| Basic Information | |
|---|---|
| Family ID | F072229 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSRRTLTILITILFVLLAWAFFSSERGVAGTLEWIGGWISKLFD |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.51 % |
| % of genes near scaffold ends (potentially truncated) | 21.49 % |
| % of genes from short scaffolds (< 2000 bps) | 80.17 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (7.438 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.413 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (71.074 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 56.94% β-sheet: 0.00% Coil/Unstructured: 43.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF09594 | GT87 | 1.65 |
| PF00005 | ABC_tran | 1.65 |
| PF01757 | Acyl_transf_3 | 0.83 |
| PF05299 | Peptidase_M61 | 0.83 |
| PF04188 | Mannosyl_trans2 | 0.83 |
| PF01590 | GAF | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.83 |
| COG3975 | Predicted metalloprotease, contains C-terminal PDZ domain | General function prediction only [R] | 0.83 |
| COG5542 | Mannosyltransferase related to Gpi18 | Carbohydrate transport and metabolism [G] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c2388555 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2005 | Open in IMG/M |
| 3300001464|JGI12363J15224_100047 | All Organisms → cellular organisms → Bacteria | 27615 | Open in IMG/M |
| 3300002568|C688J35102_120551418 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1171 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10097222 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 536 | Open in IMG/M |
| 3300003203|JGI25406J46586_10015486 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 3214 | Open in IMG/M |
| 3300003324|soilH2_10032523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4079 | Open in IMG/M |
| 3300004156|Ga0062589_100549091 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 988 | Open in IMG/M |
| 3300004479|Ga0062595_101432670 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 632 | Open in IMG/M |
| 3300005289|Ga0065704_10062240 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 648 | Open in IMG/M |
| 3300005290|Ga0065712_10072281 | All Organisms → cellular organisms → Bacteria | 4779 | Open in IMG/M |
| 3300005290|Ga0065712_10390496 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 742 | Open in IMG/M |
| 3300005293|Ga0065715_10102838 | All Organisms → cellular organisms → Bacteria | 3081 | Open in IMG/M |
| 3300005293|Ga0065715_10135150 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1942 | Open in IMG/M |
| 3300005293|Ga0065715_10236408 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1215 | Open in IMG/M |
| 3300005331|Ga0070670_100000114 | All Organisms → cellular organisms → Bacteria | 75910 | Open in IMG/M |
| 3300005331|Ga0070670_100889772 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 807 | Open in IMG/M |
| 3300005331|Ga0070670_101296545 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 667 | Open in IMG/M |
| 3300005334|Ga0068869_100332502 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300005334|Ga0068869_100712581 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 857 | Open in IMG/M |
| 3300005334|Ga0068869_101697323 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 564 | Open in IMG/M |
| 3300005343|Ga0070687_100101279 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300005344|Ga0070661_101647916 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 543 | Open in IMG/M |
