Basic Information | |
---|---|
Family ID | F072183 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 121 |
Average Sequence Length | 47 residues |
Representative Sequence | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHK |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 121 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 99.17 % |
% of genes from short scaffolds (< 2000 bps) | 89.26 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.512 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.397 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.579 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 121 Family Scaffolds |
---|---|---|
PF03466 | LysR_substrate | 37.19 |
PF07681 | DoxX | 7.44 |
PF00248 | Aldo_ket_red | 3.31 |
PF02436 | PYC_OADA | 2.48 |
PF04248 | NTP_transf_9 | 2.48 |
PF13343 | SBP_bac_6 | 2.48 |
PF07883 | Cupin_2 | 1.65 |
PF04224 | DUF417 | 1.65 |
PF00596 | Aldolase_II | 0.83 |
PF02900 | LigB | 0.83 |
PF13486 | Dehalogenase | 0.83 |
PF08669 | GCV_T_C | 0.83 |
PF13453 | zf-TFIIB | 0.83 |
PF12681 | Glyoxalase_2 | 0.83 |
PF00903 | Glyoxalase | 0.83 |
PF14686 | fn3_3 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
---|---|---|---|
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 7.44 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 7.44 |
COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 2.48 |
COG3059 | Reactive chlorine resistance protein RclC/YkgB, DUF417 family | Defense mechanisms [V] | 1.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.51 % |
Unclassified | root | N/A | 21.49 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459017|G14TP7Y01C790G | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 691 | Open in IMG/M |
3300000789|JGI1027J11758_12798479 | Not Available | 1072 | Open in IMG/M |
3300001139|JGI10220J13317_10014109 | Not Available | 838 | Open in IMG/M |
3300004022|Ga0055432_10098547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 765 | Open in IMG/M |
3300004050|Ga0055491_10181838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
3300004058|Ga0055498_10132773 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300004463|Ga0063356_101797851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 920 | Open in IMG/M |
3300004778|Ga0062383_10142647 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300004779|Ga0062380_10378025 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300005174|Ga0066680_10042763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 2629 | Open in IMG/M |
3300005179|Ga0066684_11129559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
3300005180|Ga0066685_10158816 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
3300005186|Ga0066676_10970816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
3300005332|Ga0066388_103977556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 754 | Open in IMG/M |
3300005333|Ga0070677_10275939 | Not Available | 845 | Open in IMG/M |
3300005339|Ga0070660_100153374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1853 | Open in IMG/M |
3300005366|Ga0070659_100570183 | Not Available | 970 | Open in IMG/M |
3300005458|Ga0070681_11348399 | Not Available | 636 | Open in IMG/M |
3300005536|Ga0070697_101974601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
3300005545|Ga0070695_101115662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 646 | Open in IMG/M |
3300005549|Ga0070704_100208322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1583 | Open in IMG/M |
3300005558|Ga0066698_10145659 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
3300005615|Ga0070702_100090397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1856 | Open in IMG/M |
3300005616|Ga0068852_100957272 | Not Available | 874 | Open in IMG/M |
3300005718|Ga0068866_11254483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
3300005764|Ga0066903_101398224 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
3300005842|Ga0068858_102238374 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300005890|Ga0075285_1032863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 656 | Open in IMG/M |
3300005895|Ga0075277_1030834 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300006794|Ga0066658_10503713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
3300006804|Ga0079221_11742344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300006844|Ga0075428_100853050 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300006845|Ga0075421_100480260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1480 | Open in IMG/M |
3300006847|Ga0075431_100065763 | All Organisms → cellular organisms → Bacteria | 3743 | Open in IMG/M |
3300006847|Ga0075431_100918173 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300006871|Ga0075434_100052934 | All Organisms → cellular organisms → Bacteria | 4034 | Open in IMG/M |
3300006903|Ga0075426_10357052 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300006954|Ga0079219_10033314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2060 | Open in IMG/M |
3300006969|Ga0075419_10674333 | Not Available | 731 | Open in IMG/M |
3300007076|Ga0075435_100492294 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300007076|Ga0075435_100651947 | Not Available | 914 | Open in IMG/M |
3300009094|Ga0111539_10148408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2745 | Open in IMG/M |
3300009094|Ga0111539_11690867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 734 | Open in IMG/M |
3300009101|Ga0105247_11626687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300009162|Ga0075423_10179443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2223 | Open in IMG/M |
