| Basic Information | |
|---|---|
| Family ID | F072219 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSGTVSRGREAGQQAEALAAAEARGSRGRGRWVALGIVVVVAAGA |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.29 % |
| % of genes near scaffold ends (potentially truncated) | 96.69 % |
| % of genes from short scaffolds (< 2000 bps) | 90.08 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.860 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.446 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.446 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.934 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 5.79 |
| PF00672 | HAMP | 2.48 |
| PF00486 | Trans_reg_C | 2.48 |
| PF02518 | HATPase_c | 1.65 |
| PF01740 | STAS | 0.83 |
| PF13581 | HATPase_c_2 | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.86 % |
| Unclassified | root | N/A | 23.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100310073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 705 | Open in IMG/M |
| 3300001661|JGI12053J15887_10417119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 644 | Open in IMG/M |
| 3300001661|JGI12053J15887_10555399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300002917|JGI25616J43925_10305528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
| 3300004091|Ga0062387_100595930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 791 | Open in IMG/M |
| 3300004092|Ga0062389_102411108 | Not Available | 696 | Open in IMG/M |
| 3300004092|Ga0062389_103015703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 630 | Open in IMG/M |
| 3300005093|Ga0062594_102981545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 528 | Open in IMG/M |
| 3300005332|Ga0066388_100407270 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300005434|Ga0070709_11297228 | Not Available | 587 | Open in IMG/M |
| 3300005436|Ga0070713_100553042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1090 | Open in IMG/M |
| 3300005437|Ga0070710_11465793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300005602|Ga0070762_10298342 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300005602|Ga0070762_10565128 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005764|Ga0066903_105265401 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005764|Ga0066903_108041982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 541 | Open in IMG/M |
| 3300006755|Ga0079222_10710244 | Not Available | 798 | Open in IMG/M |
| 3300006796|Ga0066665_10410648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1118 | Open in IMG/M |
| 3300006806|Ga0079220_10114621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1425 | Open in IMG/M |
| 3300009038|Ga0099829_10660639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 869 | Open in IMG/M |
| 3300009038|Ga0099829_10825008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 770 | Open in IMG/M |
| 3300009088|Ga0099830_10695739 | Not Available | 837 | Open in IMG/M |
| 3300009090|Ga0099827_10305958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1345 | Open in IMG/M |
| 3300009143|Ga0099792_10262326 | Not Available | 1010 | Open in IMG/M |
