMG/M |
| 3300007973|Ga0105746_1171844 | Not Available | 735 | Open in IMG/M |
| 3300008110|Ga0114343_1226543 | Not Available | 518 | Open in IMG/M |
| 3300008114|Ga0114347_1274611 | Not Available | 500 | Open in IMG/M |
| 3300008116|Ga0114350_1166444 | Not Available | 589 | Open in IMG/M |
| 3300008266|Ga0114363_1148362 | Not Available | 781 | Open in IMG/M |
| 3300008448|Ga0114876_1130608 | Not Available | 948 | Open in IMG/M |
| 3300008448|Ga0114876_1267150 | Not Available | 515 | Open in IMG/M |
| 3300008450|Ga0114880_1191863 | Not Available | 694 | Open in IMG/M |
| 3300009160|Ga0114981_10781955 | Not Available | 503 | Open in IMG/M |
| 3300009180|Ga0114979_10419188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300009183|Ga0114974_10600101 | Not Available | 607 | Open in IMG/M |
| 3300009184|Ga0114976_10039211 | All Organisms → Viruses → Predicted Viral | 2826 | Open in IMG/M |
| 3300009419|Ga0114982_1203646 | Not Available | 613 | Open in IMG/M |
| 3300010354|Ga0129333_11277032 | Not Available | 607 | Open in IMG/M |
| 3300010354|Ga0129333_11701180 | Not Available | 513 | Open in IMG/M |
| 3300010370|Ga0129336_10128160 | Not Available | 1476 | Open in IMG/M |
| 3300011010|Ga0139557_1010448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1824 | Open in IMG/M |
| 3300012665|Ga0157210_1040678 | Not Available | 717 | Open in IMG/M |
| 3300012732|Ga0157549_1102775 | All Organisms → cellular organisms → Eukaryota | 563 | Open in IMG/M |
| 3300013004|Ga0164293_10688824 | Not Available | 656 | Open in IMG/M |
| 3300013006|Ga0164294_10946435 | Not Available | 579 | Open in IMG/M |
| 3300015050|Ga0181338_1013577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1314 | Open in IMG/M |
| 3300015050|Ga0181338_1066784 | Not Available | 513 | Open in IMG/M |
| 3300017700|Ga0181339_1013600 | Not Available | 938 | Open in IMG/M |
| 3300017701|Ga0181364_1012227 | Not Available | 1442 | Open in IMG/M |
| 3300017707|Ga0181363_1090371 | Not Available | 519 | Open in IMG/M |
| 3300017716|Ga0181350_1080902 | Not Available | 822 | Open in IMG/M |
| 3300017723|Ga0181362_1112683 | Not Available | 535 | Open in IMG/M |
| 3300017736|Ga0181365_1061043 | Not Available | 935 | Open in IMG/M |
| 3300017736|Ga0181365_1133253 | Not Available | 593 | Open in IMG/M |
| 3300017747|Ga0181352_1028335 | Not Available | 1702 | Open in IMG/M |
| 3300017747|Ga0181352_1079502 | Not Available | 918 | Open in IMG/M |
| 3300017747|Ga0181352_1129153 | Not Available | 678 | Open in IMG/M |
| 3300017747|Ga0181352_1199414 | Not Available | 515 | Open in IMG/M |
| 3300017754|Ga0181344_1025432 | Not Available | 1821 | Open in IMG/M |
| 3300017754|Ga0181344_1140622 | Not Available | 690 | Open in IMG/M |
| 3300017754|Ga0181344_1215393 | Not Available | 536 | Open in IMG/M |
| 3300017754|Ga0181344_1236798 | Not Available | 507 | Open in IMG/M |
| 3300017754|Ga0181344_1238888 | Not Available | 504 | Open in IMG/M |
| 3300017774|Ga0181358_1075467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