| 3300005345|Ga0070692_10506115 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 784 | Open in IMG/M |
| 3300005355|Ga0070671_100905374 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 771 | Open in IMG/M |
| 3300005438|Ga0070701_10474741 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 807 | Open in IMG/M |
| 3300005444|Ga0070694_101516275 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 567 | Open in IMG/M |
| 3300005466|Ga0070685_11588500 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 506 | Open in IMG/M |
| 3300005468|Ga0070707_100224362 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1830 | Open in IMG/M |
| 3300005530|Ga0070679_100367519 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1386 | Open in IMG/M |
| 3300005539|Ga0068853_102146832 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 542 | Open in IMG/M |
| 3300005545|Ga0070695_100182826 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1487 | Open in IMG/M |
| 3300005546|Ga0070696_100670022 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 843 | Open in IMG/M |
| 3300005547|Ga0070693_100153693 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300005549|Ga0070704_100421768 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300005564|Ga0070664_100515113 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1104 | Open in IMG/M |
| 3300005564|Ga0070664_101795450 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 582 | Open in IMG/M |
| 3300005577|Ga0068857_100139402 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300005577|Ga0068857_102420124 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 516 | Open in IMG/M |
| 3300005578|Ga0068854_100682919 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 885 | Open in IMG/M |
| 3300005615|Ga0070702_100918214 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 687 | Open in IMG/M |
| 3300005617|Ga0068859_100216800 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2001 | Open in IMG/M |
| 3300005618|Ga0068864_101940213 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 595 | Open in IMG/M |
| 3300005841|Ga0068863_101352511 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 719 | Open in IMG/M |
| 3300005875|Ga0075293_1006444 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1241 | Open in IMG/M |
| 3300005875|Ga0075293_1031832 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 710 | Open in IMG/M |
| 3300005878|Ga0075297_1016259 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 766 | Open in IMG/M |
| 3300006755|Ga0079222_10097418 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300006755|Ga0079222_10414972 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 944 | Open in IMG/M |
| 3300006804|Ga0079221_10807553 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 673 | Open in IMG/M |
| 3300006852|Ga0075433_10862578 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 790 | Open in IMG/M |
| 3300006904|Ga0075424_102303172 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 566 | Open in IMG/M |
| 3300006954|Ga0079219_10019159 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300007076|Ga0075435_101007704 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 727 | Open in IMG/M |
| 3300009093|Ga0105240_11965269 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 608 | Open in IMG/M |