3300009162|Ga0075423_11393200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
3300009162|Ga0075423_13139670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
3300009174|Ga0105241_11637411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 624 | Open in IMG/M |
3300009691|Ga0114944_1121452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1009 | Open in IMG/M |
3300010036|Ga0126305_10807185 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300010336|Ga0134071_10683190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
3300010361|Ga0126378_10514602 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300010366|Ga0126379_10681148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1121 | Open in IMG/M |
3300010403|Ga0134123_10045278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3284 | Open in IMG/M |
3300010868|Ga0124844_1156982 | Not Available | 857 | Open in IMG/M |
3300012198|Ga0137364_10869216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 682 | Open in IMG/M |
3300012198|Ga0137364_11005055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
3300012207|Ga0137381_11364465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 601 | Open in IMG/M |
3300012228|Ga0137459_1057027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1113 | Open in IMG/M |
3300012582|Ga0137358_10849914 | Not Available | 602 | Open in IMG/M |
3300012922|Ga0137394_10516245 | Not Available | 1014 | Open in IMG/M |
3300012924|Ga0137413_10099180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1812 | Open in IMG/M |
3300012925|Ga0137419_10802474 | Not Available | 770 | Open in IMG/M |
3300012957|Ga0164303_11143069 | Not Available | 565 | Open in IMG/M |
3300013306|Ga0163162_10123399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2695 | Open in IMG/M |
3300014254|Ga0075312_1012798 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300014314|Ga0075316_1064802 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300015242|Ga0137412_10152630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1862 | Open in IMG/M |
3300015372|Ga0132256_101980555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 689 | Open in IMG/M |
3300015372|Ga0132256_103806134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
3300015373|Ga0132257_101085721 | Not Available | 1010 | Open in IMG/M |
3300015374|Ga0132255_102455557 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300016270|Ga0182036_11839273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
3300018031|Ga0184634_10497921 | Not Available | 544 | Open in IMG/M |
3300018056|Ga0184623_10233458 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300018063|Ga0184637_10269354 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300018063|Ga0184637_10538346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 673 | Open in IMG/M |
3300018476|Ga0190274_10353474 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300018920|Ga0190273_10646730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 808 | Open in IMG/M |
3300019361|Ga0173482_10123177 | Not Available | 974 | Open in IMG/M |
3300019362|Ga0173479_10286791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 743 | Open in IMG/M |
3300021081|Ga0210379_10016304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2774 | Open in IMG/M |
3300021081|Ga0210379_10102254 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300021090|Ga0210377_10585594 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300021332|Ga0210339_1521050 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300022534|Ga0224452_1254356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
3300022756|Ga0222622_10291031 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300025315|Ga0207697_10014429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3276 | Open in IMG/M |
3300025893|Ga0207682_10325366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 722 | Open in IMG/M |
3300025912|Ga0207707_10142258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2097 | Open in IMG/M |
3300025917|Ga0207660_10800119 | Not Available | 769 | Open in IMG/M |
3300025933|Ga0207706_10741343 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300025935|Ga0207709_10437382 | Not Available | 1008 | Open in IMG/M |
3300025949|Ga0207667_12154461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
3300025961|Ga0207712_10552898 | Not Available | 990 | Open in IMG/M |
3300026089|Ga0207648_10556883 | Not Available | 1054 | Open in IMG/M |
3300026324|Ga0209470_1375645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
3300026535|Ga0256867_10323174 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300026540|Ga0209376_1374668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
3300027614|Ga0209970_1090740 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300027843|Ga0209798_10112685 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300027843|Ga0209798_10420897 | Not Available | 621 | Open in IMG/M |
3300027909|Ga0209382_10362143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1622 | Open in IMG/M |
3300027915|Ga0209069_10914393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300028536|Ga0137415_11181364 | Not Available | 580 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1097239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 636 | Open in IMG/M |
3300031716|Ga0310813_10153471 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1855 | Open in IMG/M |
3300031820|Ga0307473_10952715 | Not Available | 623 | Open in IMG/M |
3300031911|Ga0307412_10032645 | All Organisms → cellular organisms → Bacteria | 3302 | Open in IMG/M |
3300031962|Ga0307479_11437035 | Not Available | 648 | Open in IMG/M |