| 3300017777|Ga0181357_1048008 | Not Available | 1670 | Open in IMG/M |
| 3300017777|Ga0181357_1051971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1598 | Open in IMG/M |
| 3300017777|Ga0181357_1163574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
| 3300017780|Ga0181346_1127221 | Not Available | 971 | Open in IMG/M |
| 3300017780|Ga0181346_1203286 | Not Available | 713 | Open in IMG/M |
| 3300017784|Ga0181348_1142845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300017784|Ga0181348_1282782 | Not Available | 562 | Open in IMG/M |
| 3300017785|Ga0181355_1160060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300017785|Ga0181355_1173615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
| 3300017785|Ga0181355_1331783 | Not Available | 563 | Open in IMG/M |
| 3300018420|Ga0181563_10306834 | Not Available | 927 | Open in IMG/M |
| 3300018420|Ga0181563_10680304 | Not Available | 569 | Open in IMG/M |
| 3300019784|Ga0181359_1243342 | Not Available | 550 | Open in IMG/M |
| 3300020159|Ga0211734_11289534 | Not Available | 623 | Open in IMG/M |
| 3300020161|Ga0211726_10836175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300020161|Ga0211726_10978637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300020735|Ga0214219_1032537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300022173|Ga0181337_1028659 | Not Available | 744 | Open in IMG/M |
| 3300022190|Ga0181354_1086115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| 3300022752|Ga0214917_10246856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| 3300024558|Ga0255232_1057091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300025091|Ga0209616_1003248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2413 | Open in IMG/M |
| 3300025399|Ga0208107_1013408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1347 | Open in IMG/M |
| 3300025435|Ga0208618_1013998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1784 | Open in IMG/M |
| 3300025732|Ga0208784_1154945 | Not Available | 676 | Open in IMG/M |
| 3300025848|Ga0208005_1016136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2287 | Open in IMG/M |
| 3300025896|Ga0208916_10183058 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 905 | Open in IMG/M |
| 3300025896|Ga0208916_10513195 | Not Available | 522 | Open in IMG/M |
| 3300026455|Ga0255155_1074016 | Not Available | 558 | Open in IMG/M |
| 3300026565|Ga0256311_1149067 | Not Available | 503 | Open in IMG/M |
| 3300027130|Ga0255089_1025665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
| 3300027486|Ga0255086_1066078 | Not Available | 559 | Open in IMG/M |
| 3300027732|Ga0209442_1247223 | Not Available | 639 | Open in IMG/M |
| 3300027734|Ga0209087_1125908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
| 3300027754|Ga0209596_1305031 | Not Available | 631 | Open in IMG/M |
| 3300027759|Ga0209296_1222447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300027759|Ga0209296_1397587 | Not Available | 517 | Open in IMG/M |
| 3300027772|Ga0209768_10094010 | Not Available | 1486 | Open in IMG/M |