| 3300009098|Ga0105245_10499221 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1233 | Open in IMG/M |
| 3300009098|Ga0105245_11263346 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 787 | Open in IMG/M |
| 3300009176|Ga0105242_10030629 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 4296 | Open in IMG/M |
| 3300009177|Ga0105248_12307750 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 613 | Open in IMG/M |
| 3300009545|Ga0105237_10211027 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1942 | Open in IMG/M |
| 3300010037|Ga0126304_10059528 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2339 | Open in IMG/M |
| 3300010038|Ga0126315_10086915 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1771 | Open in IMG/M |
| 3300010038|Ga0126315_11162725 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 523 | Open in IMG/M |
| 3300010040|Ga0126308_10201363 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1279 | Open in IMG/M |
| 3300010041|Ga0126312_11457733 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 507 | Open in IMG/M |
| 3300010042|Ga0126314_10046635 | All Organisms → cellular organisms → Bacteria | 2796 | Open in IMG/M |
| 3300010044|Ga0126310_10018817 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 3415 | Open in IMG/M |
| 3300010044|Ga0126310_10778973 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 733 | Open in IMG/M |
| 3300010044|Ga0126310_10795930 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 726 | Open in IMG/M |
| 3300010047|Ga0126382_12256005 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 525 | Open in IMG/M |
| 3300010396|Ga0134126_10731815 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1122 | Open in IMG/M |
| 3300010399|Ga0134127_10970273 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 909 | Open in IMG/M |
| 3300010399|Ga0134127_12161782 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 635 | Open in IMG/M |
| 3300010400|Ga0134122_12625927 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 555 | Open in IMG/M |
| 3300012212|Ga0150985_110831059 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1101 | Open in IMG/M |
| 3300013100|Ga0157373_10018380 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 5090 | Open in IMG/M |
| 3300013297|Ga0157378_12692214 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 550 | Open in IMG/M |
| 3300013306|Ga0163162_11014244 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 939 | Open in IMG/M |
| 3300013306|Ga0163162_11629799 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 736 | Open in IMG/M |
| 3300014325|Ga0163163_11745380 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 683 | Open in IMG/M |
| 3300015374|Ga0132255_105588889 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 532 | Open in IMG/M |
| 3300018476|Ga0190274_10380207 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1359 | Open in IMG/M |
| 3300025900|Ga0207710_10001283 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 12696 | Open in IMG/M |
| 3300025900|Ga0207710_10701127 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 531 | Open in IMG/M |
| 3300025903|Ga0207680_11282072 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 521 | Open in IMG/M |
| 3300025911|Ga0207654_10037570 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2712 | Open in IMG/M |
| 3300025911|Ga0207654_10068232 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2103 | Open in IMG/M |