| 3300009177|Ga0105248_11049524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 921 | Open in IMG/M |
| 3300009520|Ga0116214_1116913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 984 | Open in IMG/M |
| 3300009553|Ga0105249_12319064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 609 | Open in IMG/M |
| 3300009792|Ga0126374_11402745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
| 3300010048|Ga0126373_12335348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 595 | Open in IMG/M |
| 3300010333|Ga0134080_10665984 | Not Available | 513 | Open in IMG/M |
| 3300010358|Ga0126370_11463788 | Not Available | 648 | Open in IMG/M |
| 3300010360|Ga0126372_11980310 | Not Available | 629 | Open in IMG/M |
| 3300010361|Ga0126378_12353214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 608 | Open in IMG/M |
| 3300010376|Ga0126381_100239015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus | 2453 | Open in IMG/M |
| 3300010376|Ga0126381_101089036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1154 | Open in IMG/M |
| 3300010376|Ga0126381_104752416 | Not Available | 523 | Open in IMG/M |
| 3300010880|Ga0126350_11392519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 790 | Open in IMG/M |
| 3300010880|Ga0126350_12148659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1978 | Open in IMG/M |
| 3300011271|Ga0137393_10903089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 754 | Open in IMG/M |
| 3300012205|Ga0137362_10166255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1892 | Open in IMG/M |
| 3300012209|Ga0137379_10974228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 753 | Open in IMG/M |
| 3300012209|Ga0137379_11342343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 620 | Open in IMG/M |
| 3300012210|Ga0137378_11336666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 632 | Open in IMG/M |
| 3300012211|Ga0137377_10268027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1639 | Open in IMG/M |
| 3300012363|Ga0137390_11936017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300012473|Ga0157340_1029867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300012917|Ga0137395_10764846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 699 | Open in IMG/M |
| 3300012917|Ga0137395_10955822 | Not Available | 616 | Open in IMG/M |
| 3300012925|Ga0137419_11536369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300012930|Ga0137407_10009102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6936 | Open in IMG/M |
| 3300013105|Ga0157369_10746553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1007 | Open in IMG/M |
| 3300013307|Ga0157372_11769026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 711 | Open in IMG/M |
| 3300014325|Ga0163163_13010514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300014501|Ga0182024_11344117 | Not Available | 826 | Open in IMG/M |
| 3300015242|Ga0137412_10837398 | Not Available | 672 | Open in IMG/M |
| 3300016422|Ga0182039_11731699 | Not Available | 572 | Open in IMG/M |
| 3300017993|Ga0187823_10178700 | Not Available | 685 | Open in IMG/M |
| 3300018001|Ga0187815_10361730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 617 | Open in IMG/M |