| 3300027782|Ga0209500_10130210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1208 | Open in IMG/M |
| 3300027793|Ga0209972_10261299 | Not Available | 777 | Open in IMG/M |
| 3300028393|Ga0304728_1046073 | Not Available | 1828 | Open in IMG/M |
| 3300031673|Ga0307377_10231421 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
| 3300031758|Ga0315907_11208186 | Not Available | 529 | Open in IMG/M |
| 3300031787|Ga0315900_10500399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300031873|Ga0315297_11254352 | Not Available | 606 | Open in IMG/M |
| 3300031951|Ga0315904_10579795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
| 3300031951|Ga0315904_10735866 | Not Available | 823 | Open in IMG/M |
| 3300031951|Ga0315904_10747604 | Not Available | 814 | Open in IMG/M |
| 3300031952|Ga0315294_11370089 | Not Available | 562 | Open in IMG/M |
| 3300031999|Ga0315274_10598456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
| 3300031999|Ga0315274_11241943 | Not Available | 733 | Open in IMG/M |
| 3300032046|Ga0315289_10780250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300032046|Ga0315289_10817183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300032092|Ga0315905_10320568 | Not Available | 1480 | Open in IMG/M |
| 3300032117|Ga0316218_1111004 | Not Available | 1063 | Open in IMG/M |
| 3300032722|Ga0316231_1003013 | Not Available | 15308 | Open in IMG/M |
| 3300034105|Ga0335035_0162674 | All Organisms → Viruses → Predicted Viral | 1399 | Open in IMG/M |
| 3300034112|Ga0335066_0344457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
| 3300034116|Ga0335068_0501996 | Not Available | 561 | Open in IMG/M |
| 3300034167|Ga0335017_0401900 | Not Available | 742 | Open in IMG/M |
| 3300034200|Ga0335065_0470040 | Not Available | 758 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 33.06% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.09% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.44% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.96% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.13% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 2.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.48% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.65% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.83% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.83% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.83% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.83% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000525 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006111 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012732 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES039 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300022173 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.D.D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024558 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025399 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025435 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