| 3300025911|Ga0207654_10442587 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 910 | Open in IMG/M |
| 3300025913|Ga0207695_10911195 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 759 | Open in IMG/M |
| 3300025918|Ga0207662_10195070 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1308 | Open in IMG/M |
| 3300025918|Ga0207662_10773209 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 676 | Open in IMG/M |
| 3300025919|Ga0207657_10732026 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 767 | Open in IMG/M |
| 3300025920|Ga0207649_11397599 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 554 | Open in IMG/M |
| 3300025923|Ga0207681_10039783 | All Organisms → cellular organisms → Bacteria | 3124 | Open in IMG/M |
| 3300025925|Ga0207650_10000022 | All Organisms → cellular organisms → Bacteria | 318878 | Open in IMG/M |
| 3300025925|Ga0207650_10524699 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 991 | Open in IMG/M |
| 3300025927|Ga0207687_11374305 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 607 | Open in IMG/M |
| 3300025930|Ga0207701_10244236 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1568 | Open in IMG/M |
| 3300025933|Ga0207706_10404461 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1183 | Open in IMG/M |
| 3300025935|Ga0207709_10068050 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300025935|Ga0207709_10523996 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 928 | Open in IMG/M |
| 3300025938|Ga0207704_10914688 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 738 | Open in IMG/M |
| 3300025941|Ga0207711_10560603 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1066 | Open in IMG/M |
| 3300025941|Ga0207711_10639715 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 992 | Open in IMG/M |
| 3300025941|Ga0207711_12047084 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 515 | Open in IMG/M |
| 3300025961|Ga0207712_10785191 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 836 | Open in IMG/M |
| 3300025981|Ga0207640_10685445 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 877 | Open in IMG/M |
| 3300025981|Ga0207640_11639601 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 580 | Open in IMG/M |
| 3300026005|Ga0208285_1000587 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1661 | Open in IMG/M |
| 3300026035|Ga0207703_11487288 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 652 | Open in IMG/M |
| 3300026041|Ga0207639_10692746 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 945 | Open in IMG/M |
| 3300026095|Ga0207676_10963261 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 839 | Open in IMG/M |
| 3300026116|Ga0207674_10045025 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 4541 | Open in IMG/M |
| 3300026116|Ga0207674_10141524 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2365 | Open in IMG/M |
| 3300027514|Ga0208338_1000012 | All Organisms → cellular organisms → Bacteria | 99281 | Open in IMG/M |
| 3300027718|Ga0209795_10138643 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 688 | Open in IMG/M |
| 3300027775|Ga0209177_10063871 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1081 | Open in IMG/M |
| 3300028380|Ga0268265_11852334 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 610 | Open in IMG/M |
| 3300028381|Ga0268264_11504449 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 684 | Open in IMG/M |