| 3300018007|Ga0187805_10496437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 572 | Open in IMG/M |
| 3300018032|Ga0187788_10502423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| 3300019887|Ga0193729_1051705 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300021171|Ga0210405_11397210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
| 3300021181|Ga0210388_11263036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 625 | Open in IMG/M |
| 3300021433|Ga0210391_10766648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 755 | Open in IMG/M |
| 3300021478|Ga0210402_11486821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura rudentiformis | 605 | Open in IMG/M |
| 3300021560|Ga0126371_12100732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 681 | Open in IMG/M |
| 3300021560|Ga0126371_13559501 | Not Available | 526 | Open in IMG/M |
| 3300022557|Ga0212123_10228936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1352 | Open in IMG/M |
| 3300022557|Ga0212123_10449604 | Not Available | 850 | Open in IMG/M |
| 3300024288|Ga0179589_10571479 | Not Available | 528 | Open in IMG/M |
| 3300025627|Ga0208220_1009657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3311 | Open in IMG/M |
| 3300025927|Ga0207687_10340477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1219 | Open in IMG/M |
| 3300025941|Ga0207711_11366116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 651 | Open in IMG/M |
| 3300026327|Ga0209266_1120076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1118 | Open in IMG/M |
| 3300026498|Ga0257156_1100737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300026508|Ga0257161_1007292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1946 | Open in IMG/M |
| 3300026508|Ga0257161_1100237 | Not Available | 603 | Open in IMG/M |
| 3300026551|Ga0209648_10049159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3619 | Open in IMG/M |
| 3300027648|Ga0209420_1036718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1513 | Open in IMG/M |
| 3300027681|Ga0208991_1108127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 832 | Open in IMG/M |
| 3300027727|Ga0209328_10204154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 596 | Open in IMG/M |
| 3300027738|Ga0208989_10119485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 893 | Open in IMG/M |
| 3300027895|Ga0209624_10287330 | Not Available | 1095 | Open in IMG/M |
| 3300027905|Ga0209415_10443671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1025 | Open in IMG/M |
| 3300027908|Ga0209006_10871755 | Not Available | 725 | Open in IMG/M |
| 3300028807|Ga0307305_10037099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2237 | Open in IMG/M |
| 3300028828|Ga0307312_10354731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 960 | Open in IMG/M |
| 3300028828|Ga0307312_10544922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 767 | Open in IMG/M |
| 3300028884|Ga0307308_10531382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
| 3300031546|Ga0318538_10084990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1612 | Open in IMG/M |