| 3300026565 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027130 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1221J11331_10096596 | 3300000525 | Hypersaline | MMDKKDTKQSKATAAAAVHKHERAMHKGQSMTKLAKGGKTNMQ |
| JGI25908J49247_101505202 | 3300003277 | Freshwater Lake | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGKTNEMM |
| JGI25907J50239_10331051 | 3300003394 | Freshwater Lake | MDKADLKQDKKMMAKAVHKHEKKLHPGKPMTKLAKGGPTS |
| JGI25930J51415_10375293 | 3300003499 | Freshwater Lake | MDKKDLAQDKKMIAGAVHKHEKALHKGKPMTKLKKGGVTS |
| Ga0007829_101470841 | 3300004095 | Freshwater | MMAKVDKEDIKQDKKMIATAIHKHEKHDHPGKPLTKLAKGGKTNANMLKYGR |
| Ga0069718_101171762 | 3300004481 | Sediment | MDKKDLKQDKATAAKAVHKHERAMHKGKPLTKMAKGGKTN |
| Ga0068877_106443101 | 3300005525 | Freshwater Lake | MNKSDLKQDKKMVASAVHKHESSMHPGKPKTKLAKGGGIKMRGT |
| Ga0068876_106281592 | 3300005527 | Freshwater Lake | MDKKDLKQDKATAAKAVHKHERAMHKGKPLTKMAKGGKT |
| Ga0049082_100856171 | 3300005584 | Freshwater Lentic | MNDMKQDKKMMAGAVHKHEKKLHPGKPMTKLAKGGKTN |
| Ga0007848_10814083 | 3300006111 | Freshwater | MAKVDKEDIKQDKKMIATAIHKHEKHDHPGKPLTKLAKGGKT |
| Ga0075471_104109163 | 3300006641 | Aqueous | MAEKHDKADIKADKKMVASAVHKHEKNMHPGKAVTKLKAGG |
| Ga0070749_103665561 | 3300006802 | Aqueous | MDKKDLAQDKKMIAGAVHKHEKAKHKGAPLTKLKKGGPP |
| Ga0075473_102557871 | 3300006875 | Aqueous | MDKKDLAQDKKTAAKAVHKHEKAMHPGKPMTKMRAGGKTNSDM |
| Ga0075473_103403223 | 3300006875 | Aqueous | MDKKDLAQDKKMVAGAVHKHERAKHKGQPLTKLKKGGPTGMDMRKM |
| Ga0105746_11718443 | 3300007973 | Estuary Water | MDKKDLAQDKKMVAGAVHKHEKKMHPGKPMTKLKAG |
| Ga0114343_12265431 | 3300008110 | Freshwater, Plankton | MDKKDLAQDKKMIAGAVHKHEKAKHKGAPLTKLKKGGPTG |
| Ga0114347_12746112 | 3300008114 | Freshwater, Plankton | MNKSDLKQDKKMVASAVHKHESSMHPGKPKTKLAKGGGIKMRGTG |
| Ga0114350_11664442 | 3300008116 | Freshwater, Plankton | MDKKDLKQDKAMVAKAVHKHERAKHKGQPMTKLAKGGKTNAQMGAMGRN |
| Ga0114337_10633055 | 3300008262 | Freshwater, Plankton | MDKADLKQDKKMVAGAVHKHEKKLHPGQPMTKLAKGGKTNLQMKKGG* |
| Ga0114363_11483621 | 3300008266 | Freshwater, Plankton | MMDKKDLAQDKRMIAGAVHKHERAKHKGAPLTKLKKGGPTGEMMRKM |
| Ga0114876_11306083 | 3300008448 | Freshwater Lake | MDKKDMKQDKKMVAGAVHKHEKKLHPGKPMTKLAKGGVTTDQM |
| Ga0114876_12671502 | 3300008448 | Freshwater Lake | MDKADLKQDKKMMAGAVHKHEKKMHPGKPMTKLAKGGKTNEMMKSM |
| Ga0114880_11918631 | 3300008450 | Freshwater Lake | MHKADMKQDKKMMAGAVHKHEKRLHPGKPMTKLAKGGKT |
| Ga0104242_10508873 | 3300008962 | Freshwater | MKDGMKQDKKIAGAIHKHEKHMHPGKSMTKLRKGGLTSEMMR |
| Ga0114981_107819551 | 3300009160 | Freshwater Lake | MDKADLKQDKKMIAGAVHKHEKRMHPGKPMTKLAKGGVTG |
| Ga0114979_104191883 | 3300009180 | Freshwater Lake | MDKADLKQDKKMIAGAVHKHEKRMHPGKPMTKLKKGGVTGDMMK |
| Ga0114974_106001012 | 3300009183 | Freshwater Lake | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGK |
| Ga0114976_100392111 | 3300009184 | Freshwater Lake | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGVTTDMMKSM |
| Ga0114982_12036461 | 3300009419 | Deep Subsurface | MDKKDLAQDKKMVAGAVHKHEKKMHPGKPMTKLKK |