| 3300030511|Ga0268241_10084148 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 721 | Open in IMG/M |
| 3300031548|Ga0307408_101485339 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 640 | Open in IMG/M |
| 3300033412|Ga0310810_11407286 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 532 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 7.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 7.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.13% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.31% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.31% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001464 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027514 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_23885552 | 3300000033 | Soil | MSRRTLTILITIXFILLAWAFFSSEGGVAGVLEKIGGWISKLWS* |
| JGI12363J15224_1000474 | 3300001464 | Soil | MSRRTLTILIVVLFILLALAFLSSEGGVAGALEWIGGWISKLFD* |
| C688J35102_1205514181 | 3300002568 | Soil | MSRRTLTILITLLFVLLALAVFSSERGVAGVLEQIGAVISKFFD* |
| JGIcombinedJ43975_100972222 | 3300002899 | Soil | MSRRTLTILITILFVLLAWAFFASDRGVAGTLEQIGGWISKLWS* |
| JGI25406J46586_100154863 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MSRRTLTILITVLFVVLAWAFFTSERGVAGVLESIGATISKLFD* |
| soilH2_100325233 | 3300003324 | Sugarcane Root And Bulk Soil | MSRKTLTVLITILFVLLALTFFSSERGVAGVLEQIGAAISKLFD* |
| Ga0062589_1005490912 | 3300004156 | Soil | MSRKALTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFA* |
| Ga0062595_1014326702 | 3300004479 | Soil | VSRRTLTVIITILFILLAWTFFASDRGVLDVLERMGAAISKLFD* |
| Ga0065704_100622402 | 3300005289 | Switchgrass Rhizosphere | MSRRTLTVLITLLFVLLAWAFFTSERGVAGVLESIGGTLSKLFD* |
| Ga0065712_100722812 | 3300005290 | Miscanthus Rhizosphere | MSRKTLTILITILFILLVWVFFASERGIAGTLEQIGGWISKLFD* |
| Ga0065712_103904961 | 3300005290 | Miscanthus Rhizosphere | MSRRTLTILITLLFILLAWAFFTSERGVAGVLESIGATISKLFD* |
| Ga0065715_101028383 | 3300005293 | Miscanthus Rhizosphere | MSRKTLTVLITLLFVILALAVFSSERGVAGVLETIGGAISKLFD* |
| Ga0065715_101351502 | 3300005293 | Miscanthus Rhizosphere | MSRKTLTILITILFILLVWVFFASERGIAGTLEQIGGWISKLFA* |
| Ga0065715_102364082 | 3300005293 | Miscanthus Rhizosphere | VSRRTLTILITILFILLAWTFFASDRGLVDVLERIGAAISKLFD* |
| Ga0070670_10000011439 | 3300005331 | Switchgrass Rhizosphere | MSRRTLTILITILFILLAWAFFSSERGVAGTLEEIGGWISKLWS* |
| Ga0070670_1008897721 | 3300005331 | Switchgrass Rhizosphere | MSRRTLTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFA* |
| Ga0070670_1012965452 | 3300005331 | Switchgrass Rhizosphere | MSRRTLTILITILFVVLVWTFFASERGVAGVLESIGAAISKLFA* |
| Ga0068869_1003325022 | 3300005334 | Miscanthus Rhizosphere | MSRRTLTILITILLILLAWAFFSPERGVAGALEQIGGWISKLFS* |
| Ga0068869_1007125812 | 3300005334 | Miscanthus Rhizosphere | MSRRTLTILITILFVLLVWAFFSSERGVAGTLEQVGGWISKLFS* |
| Ga0068869_1016973232 | 3300005334 | Miscanthus Rhizosphere | VSRRTLTILITLLFILLAWTFFSSDRGLIGVLEWLGAAISKLFD* |
| Ga0070687_1001012792 | 3300005343 | Switchgrass Rhizosphere | MSRRTLTILIVILFVLLAWAFFTSERGVAGALEQIGAVISRLFD* |
| Ga0070661_1016479162 | 3300005344 | Corn Rhizosphere | MSRKTLTILITILFLLLVWVFFASERGIAGTLELIGSWISKLFA* |
| Ga0070692_105061151 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | TLTILITILFILLAWTFFASDRGLVDVLERIGAAISKLFD* |
| Ga0070671_1009053742 | 3300005355 | Switchgrass Rhizosphere | MSRRTLTILIVVLFILLAFTFFSSEGGVAGTLERIGGWISKLFD* |
| Ga0070701_104747411 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRTLTILITVLFVVLAWAFFTSERGVAGVLESIGATISKLFA* |