| 3300031640|Ga0318555_10522078 | Not Available | 643 | Open in IMG/M |
| 3300031680|Ga0318574_10168563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1250 | Open in IMG/M |
| 3300031681|Ga0318572_10074368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1877 | Open in IMG/M |
| 3300031723|Ga0318493_10085127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1564 | Open in IMG/M |
| 3300031744|Ga0306918_10938205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 673 | Open in IMG/M |
| 3300031747|Ga0318502_10095298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1643 | Open in IMG/M |
| 3300031748|Ga0318492_10026011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2595 | Open in IMG/M |
| 3300031751|Ga0318494_10734224 | Not Available | 578 | Open in IMG/M |
| 3300031753|Ga0307477_10573063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 763 | Open in IMG/M |
| 3300031765|Ga0318554_10401503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 778 | Open in IMG/M |
| 3300031768|Ga0318509_10622543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 601 | Open in IMG/M |
| 3300031771|Ga0318546_10151894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1561 | Open in IMG/M |
| 3300031778|Ga0318498_10305787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300031781|Ga0318547_10108137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1597 | Open in IMG/M |
| 3300031782|Ga0318552_10267006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 869 | Open in IMG/M |
| 3300031805|Ga0318497_10054231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2074 | Open in IMG/M |
| 3300031821|Ga0318567_10493477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 695 | Open in IMG/M |
| 3300031823|Ga0307478_10509552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1003 | Open in IMG/M |
| 3300031832|Ga0318499_10042058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1686 | Open in IMG/M |
| 3300031832|Ga0318499_10134780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 962 | Open in IMG/M |
| 3300031835|Ga0318517_10050746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1737 | Open in IMG/M |
| 3300031896|Ga0318551_10540876 | Not Available | 670 | Open in IMG/M |
| 3300031896|Ga0318551_10677997 | Not Available | 597 | Open in IMG/M |
| 3300031897|Ga0318520_10767105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 604 | Open in IMG/M |
| 3300031912|Ga0306921_12471501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
| 3300032008|Ga0318562_10229409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1077 | Open in IMG/M |
| 3300032025|Ga0318507_10283530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 720 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.13% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.48% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.65% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1003100732 | 3300000955 | Soil | VSKTVSRGREAGQQAEVLAAGEVRRSRGRRRWAALGIVAVV |
| JGI12053J15887_104171192 | 3300001661 | Forest Soil | VSETVSRGREAGRQAEAQAAGEARGSRGRRRGGWVTAGLG |
| JGI12053J15887_105553992 | 3300001661 | Forest Soil | MSGMVSRRRESGQQTEAQAAVEVRRPRGRGRWVALGI |