| Ga0129333_112770322 | 3300010354 | Freshwater To Marine Saline Gradient | MDKKDLAQDKKMIAGAVHKHEKAKHPGKPLTKLAKGGKT |
| Ga0129333_117011802 | 3300010354 | Freshwater To Marine Saline Gradient | MMDKKDLAQDKKMIAGAVHKHERAKHKGAPLTKLKK |
| Ga0129336_101281604 | 3300010370 | Freshwater To Marine Saline Gradient | MDKKDLAQDKKMIAGAVHKHEKAKHKGQPLTKLAKGGKTNANML |
| Ga0133913_107292051 | 3300010885 | Freshwater Lake | MDKEDLKQDKAMISAAVHKHEANMHKGKPMTKLKSGGSV |
| Ga0139557_10104482 | 3300011010 | Freshwater | MNDMKQDKKMMAGAVHKHEKKLHPGKPMTKLAKGGKTXXX* |
| Ga0157210_10406781 | 3300012665 | Freshwater | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGVTSDMM |
| Ga0157549_11027752 | 3300012732 | Freshwater | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGVTTDMMKVCCNGR* |
| Ga0164293_106888241 | 3300013004 | Freshwater | MDKADKKQDKKMIANMVHTHEGKLHPGKPKTKFAKG |
| Ga0164294_109464352 | 3300013006 | Freshwater | MDKKDLKQDKKMIAGAVHKHEKRLHPGKPITKLAKGGKTNE |
| Ga0181338_10135773 | 3300015050 | Freshwater Lake | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGVT |
| Ga0181338_10667841 | 3300015050 | Freshwater Lake | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGKTNEMMMSMG |
| Ga0181339_10136001 | 3300017700 | Freshwater Lake | MDKKDMKQDKKMIAGAVHKHEKKLHPGKPMTKLAK |
| Ga0181364_10122271 | 3300017701 | Freshwater Lake | MDKKDLAQDKKMVAGAVHKHEKKLHPGQPMTKFAKGGKTNEQ |
| Ga0181363_10903712 | 3300017707 | Freshwater Lake | MDKKDLKQDKKMIASAVHKHEAKMHPGKPMTKLAKGGVTSANMKKYGR |
| Ga0181350_10809021 | 3300017716 | Freshwater Lake | MDKADLKQDKKMMAGAVHKHEKKLHLGQPMTKFAKGGKTNAHM |
| Ga0181362_11126832 | 3300017723 | Freshwater Lake | MDKKDLKQDKKMMAGAVHKHEKRLHPGKPMTKLAKGGKTN |
| Ga0181365_10610431 | 3300017736 | Freshwater Lake | MNDMKQDKKMVAGAVHKHEKKLHPGKPMTKLAKGGKTN |
| Ga0181365_11332531 | 3300017736 | Freshwater Lake | MDKADMKQDKKRMAGAVHKHKKRLHPGKTPTKFAKGGKTDMDMMKYG |
| Ga0181352_10283354 | 3300017747 | Freshwater Lake | MDKKDLAQDKKMVAGAVHKHEKKMHPGKPMTKLKAGG |
| Ga0181352_10795023 | 3300017747 | Freshwater Lake | MDKADLKQDKKMIASAVHKHEAKMHPGKPMTKLKKGGVTSM |
| Ga0181352_11291531 | 3300017747 | Freshwater Lake | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLKKGGVTGEMMKSMG |
| Ga0181352_11994142 | 3300017747 | Freshwater Lake | MDKADLKQDKKMIAGAVHKHEKKLHPGKPMTKLKKGGVTGEM |
| Ga0181344_10254325 | 3300017754 | Freshwater Lake | MDKADLKQDKKMMAGAVHKHEKKMHPGQPMTKLAKGGKTNLQMKQL |
| Ga0181344_11406221 | 3300017754 | Freshwater Lake | MDKKDLKQDKKMIASAVHKHEAKMHPGKPMTKLAKGGVTSANMK |
| Ga0181344_12153932 | 3300017754 | Freshwater Lake | MKHDDAKADMKMDKAQDKKMIKAAVGKHEKKLHPGQPMTKLAKGGKTNLQMKQL |
| Ga0181344_12367982 | 3300017754 | Freshwater Lake | MDKKDLAQDKKTAARAVHKHEAAMHPGKPMTKMRVGGKT |
| Ga0181344_12388882 | 3300017754 | Freshwater Lake | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLKKGGVTTDMM |
| Ga0181358_10754671 | 3300017774 | Freshwater Lake | MDKKDMKQDKKMVAGAVHKHEKRLHPGKSMTKLAKGGVTTDQMKAVG |
| Ga0181357_10480084 | 3300017777 | Freshwater Lake | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGVTTDQM |
| Ga0181357_10519711 | 3300017777 | Freshwater Lake | MDKADMKQDKKIIAGAVHKHEKKLHPGKPMTKLAKGGVTTDQMKAVGR |
| Ga0181357_11635741 | 3300017777 | Freshwater Lake | MDKADMKQDKKMMAGAVHKHEKRLHPGKPMTKLAKGG |
| Ga0181346_11272213 | 3300017780 | Freshwater Lake | MDKADLKQDKKMMAGAVHKHEKKLHPGQPMTKFAKGGK |
| Ga0181346_12032861 | 3300017780 | Freshwater Lake | MDKADLKQDKKMIAGAVHKHEKKLHPGKPMTKFAKGGKTN |
| Ga0181348_11428453 | 3300017784 | Freshwater Lake | MAKHDTKQDKKMITSAVHKHERSKHPGTPLTKMAKGG |
| Ga0181348_12827822 | 3300017784 | Freshwater Lake | MDKADLKQDKKMMAGAVHKHEKKLHPGKPMTKLAKGGKT |
| Ga0181355_11600603 | 3300017785 | Freshwater Lake | MNKADMKQDKKMMAGAVHKHEKKLHPGKPMTKLAKGG |
| Ga0181355_11736151 | 3300017785 | Freshwater Lake | MDKADKKQDKKMMAGAVNKHEKRMHPGKTPTKFAQGGKTDMDMMKY |
| Ga0181355_13317831 | 3300017785 | Freshwater Lake | MDKKDLKQDKKMVAGAVHKHEKALHPGKPMTKLKAGG |
| Ga0181563_103068343 | 3300018420 | Salt Marsh | MDKKDLAQDKKMIAGAVHKHEKKLHPGKPMTKLKAGG |
| Ga0181563_106803042 | 3300018420 | Salt Marsh | MDKKDLAQDKKMIAGAVHKHEKAKHKGQPLTKLAK |
| Ga0181359_12433422 | 3300019784 | Freshwater Lake | MNDMKQDKKMMAGAVHKHEKKLHPGKPMTKLAKGG |
| Ga0211734_112895343 | 3300020159 | Freshwater | MDKADLKQDKKMMAGAVHKHEKKLHPGKPMTKLAKGGKTN |
| Ga0211726_108361753 | 3300020161 | Freshwater | MDKKDLAQDKKMIAGAVHKHEKKLHPGKPMTKLRAGG |
| Ga0211726_109786371 | 3300020161 | Freshwater | MDKKDMKQDKAMIAGAVHKHEKAKHKGKPLTKLAKGGKTNAQMK |
| Ga0214219_10325373 | 3300020735 | Freshwater | MAKVDKEDIKQDKKMIAAAVHKHERHDHPGKPLTKL |
| Ga0181337_10286593 | 3300022173 | Freshwater Lake | MAKEKGKSDMAQDKAMVKKAVGKHEKRLHPGKSLTK |
| Ga0181354_10861153 | 3300022190 | Freshwater Lake | MDKADMKQDKKMVAGAVHKHEKRLHPGKPMTKLAKGGKTNEMI |
| Ga0214917_102468563 | 3300022752 | Freshwater | MDKADLKQDKKMIAGAVHKHEKKMHPGKPMTKLKKG |
| Ga0255232_10570913 | 3300024558 | Freshwater | MDKKDLAQDKKMVASAVHKHEARMHPGKAPTKLAKGGV |
| Ga0209616_10032481 | 3300025091 | Freshwater | MDKKDLKQDKKMVAGAVHKHEKALHPGKPMTKLRAGGKTNSDMLKM |
| Ga0208107_10134081 | 3300025399 | Freshwater | MAKVDKEDIKQDKKMIATAIHKHEKHDHPGKPLTKLAKGGK |
| Ga0208618_10139981 | 3300025435 | Freshwater | MAKVDKEDIKQDKKMIATAIHKHEKHDHPGKPLTKLAKGGKTNANMLKYG |
| Ga0208147_10615383 | 3300025635 | Aqueous | MDKKDLAQDKKMIGAAVHKHEARMHPGKAPTKLAKGGVTGK |
| Ga0208784_11549453 | 3300025732 | Aqueous | MDKKDLAQDKKMIAGAVHKHEKAKHKGQPLTKLKKGGPTGM |
| Ga0208005_10161366 | 3300025848 | Aqueous | MDKKDLKQDKKMIASAVHKHEAKMHPGKPMTKLAKGG |
| Ga0208916_101830583 | 3300025896 | Aqueous | MDKKDLAQDKKMVAGAVHKHERAKHKGQPLTKLKKGGPTGMD |
| Ga0208916_105131952 | 3300025896 | Aqueous | MDKKDLAQDKKMIAGAVHKHEKAKHKGQPLTKLAKG |
| Ga0255155_10740161 | 3300026455 | Freshwater | MDKADLKQDKKMIASAVHKHEKRMHPGKPVTKLKAGGKTNS |
| Ga0256311_11490672 | 3300026565 | Freshwater | MDKADLKQDKKMIASAVHKHEKNMHPGKAVTKLRAGG |
| Ga0255089_10256651 | 3300027130 | Freshwater | MDKKDLKQDKKMIASAVHKHEAKMHPGKPMTKLAK |
| Ga0255086_10660781 | 3300027486 | Freshwater | MDKKDLAQDKKTAARAVHKHEAAMHPGKPMTKMRAGGKTNSDMLKMGR |