| Ga0070694_1015162752 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRTLTILITLLFVLLAFAVFTSERGVAGVLEQIGAVISKFFD* |
| Ga0070685_115885001 | 3300005466 | Switchgrass Rhizosphere | TLTILITILFVLLAWAFFSSERGVAGTLEKIGGWISKLFD* |
| Ga0070707_1002243622 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRKSLTVLIALLFVVLAFAVFSSERGVAGVLETIGGAISKLFE* |
| Ga0070679_1003675191 | 3300005530 | Corn Rhizosphere | RCEESLELMSRKSLTVLIALLFVVLAFAVFSSERGVAGVLETIGGAISKLFE* |
| Ga0068853_1021468321 | 3300005539 | Corn Rhizosphere | EALMSRRTLTILITILFILLAWALFVSERGLAGVLEQIGGWISKLFD* |
| Ga0070695_1001828262 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRKALTVLICLLFAVLAFAVFSSERGVAGVLEKIGGAISRLLGN* |
| Ga0070696_1006700222 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRKTLTILITILFGLLVWTFLASERGVAGTLEWIGAAISKLFA* |
| Ga0070693_1001536932 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRTLTILMVLLFALLVWVLFVSERGLIGVLEEIGALIAKLFN* |
| Ga0070704_1004217682 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRTLTILITILLIMLAWAFFASERGVAGTLERIGGWISKLFT* |
| Ga0070664_1005151132 | 3300005564 | Corn Rhizosphere | MSRKTLTILITILFVLLVWTFFASERGVAGTLEWIGGAISKLFA* |
| Ga0070664_1017954502 | 3300005564 | Corn Rhizosphere | MSRRTLTILITILFVLLVWTFFASERGVAGVLESIGAAISKLFA* |
| Ga0068857_1001394022 | 3300005577 | Corn Rhizosphere | MSRRTLTILITVLFVLLAWAFFTSERGVAGVLESIGATISKLFA* |
| Ga0068857_1024201241 | 3300005577 | Corn Rhizosphere | RRTLTVLITLLFVLLALAVFSSERGVAGVLQSIGAMLSKLFD* |
| Ga0068854_1006829191 | 3300005578 | Corn Rhizosphere | MSRRTLTILITILFILLAWAFFSPERGVAGALEQIGGWISKLFS* |
| Ga0070702_1009182142 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | TLTILIVVLFILLAFTFFSSERGVAGTLEWIGGWISKLFD* |
| Ga0068859_1002168003 | 3300005617 | Switchgrass Rhizosphere | MSRKTLTILITILFILLVWVFFASERGIAGTLEQIGGWISKLWS* |
| Ga0068864_1019402131 | 3300005618 | Switchgrass Rhizosphere | WEALMSRRTLTILITILFILLAWAFFSSEGGVAGVLEKIGGWISKLFSYI* |
| Ga0068863_1013525111 | 3300005841 | Switchgrass Rhizosphere | MSRRTLTILITILFILLAWAFFSSERGVAGTLEWIGGWISKLFD* |
| Ga0075293_10064442 | 3300005875 | Rice Paddy Soil | MSRRTLTILITILFVLLAWALFTSERGVAGVLEQIGSVLSKLFV* |
| Ga0075293_10318321 | 3300005875 | Rice Paddy Soil | MRFMSRRTLTILITLLFVLLALAVYSSERGVAGVLEQIGAVISKFFD* |
| Ga0075297_10162591 | 3300005878 | Rice Paddy Soil | MSRRTLTILITILFVLLAWALFTSERGVAGVLEQIGSVLS |
| Ga0079222_100974182 | 3300006755 | Agricultural Soil | MSRRTLTVLIVILFALLVWMLFVSERGLTGVLEQIGALISKLFN* |
| Ga0079222_104149721 | 3300006755 | Agricultural Soil | MSRKTLTILITILFILLAWVFFASERGIAGTLEQIGSWISKLFS* |
| Ga0079221_108075531 | 3300006804 | Agricultural Soil | RTLTILITLLFVLLALAFFSSERGVAGVLEQIGAVISKLFD* |
| Ga0075433_108625782 | 3300006852 | Populus Rhizosphere | MMSRKTLTVLIALLFAVLAFAVFSSERGVAGVLEKMGGAISK |
| Ga0075424_1023031721 | 3300006904 | Populus Rhizosphere | KTLTVLITLLLIVLAFAVFSSERGVTGVLEKIGAAISKLLGN* |
| Ga0079219_100191592 | 3300006954 | Agricultural Soil | MSRRTLTVLIMILFALLVWVLFVSERGLTGVLEQIGALISKLFN* |
| Ga0075435_1010077042 | 3300007076 | Populus Rhizosphere | LTVLITLLLIVLAFAVFSSERGVTGVLEKIGAAISKLLGN* |
| Ga0105240_119652692 | 3300009093 | Corn Rhizosphere | MSRKALTILITILFVLLAWAFFTSERGVAGVLELIGATISKLFA* |
| Ga0105245_104992211 | 3300009098 | Miscanthus Rhizosphere | KALTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFA* |
| Ga0105245_112633461 | 3300009098 | Miscanthus Rhizosphere | RTLTILITILLILLAWAFFSPERGVAGALEQIGGWISKLFS* |