| JGI25616J43925_103055282 | 3300002917 | Grasslands Soil | VSETVSRGREAGQYAEAEVAAEARGSRGRGRWVALGIVAVVAAG |
| Ga0062387_1005959302 | 3300004091 | Bog Forest Soil | VSETVSRGREAGQQAEALADVGARGSRGPRRWVALGIVVVVAAGAVSAWRAGVFSA |
| Ga0062389_1024111081 | 3300004092 | Bog Forest Soil | MSGTVSRGREAGQQEAGQQAEARGSRGRARWVALGIAAVVAAGVVSAWQAGVFSPA |
| Ga0062389_1030157031 | 3300004092 | Bog Forest Soil | MDSERGREAGQQAGALAAAEARGSRGLRRWVALGIVFVVAAGAVSA |
| Ga0062594_1029815451 | 3300005093 | Soil | VSKTVSRGREAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVAAGVVSAWRVGAFSPAASSGAGQR |
| Ga0066388_1004072703 | 3300005332 | Tropical Forest Soil | VSGTVSRGRQAGRRTVAHVAAEAGKPRGRGRWAALGVVVVMAAGAVPA |
| Ga0070709_112972281 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGTVSRGREAGRQTEAHAAAEARRPRGRGRWAALGIVVVMAAGA |
| Ga0070713_1005530423 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRRTVSATASRGRGTGQQPEVLSAALTRGPRGRGRWVALGIAVVVVAAGVGSAWQAGAF |
| Ga0070710_114657931 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VSETVSRGREAGRQVEVLAAGEARVSRGRRRWVALGIVAVVAAGVVS |
| Ga0070762_102983421 | 3300005602 | Soil | MSETVSRGREAGPQAEVLAAVEARGWRGRGRWVALGVVVVVLAAAVSAWRAGVFSPAA |
| Ga0070762_105651281 | 3300005602 | Soil | MVSETFSRGREAGQQADALTAAGARGPRGRGRWVALGIVVMVAAGAISAWRAGVFSPAAASGTWPRGAPPP |
| Ga0066903_1037437812 | 3300005764 | Tropical Forest Soil | VSGAVSRRQAAGRQAEALAAEGATGSRGHRLGRWVALGIVVV |
| Ga0066903_1052654011 | 3300005764 | Tropical Forest Soil | VSRTVPRSREAGQQAEDLAAAQPRGPRRRGRWLALGTVAVVAAG |
| Ga0066903_1080419821 | 3300005764 | Tropical Forest Soil | VSKTISRGRQAGQQANVLVAAEARGPRGRRRWAALGI |
| Ga0079222_107102441 | 3300006755 | Agricultural Soil | VSETVPRGREAEQQAEVLPAGESRGSRGRRRWLALGIVAV |
| Ga0066665_104106481 | 3300006796 | Soil | VSKTGSRGREAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVAAG |
| Ga0079220_101146211 | 3300006806 | Agricultural Soil | VGETVSPGRETGRQAAALAVAEARGPRRRGGWVAAGLVVVLAAGMVSAWRAG |
| Ga0099829_106606393 | 3300009038 | Vadose Zone Soil | VSGTVSRGREAGWQAEAQAAGEARGSRGRRRGGWVAAGLVVVLAAG |
| Ga0099829_108250082 | 3300009038 | Vadose Zone Soil | MSGTVSRGREAELEAEALATAGARGSRGRGRWVALGIVVVVAAGAVSAWRAGVFSPAA |
| Ga0099830_106957392 | 3300009088 | Vadose Zone Soil | VSETVPRGREAGQAEVLATTEPRGSRGRGRWVALGLVAVVAAGTVSAWRAGVFSPAASSG |
| Ga0099827_103059583 | 3300009090 | Vadose Zone Soil | VSGTVSRGREAGWQAEAQAAGEARGSRGRRRGGWVAAGLVVVLAAGVVSAWR |
| Ga0099792_102623262 | 3300009143 | Vadose Zone Soil | VSGTVSRGGEAGQRGVAAEAGGSRRRGGWVALGVVVVVAAGPVAAWRAGVFSPAASSGAGQQ |
| Ga0105248_110495242 | 3300009177 | Switchgrass Rhizosphere | VSKTVSRGREAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVAAGVVSAWRIGAFSPA |
| Ga0116214_11169132 | 3300009520 | Peatlands Soil | MSGTVSRGREAGRQAEVLAADEARGSRGRGRWVALGIVVV |
| Ga0105249_123190641 | 3300009553 | Switchgrass Rhizosphere | VSKTVSRGREAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVAAGVVSAWRVGA |
| Ga0126374_114027451 | 3300009792 | Tropical Forest Soil | VSKTISRGREAGQQADVPAAAEAPGPRGRRWVALGIVAVVAAG |
| Ga0126373_123353481 | 3300010048 | Tropical Forest Soil | MSRTVSRGREAGQQAEDLGAEVRGSRARGRWVALGLVVVLAAGAVWAWRAG |