| Ga0209442_12472231 | 3300027732 | Freshwater Lake | MDKADMKQDKKMMAGAVHKHEKRLHPGKPMTKLAKGGKTNEMMM |
| Ga0209087_11259083 | 3300027734 | Freshwater Lake | MDKADLKQDKKMMAGAVHKHEKAMHPGKPMTKLKKGGVTSMAMK |
| Ga0209596_13050312 | 3300027754 | Freshwater Lake | MAKESGKSDIKQDKAMIKAMIHKHEKKAHPGKPLTKLAKG |
| Ga0209296_12224471 | 3300027759 | Freshwater Lake | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPLTKLAK |
| Ga0209296_13975872 | 3300027759 | Freshwater Lake | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGG |
| Ga0209768_100940103 | 3300027772 | Freshwater Lake | MDKKDMKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGKT |
| Ga0209500_101302101 | 3300027782 | Freshwater Lake | MDKADLKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGVTT |
| Ga0209972_102612993 | 3300027793 | Freshwater Lake | MDKKDLAQDKKTAASAVHKHEKAMHPGKPMTKLAK |
| Ga0304728_10460735 | 3300028393 | Freshwater Lake | MAKESSKSDIKQDKAMIKAMVHKHEKHDHPGKPLTKLAKGGKTNMQM |
| Ga0307377_102314211 | 3300031673 | Soil | MDKADLKQDKKMIAGAVHKHEKSMHPGKPMTKLAKGGKTNEMM |
| Ga0315907_112081862 | 3300031758 | Freshwater | MDKADLKQDKKMMAGAVHKHEKRMHPGKPMTKFAKGGK |
| Ga0315900_105003991 | 3300031787 | Freshwater | MDKKDLKQDKKMIAGAVHKHEKKLHPGKPMTKLRAGG |
| Ga0315297_112543522 | 3300031873 | Sediment | MNKADMKQDKKMMAGAVHKHEKRLHPGKPMTKLAKGGKTNEMMMS |
| Ga0315904_105797951 | 3300031951 | Freshwater | MDKKDLAQDKKTAAKAVHKHEKAMHPGKPMTKMRAGG |
| Ga0315904_107358661 | 3300031951 | Freshwater | MDKKDLKQDKKMIAGAVHKHEKKLHPGQPMTKLKKGGTTSL |
| Ga0315904_107476041 | 3300031951 | Freshwater | MNDMKQDKKMVAGAVHKHEKKLHPGKPMTKLAKGGK |
| Ga0315294_113700892 | 3300031952 | Sediment | MNKADMKQDKKMMAGAVHEHEKKLHPGKPMTKLAK |
| Ga0315274_105984563 | 3300031999 | Sediment | MNKADMKQDKKMMAGAVHKHEKKLHPGKPMTKLAK |
| Ga0315274_112419431 | 3300031999 | Sediment | MDKADMKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGKTNEM |
| Ga0315289_107802503 | 3300032046 | Sediment | MDKADMKQDKKMIAGAVHKHEKKLHPGKPMTKLAKGGKTN |
| Ga0315289_108171833 | 3300032046 | Sediment | MDKADMKQDKKMMAGAVHKHEKSMHPGKPMTKFAKGGKTNMDMM |
| Ga0315905_103205681 | 3300032092 | Freshwater | MDKKDMKQDKATVAKAVHKHERAKHKGQPLTKLAKGGKTN |
| Ga0316218_11110041 | 3300032117 | Freshwater | MAKESSKSDIKQDKAMIKAMIHKHERHDHPGKPLTKFAKGGK |
| Ga0316231_100301325 | 3300032722 | Freshwater | MAKESSKSDIKQDKAMIKAMIHKHERHDHPGKPLTKFAK |
| Ga0335035_0162674_1_120 | 3300034105 | Freshwater | MDKADKKQDKKMIADMVHTHEGKLHPGKPKTKFAKGGKTD |
| Ga0335063_0128967_1361_1486 | 3300034111 | Freshwater | MADKDMAQDKATVHKAVHKHERAMHPGKPLTKMRKGGEVGC |
| Ga0335066_0344457_1_150 | 3300034112 | Freshwater | MDKKDMKQDKATAAKAVHKHERAMHKGKPLTKMAKGGKTNAQMGAMGRNL |
| Ga0335068_0501996_1_141 | 3300034116 | Freshwater | MDKKDLAQDKKTAASAVHKHEKAMHPGKPMTKLAKGGKTNLQMKQLG |
| Ga0335017_0401900_3_140 | 3300034167 | Freshwater | MDKADKKQDKKMIAGAVHKHEKRMHPGKTPTKFAHGGKTGEDMMKY |
| Ga0335065_0470040_631_756 | 3300034200 | Freshwater | MDKKDLKQDKATAAKAVHKHERAKHKGQPLTKLAKGGKTNMQ |
| Ga0335013_0606078_493_639 | 3300034284 | Freshwater | MMDKKDLAQDKKMVAGAVHKHEKAKHKGQPLTKLRKGGKTNAEMKTLGR |
| ⦗Top⦘ |