| Ga0105242_100306293 | 3300009176 | Miscanthus Rhizosphere | MSRRTLTILITILLVLLAWAFFSSERGVAGALEQIGGWISKLFS* |
| Ga0105248_123077501 | 3300009177 | Switchgrass Rhizosphere | MSRRTLTILITLLFVLLAFAVFTSERGVAGVLEQI |
| Ga0105237_102110272 | 3300009545 | Corn Rhizosphere | MSRKTLTILITILFILLVWVFFASERGIAGTLELIGSWISKLFA* |
| Ga0126304_100595283 | 3300010037 | Serpentine Soil | MSRRTLTILIAVLIILLALALFTSERDVAGVLEQIGSLLSKLFD* |
| Ga0126315_100869152 | 3300010038 | Serpentine Soil | MSRRTLTVLITILFVLLGLAVLSSERGVAGVLESIGRTISKLFD* |
| Ga0126315_111627252 | 3300010038 | Serpentine Soil | MSRRTLTILILVLFILLALTFLSSEGGVAGALEKIGGWISKLFD* |
| Ga0126308_102013631 | 3300010040 | Serpentine Soil | MSRRTLTILIAVLFILLALALFTSERDVAGVLEQIGSVLSKLFD* |
| Ga0126312_114577332 | 3300010041 | Serpentine Soil | MSRKTLTILITLLFVLLALAFFSDERGVAGVLEKIGGTISKLFD* |
| Ga0126314_100466353 | 3300010042 | Serpentine Soil | MSRRTLTILIVVLFILLALTFLSSEGGVAGALEKIGGWISKLFD* |
| Ga0126310_100188173 | 3300010044 | Serpentine Soil | MSRRTLTILIAVLFILLALALFTSERDVAGVLEYIGSVLSRLFN* |
| Ga0126310_107789732 | 3300010044 | Serpentine Soil | MSRRTLTILIALLFIALAFAVFASERGVSGVLEKIGTYISRLVD* |
| Ga0126310_107959302 | 3300010044 | Serpentine Soil | MSRRTLTILITILFGLLALALFSSERGVAGVLETIGKTISKLFDYL* |
| Ga0126382_122560051 | 3300010047 | Tropical Forest Soil | MSRKGLTVLITLLFVVLAFAVFSSERGVAGVLEKIGGAISKLLGN* |
| Ga0134126_107318152 | 3300010396 | Terrestrial Soil | MSRRTLTILIVVLFALLVWVLFVSERGLIGVLEEIGALIAKLFN* |
| Ga0134127_109702732 | 3300010399 | Terrestrial Soil | MLSINAMSRKTLTVAIILLFVILAFAVFSSERGVAGVLEKIGGAISKLFD* |
| Ga0134127_121617821 | 3300010399 | Terrestrial Soil | MSRRTLTILIVILFALLAWAFFSSERGVAGVLEQIGAVISKLFD* |
| Ga0134122_126259272 | 3300010400 | Terrestrial Soil | SRRTLTILITVLFVLLAWAFFTSERGVAGVLESIGATISKLFA* |
| Ga0150985_1108310592 | 3300012212 | Avena Fatua Rhizosphere | MSRKTLTIIITILFILLVWVFFASERGIAGTLELIGSWISKLFA* |
| Ga0157373_100183802 | 3300013100 | Corn Rhizosphere | MSRRTLTILIVVLFALLVWVLFVSERGLIGVLEQIGALIAKLFD* |
| Ga0157378_126922141 | 3300013297 | Miscanthus Rhizosphere | MSRRTLTNLIVILFVLLAWAFFTSERGVAGALEQIGAVISRLFD* |
| Ga0163162_110142442 | 3300013306 | Switchgrass Rhizosphere | MSRRTLTILITLLFVLLALAFFSSERGVAGVLEQI |
| Ga0163162_116297991 | 3300013306 | Switchgrass Rhizosphere | VSRRTLTILITILFILLAWTFFSSDRGLIGVLEWLGAAISKLFD* |
| Ga0163163_117453802 | 3300014325 | Switchgrass Rhizosphere | MSRRTLTILIAILFILLAWAFFSSEGGVAGALEWIGGWISKLFD* |
| Ga0132255_1055888891 | 3300015374 | Arabidopsis Rhizosphere | MSRKALTVLITLLFLVLAFAVFSSERGVAGVLEKIGGAISKLLGN* |
| Ga0190274_103802073 | 3300018476 | Soil | MSRRTLTILIALLFALLALAVFSSERGVAGVLEQIGGALSKFFDKYGTRG |
| Ga0207710_100012838 | 3300025900 | Switchgrass Rhizosphere | MSRKTLTILITILFILLVWVFFASERGIAGTLEQIGGWISKLFA |
| Ga0207710_107011272 | 3300025900 | Switchgrass Rhizosphere | SRRTLTILITLLFVLLALAVFSSERGVAGVLEQIGAVISKFFD |
| Ga0207680_112820722 | 3300025903 | Switchgrass Rhizosphere | MSRRTLTILITILFVLLAWAFFASDRGVAGTLEQIGGWISKLFD |
| Ga0207654_100375703 | 3300025911 | Corn Rhizosphere | MSRRTLTILITILLVLLAWAFFSSERGVAGALEQIGGWISKLFS |
| Ga0207654_100682322 | 3300025911 | Corn Rhizosphere | MSRKSLTVLIALLFVVLAFAVFSSERGVAGVLETIGGAISKLFE |
| Ga0207654_104425871 | 3300025911 | Corn Rhizosphere | MSRRTLTILITVLFVLLAWAFFTSERGVAGVLESIGATISKLF |
| Ga0207695_109111952 | 3300025913 | Corn Rhizosphere | MSRKTLTILITILFGLLVWTFLASERGVAGTLEWIGAAISKLFA |
| Ga0207662_101950702 | 3300025918 | Switchgrass Rhizosphere | MSRRTLTILIVILFVLLAWAFFTSERGVAGALEQIGAVISRLFD |