| Ga0134080_106659842 | 3300010333 | Grasslands Soil | VSETVSRGREARQQAEVPMAGETRGSRGRRRWVVLGVVVVVAAGAVSAWRTGVFSPAASS |
| Ga0126370_114637881 | 3300010358 | Tropical Forest Soil | MSGTVARGREAGDQAGAPAAEEARGSRGRGRWVAAGIVIVVAAGVVLAWLA |
| Ga0126370_123970221 | 3300010358 | Tropical Forest Soil | VSGAVSRRQAAGRQAEALAAEGATGSRGRSQGRWVVL |
| Ga0126372_119803102 | 3300010360 | Tropical Forest Soil | VSETVSRGREAGQQADVLPAVEARGSRGRRRWVALGIVAVVAA |
| Ga0126378_123532142 | 3300010361 | Tropical Forest Soil | MSRTVSRGREARQQAEDLAAEVRGSSARGRWVALGLVVVLA |
| Ga0126381_1002390151 | 3300010376 | Tropical Forest Soil | VSETVSHGREAGQQAGVLAVAEARGSRRRPGGWVALGMAVVVVAGVVGA |
| Ga0126381_1010890361 | 3300010376 | Tropical Forest Soil | VSGSFSRRRAAGRQAEALAAAGASGSRGRRRGRWVALGIVV |
| Ga0126381_1047524162 | 3300010376 | Tropical Forest Soil | VSETVSRGREAEQQDVELAAAGARRAGARGRWIGLGIVLLTA |
| Ga0126350_113925191 | 3300010880 | Boreal Forest Soil | VSETVSAGREAGQQAEALAAGAARGSHRRGGWVAAGLV |
| Ga0126350_121486591 | 3300010880 | Boreal Forest Soil | MSETVSRGREAGSQAEVLAAAQARGRRGRGRWVALGIVVVVAAAAVS |
| Ga0137393_109030891 | 3300011271 | Vadose Zone Soil | MSGTVSRGREAGQQAEVLAAAEARGSRGRRRWAALGIVAVVAAGAVSAWR |
| Ga0137362_101662553 | 3300012205 | Vadose Zone Soil | MSGTVSRGREAGQQAEAQAAAEARGSRGHHRRGGWAAVGLVALAAA |
| Ga0137379_109742282 | 3300012209 | Vadose Zone Soil | MSGTVSRGREAGQQAEALADSGARGSRGRWVALGIVVVVA |
| Ga0137379_113423432 | 3300012209 | Vadose Zone Soil | VSETVSRGREAGRQAEAEPAGQARGSRGRRRGGWV |
| Ga0137378_113366661 | 3300012210 | Vadose Zone Soil | MSGTVSRGQEAGRQAEVLAAAGARGSRGRGRWVALGIVVVVAAGAVSAWRAGAF |
| Ga0137377_102680271 | 3300012211 | Vadose Zone Soil | VSETVSRGREAGQQAGALAAAQARASHRRRRGGWVAAGIVVVLAAGA |
| Ga0137390_119360172 | 3300012363 | Vadose Zone Soil | VSGAVPRGREDGRQAEALADLEARGSRGRVRWVALGIAVVVAAGAV |
| Ga0157340_10298671 | 3300012473 | Arabidopsis Rhizosphere | VSKTVSRGQEAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVAAGVVSAWRVGA |
| Ga0137395_107648461 | 3300012917 | Vadose Zone Soil | VSETVSRGREAGLQAEAEPAGEAKGSRGRRWGGWVAAGLVVVLAAGAVLAWRAGVFSAAASPG |
| Ga0137395_109558221 | 3300012917 | Vadose Zone Soil | VSGTVPRGREAGRQAEALADSEALADSEARGSRGRVRWVALGIA |
| Ga0137419_115363693 | 3300012925 | Vadose Zone Soil | MSGTVSRGREAGQQGEAQAAAEARGSRGHHRWGGWAAVGLVALAA |
| Ga0137407_100091021 | 3300012930 | Vadose Zone Soil | MSGTVSRGREAGQQGEAQAAAEARGSRGHHRWGGWAA |
| Ga0157369_107465531 | 3300013105 | Corn Rhizosphere | VSKTVSRGREAGQQAEVLAAGEVRGSRGRRRWAAL |
| Ga0157372_117690261 | 3300013307 | Corn Rhizosphere | VSKTVSRGREAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVAA |
| Ga0163163_130105142 | 3300014325 | Switchgrass Rhizosphere | VSKTVSRGREAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVAAGVVSAWRVGAFSPAA |
| Ga0182024_113441171 | 3300014501 | Permafrost | MSGTVSRGREAGQQEAGQQAEARGSRGRGRWVALGIAAVVA |
| Ga0137412_108373981 | 3300015242 | Vadose Zone Soil | VGETVSRGREAGQRAEVLAAAEARGSRGRVRWAALGIVAVVAAGAVA |
| Ga0182039_117316992 | 3300016422 | Soil | VSETVPRDREAGPQAEVLAAEGKPRPGGRGRWVAVGVAVVVAAGVLSAWRAGVFSTAA |
| Ga0187812_11558381 | 3300017821 | Freshwater Sediment | VSETVWRGREAGQRAEVLAAAGAPGSRGRGRWVALGI |
| Ga0187823_101787001 | 3300017993 | Freshwater Sediment | VSGTVSRGPETGQRAEVLAAAGARGSRGRGRWVALGIVVLVAAGVVSA |
| Ga0187815_103617301 | 3300018001 | Freshwater Sediment | VSGTVSRGPETGQRAEVLAAAGARGSRGRGRWVALGIVVVVAAG |
| Ga0187805_104964372 | 3300018007 | Freshwater Sediment | MSNTGPGGPEAGQQARAVAAQEARASRAHGRWVTLGLVVVVAAGAVSAWQARVFS |
| Ga0187788_105024232 | 3300018032 | Tropical Peatland | VSKTVSRGREAGQQAEVLAAGEVTGSRGRRRWAALGLVAVVAAGVVSAWRVG |
| Ga0193729_10517051 | 3300019887 | Soil | VSETVPRGREAGQQAEVLAAAEARGSRGRGRWVALGIVVVVAAGAATAWRAG |
| Ga0210405_113972101 | 3300021171 | Soil | MSGTVPRGRETGQQVEALPAMPPRGTRGRGRWVALGIVVVVAAGAVAGWRAGAFSPATSSGTGRQGA |
| Ga0210388_112630361 | 3300021181 | Soil | VSETVSRGQEAGQQADALAPGRRTGHWRGRGRWVAAGIGVVLAAGVVAGWRA |
| Ga0210391_107666482 | 3300021433 | Soil | VSETVSGGREAGQQAEDLAAGVARGSRRRGGWVAAALVMVLAAGGAAGAWRAGVFSPA |
| Ga0210402_114868212 | 3300021478 | Soil | MSGTVPRGREAGRQTEALANSETKGSRGRVRWVALGIAVVVAAGAVAAWRAGAFSPAASP |
| Ga0126371_121007322 | 3300021560 | Tropical Forest Soil | VSKTISRGRQAGQQADVPPAAAAEARGPHGRRRWVAVGIVIVVAA |
| Ga0126371_135595012 | 3300021560 | Tropical Forest Soil | MRDTISPGRETAQQAEVLAAAGARGSRGRRRWVALGLVVVAAAGA |
| Ga0212123_102289361 | 3300022557 | Iron-Sulfur Acid Spring | VSETVSRGREAGWQAEAQAAGEARGSRGRRRGGWVAAGLVVVLAAG |
| Ga0212123_104496041 | 3300022557 | Iron-Sulfur Acid Spring | VSGTVSRGREAGWQAEAQAAGEASGSRGRRRGGWVAAGLVVVLA |
| Ga0179589_105714792 | 3300024288 | Vadose Zone Soil | MSGTVPRGREAGQQAEAQAAAEARGSRGHGRRGGW |
| Ga0208220_10096574 | 3300025627 | Arctic Peat Soil | VSETVSRGREAGQRAETLAAAEARGSRGRGRWIALGIVVVVAAGAVSAWRVFSPDASSG |
| Ga0207687_103404773 | 3300025927 | Miscanthus Rhizosphere | VSKTVTRGREAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVAAGVVSAWRVGAFSPAASSGA |
| Ga0207711_113661161 | 3300025941 | Switchgrass Rhizosphere | VSKTVTRGREAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVAAGVVSAWRIGAFSPA |
| Ga0209266_11200761 | 3300026327 | Soil | VSKTGSRGREAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVAAGVVSA |
| Ga0257156_11007371 | 3300026498 | Soil | MSGTVSRGREAGPHAEALAAAQPRGPRGRGRWVAAGLVVVLAAG |
| Ga0257161_10072921 | 3300026508 | Soil | MSGTVSRGREAGQQAEALAAAEARGSRGRGRWVALGIVVVVAAGA |
| Ga0257161_11002372 | 3300026508 | Soil | VSETVSRGREAGRQAEAQAAGEARGSRGRRRGGWAAAGLGVVLAAGVVSAWRTGVFSPAATSGSGQQ |
| Ga0209648_100491595 | 3300026551 | Grasslands Soil | VSETVSRGREAGQQAEVLAAAEARGSRGRRRWAALGIVAV |
| Ga0209420_10367181 | 3300027648 | Forest Soil | MDSERDGFARPGGRATGGALAAAETRGSRGLRCWVALGIVFVVAAGAV |
| Ga0208991_11081273 | 3300027681 | Forest Soil | MSGTVSRGREAGQQAEALAAAEAKGSRGRGRWVALGIVVVVVAAGAVSAW |
| Ga0209328_102041541 | 3300027727 | Forest Soil | MSGTVSRGREAGQQAEALAVAGARVSRGRRRGGWVAL |
| Ga0208989_101194851 | 3300027738 | Forest Soil | VSETVSRGREAGRQAEAQAAWEARGSRGRRRGGWVTAGLGV |
| Ga0209624_102873301 | 3300027895 | Forest Soil | VGETVPRDREVGHQAEVLAAAETRGSRGRRRWAALGIVAVVAAGAVSAWR |
| Ga0209415_104436711 | 3300027905 | Peatlands Soil | MSGTVSRGREAGQQAEALAAAEARGSRGRGRWVALGIVVVLAAGAVSAWRAGV |
| Ga0209006_108717552 | 3300027908 | Forest Soil | MDSETFSRGREARRQADALTAAGAPGPRSRGRWVALGIVVVLAAGAVSAWRAG |