| Ga0207662_107732092 | 3300025918 | Switchgrass Rhizosphere | MSRRTLTILITVLFVVLAWAFFTSERGVAGVLESIGATISKLFD |
| Ga0207657_107320263 | 3300025919 | Corn Rhizosphere | MSRRTLTILITLLFVLLALAVFSSERGVAGVLEQIGAVISKFFD |
| Ga0207649_113975992 | 3300025920 | Corn Rhizosphere | MSRKTLTILITILFLLLVWVFFASERGIAGTLELIGSWISKLFA |
| Ga0207681_100397833 | 3300025923 | Switchgrass Rhizosphere | MSRRTLTILITILFILLAWAFFSPERGVAGALEQIGGWISKLFS |
| Ga0207650_10000022174 | 3300025925 | Switchgrass Rhizosphere | MSRRTLTILITILFILLAWAFFSSERGVAGTLEEIGGWISKLWS |
| Ga0207650_105246992 | 3300025925 | Switchgrass Rhizosphere | MSRRTLTVLITLLFVLLALAVFSSERGVAGVLQSIGAMLSKLFD |
| Ga0207687_113743052 | 3300025927 | Miscanthus Rhizosphere | MSRRTLTILITILLVLLAWAFFSSERGVAGVLEQIGGWISKLFT |
| Ga0207701_102442363 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRTLTILITILFVLLAWAFFSSERGVAGTLEWIGGWISKLFD |
| Ga0207706_104044612 | 3300025933 | Corn Rhizosphere | MSRKTLTILITILFILLVWVFFASERGIAGTLELIGSWISKLFA |
| Ga0207709_100680502 | 3300025935 | Miscanthus Rhizosphere | MSRKALTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFA |
| Ga0207709_105239961 | 3300025935 | Miscanthus Rhizosphere | MSRKALTVLICLLFAVLAFAVFSSERGVAGVLEKIGGAISRLL |
| Ga0207704_109146882 | 3300025938 | Miscanthus Rhizosphere | MSRRTLTILITILFVLLAWAFFSSERGVAGTLEKI |
| Ga0207711_105606032 | 3300025941 | Switchgrass Rhizosphere | MSRKTLTILITILFILLVWVFFASERGIAGTLEQIGGWISKLFD |
| Ga0207711_106397152 | 3300025941 | Switchgrass Rhizosphere | MSRRTLTILITILFILLAWAFFSSERGVAGTLEWIGGWISKLFD |
| Ga0207711_120470842 | 3300025941 | Switchgrass Rhizosphere | MSRRTLTILITLFFILLALTFFSSERGVAGVLEQIGA |
| Ga0207712_107851912 | 3300025961 | Switchgrass Rhizosphere | MSRRTLTILITLLFVLLAWAFFTSERGVAGVLESIGATISKLFD |
| Ga0207640_106854452 | 3300025981 | Corn Rhizosphere | MSRRTLTILMVLLFALLVWVLFVSERGLIGVLEEIGALIAKLFN |
| Ga0207640_116396012 | 3300025981 | Corn Rhizosphere | MSRKTLTILITILFLLLVWVFFASERGIAGTLELIGGWISKLFA |
| Ga0208285_10005873 | 3300026005 | Rice Paddy Soil | MSRRTLTILITILFVLLAWALFTSERGVAGVLEQIG |
| Ga0207703_114872882 | 3300026035 | Switchgrass Rhizosphere | MSRKALTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFD |
| Ga0207639_106927462 | 3300026041 | Corn Rhizosphere | MSRKTLTILITILFILLVWVFFASERGIAGTLELIGS |
| Ga0207676_109632612 | 3300026095 | Switchgrass Rhizosphere | MSRRTLTILITILFILLAWAFFSSEGGVAGVLEKIGGWISKLFSYI |
| Ga0207674_100450252 | 3300026116 | Corn Rhizosphere | MSRRTLTILITLLFILLAWAFFTSERGVAGVLESIGATISKLFD |
| Ga0207674_101415243 | 3300026116 | Corn Rhizosphere | MSRKTLTILITILFVLLVWTFFASERGVAGTLEWIGGAISKLFA |
| Ga0208338_100001232 | 3300027514 | Soil | MSRRTLTILIVVLFILLALAFLSSEGGVAGALEWIGGWISKLFD |
| Ga0209795_101386432 | 3300027718 | Agave | ITLLFVLLALAIFSSERGVQGVLEKIGDVISKLFV |
| Ga0209177_100638712 | 3300027775 | Agricultural Soil | MSRRTLTVLIMILFALLVWVLFVSERGLTGVLEQIGALISKLFN |
| Ga0268265_118523342 | 3300028380 | Switchgrass Rhizosphere | MSRRTLTILIVVLFILLALAFLSSERGVAGTLEWIGGWI |
| Ga0268264_115044492 | 3300028381 | Switchgrass Rhizosphere | MSRRTLTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFD |
| Ga0268241_100841482 | 3300030511 | Soil | MSRRTLTILIVLFFVLLALAIFSSERGIAGVLEQIGALISKLFD |
| Ga0307408_1014853392 | 3300031548 | Rhizosphere | MSRRTLTVLITLLFILLALAVLSSERGVAGVLEWIGATLSKLFD |
| Ga0310810_114072862 | 3300033412 | Soil | MSRRTLTILIVVLFILLAFAFFSSEGGVAGTLEWIGGWISKLFD |
| ⦗Top⦘ |