| Ga0307305_100370991 | 3300028807 | Soil | LRKRKGRRWIVSKTVSRRREAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVAAGVVSAWRAG |
| Ga0307312_103547312 | 3300028828 | Soil | VSKTVSRGREAGQQAEVLAAGEVRGSRGRRRWAALGIVAVVA |
| Ga0307312_105449222 | 3300028828 | Soil | VSETVSRGREAGRQAEAQPAGEARESRGRRRGGWVAAAMV |
| Ga0307308_105313821 | 3300028884 | Soil | VSETVSRGREAGRQAEAQPAGEARESRGRRQGGWVAAAMVVVL |
| Ga0318538_100849901 | 3300031546 | Soil | MVSRGREAGQHAEVLAAAEARGSRGRRRWVALGIVAVVA |
| Ga0318571_104249581 | 3300031549 | Soil | VSGVVSRRRAAGRQAEALAAAGATGSRGRRRGRWVALGIVAV |
| Ga0318555_105220781 | 3300031640 | Soil | MVSRGREAGQHAEVLAAAEPRGSRGRRRWVALGIVAVVAA |
| Ga0318574_101685633 | 3300031680 | Soil | MRDTVSPGREAAQQAEVFAAAGARGSRGRRRWVALGLVVVAAAGALSAWRAG |
| Ga0318572_100743684 | 3300031681 | Soil | MVSRGREAGQHAEVLAAAEARGSRGRRRWVALGIV |
| Ga0318493_100851274 | 3300031723 | Soil | VSEMVSRGREAGQHAEVLAAAEARGSRGRRRWVALG |
| Ga0306918_109382051 | 3300031744 | Soil | VSETVSRGREAGQRVEVPVAAGARGSRGRSRWVALGIVVLVAAGVISAWR |
| Ga0318502_100952984 | 3300031747 | Soil | VCEMVSRGREAGQHAEVLAAAEARGSRGRRRWVALGLVVVAAAGALSAWRAGVFSPTAS |
| Ga0318492_100260115 | 3300031748 | Soil | MVSRGREAGQHAEVLAAAEPRGSRGRRRWVALGIVAVVAAG |
| Ga0318494_107342241 | 3300031751 | Soil | VSGTVPRGREAGQQAHAPAAAGARGPRGHGRWVAL |
| Ga0307477_105730632 | 3300031753 | Hardwood Forest Soil | VSETVSRGREAGRQADALAAAGVGVAGGRRRRGGWAAACLVVVLAAGAVWAWRAGM |
| Ga0318554_104015031 | 3300031765 | Soil | VSETVSRGQEAGQQAEGRAAAMPTRPRGRGRWVALGIAVVVAAGAVTAWRAGAFSPVAS |
| Ga0318509_106225431 | 3300031768 | Soil | VSETVSRGREAGQRAEVPVAAGARGSRGRSRWVALGIVVLVAAGVISAWRAGIFSPAAS |
| Ga0318546_101518943 | 3300031771 | Soil | VSEMVSRGREAGQHAEVLAAAEARGSRGRRRWVALGIM |
| Ga0318498_103057872 | 3300031778 | Soil | MSGPVSHQVAGQPAEALAAAGASGSRGRRRGRWVALGIVVVAGGVSAWWAGV |
| Ga0318547_101081371 | 3300031781 | Soil | MVSRGREAGQHAEVLAAAEARGSRGRRRWVALGIVAVVAAGE |
| Ga0318552_102670062 | 3300031782 | Soil | MSGPVSHQVAGQPAEALAAAGASGSRGRRRGRWVALGIVVVAGGVSAWWAGVFA |
| Ga0318497_100542311 | 3300031805 | Soil | VSEMVSRGREAGQHAEVLAAAEPRGSRGRRRWVALG |
| Ga0318567_104934772 | 3300031821 | Soil | VSETVSRGREAGQRVEVPVAAGARGSRGRSRWVALGIVVLVAAGVISAWRAGIFSPAASCGTGPLGAPPP |
| Ga0307478_105095522 | 3300031823 | Hardwood Forest Soil | MSGTVSRGREAGQQAEVLAAAEARGSRGRGRWVALGIVVVVAVGAVAG |
| Ga0318499_100420581 | 3300031832 | Soil | MVSRGREAGQHAEVLAAAEARGSRGRRRWVALGIVAVVAAGAV |
| Ga0318499_101347801 | 3300031832 | Soil | VSETVSRGQEAGQQAEGRAAAMPTRPRGRGRWVALG |
| Ga0318517_100507464 | 3300031835 | Soil | MVSRGREAGQHAEVLAAAEARGSRGRRRWVALGLVVVAAAGALSAWRAGVFS |
| Ga0318551_105408762 | 3300031896 | Soil | MRDTVSPGREAAQQAEVFAAAGARGSRGRRRWVALGLVVVAAAGALSAWQAGVFS |
| Ga0318551_106779971 | 3300031896 | Soil | MSGPVSHQVAGQPAEALAAAGASGSRGRRRGRWVALGIVVVAGGVSAWWAGVFAPAAS |
| Ga0318520_107671051 | 3300031897 | Soil | VSETVSRGREAGQRVEVPVAAGARGSRGRSRWVAMGIVVLVAAGVISAWRAGIFSP |
| Ga0306921_124715012 | 3300031912 | Soil | VSETVSRGREAGQRAEVPVAAGARGSRGRGRWVALGIVVLVAAGVISAWRAGIFSPA |
| Ga0318562_102294093 | 3300032008 | Soil | MSGPVSHQVAGQPAEALAAAGASGSRGRRRGRWVALGIVVVAGG |
| Ga0318507_102835301 | 3300032025 | Soil | VSETVSRGQEAGQQAEGRAAATPTRPRGRGRWVALGIAVVV |
| ⦗Top⦘ |