3300031965|Ga0326597_11483811 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300031995|Ga0307409_100659283 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300032001|Ga0306922_11587575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
3300032075|Ga0310890_11159323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
3300032076|Ga0306924_10964025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 939 | Open in IMG/M |
3300032783|Ga0335079_10569710 | Not Available | 1198 | Open in IMG/M |
3300033412|Ga0310810_10532461 | Not Available | 1155 | Open in IMG/M |
3300033475|Ga0310811_10236855 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2179 | Open in IMG/M |
3300033481|Ga0316600_11092418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
3300034164|Ga0364940_0253204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
3300034690|Ga0364923_0198155 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.26% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.44% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 3.31% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.48% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.48% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.48% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.65% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.65% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.65% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.65% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.65% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.65% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.65% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.65% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.83% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.83% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.83% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
4ZMR_00827210 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVGRAPWVK |
JGI1027J11758_127984791 | 3300000789 | Soil | MEVKSTKEVHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKL |
JGI10220J13317_100141091 | 3300001139 | Soil | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDAR |
Ga0055432_100985471 | 3300004022 | Natural And Restored Wetlands | MEVKSIKERHTELMMHSVKFAKDEQGRRKGQDVLFKWPDI |
Ga0055491_101818381 | 3300004050 | Natural And Restored Wetlands | MEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQLGEHKHIYVVDARL |
Ga0055498_101327731 | 3300004058 | Natural And Restored Wetlands | MEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQ |
Ga0063356_1017978512 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLKHEGGSMDVKSVKETHTELMMHSVRFAKDEQGRRKGQDVLFKWRDV |
Ga0062383_101426471 | 3300004778 | Wetland Sediment | MEVKSIKETHTELMMQSVKFAKDEQGRRKGQEILFKWPDIEKQLGEHKHIYVVDA |
Ga0062380_103780252 | 3300004779 | Wetland Sediment | MEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPDIEKQLGEHKHIY |
Ga0066680_100427633 | 3300005174 | Soil | MKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQK |
Ga0066684_111295591 | 3300005179 | Soil | MKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLGEHKHIYVV |
Ga0066685_101588161 | 3300005180 | Soil | MKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKL |
Ga0066676_109708161 | 3300005186 | Soil | MKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLG |
Ga0066388_1039775561 | 3300005332 | Tropical Forest Soil | MDVKSVKEVHTELMMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHI |
Ga0070677_102759391 | 3300005333 | Miscanthus Rhizosphere | VEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKQLG |
Ga0070660_1001533741 | 3300005339 | Corn Rhizosphere | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEI |
Ga0070659_1005701832 | 3300005366 | Corn Rhizosphere | VEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEK |
Ga0070681_113483991 | 3300005458 | Corn Rhizosphere | MEVKSIKERHTELLMHSVRFAKDEQGRRKGQEVLFKWPDIEKQL |
Ga0070697_1019746012 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVKSVKERHTELMMHSVKFAKDEQGRRQGQEILFKWPDIE |
Ga0070695_1011156621 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPDIEKQLGEHKH |
Ga0070704_1002083221 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVKSTQELHTELMMHSVRFAKDEQGRRKGQEVLFKWPDIEK |
Ga0066698_101456591 | 3300005558 | Soil | MKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPE |
Ga0070702_1000903971 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKL |
Ga0068852_1009572722 | 3300005616 | Corn Rhizosphere | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKQLGEHK |
Ga0068866_112544831 | 3300005718 | Miscanthus Rhizosphere | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKK |
Ga0066903_1013982242 | 3300005764 | Tropical Forest Soil | MDVKSVKEVHTELMMHSVRFAKDEQGRRKGQDVLFKWPE |
Ga0068858_1022383742 | 3300005842 | Switchgrass Rhizosphere | MEVKSTQELHTELMMHSVRFAKDEQGRRKGQEVLFKWPDIEKKLGEHKHIYV |
Ga0075285_10328632 | 3300005890 | Rice Paddy Soil | MEVKSTRELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDARL |
Ga0075277_10308342 | 3300005895 | Rice Paddy Soil | MEVKSTRELHSELAMHSVRFAKDEQGRRKGQEVLFKWPEIEKKLGEHKH |
Ga0066658_105037132 | 3300006794 | Soil | MKQEQRSVKEVHNELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLGEHKHI |
Ga0079221_117423441 | 3300006804 | Agricultural Soil | MEVKSIKETHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGE |
Ga0075428_1008530501 | 3300006844 | Populus Rhizosphere | MEVKSVKERNTELMMHSVKLAKDEQARRKGQEILFKWPD |
Ga0075421_1004802601 | 3300006845 | Populus Rhizosphere | MEVKSIKERNTELMMHSVKFAKDEQARRKGQEILFK |
Ga0075431_1000657636 | 3300006847 | Populus Rhizosphere | MDVKSVKETHTELMMHSVRFAKDEQGRRKGQDVLFKW |
Ga0075431_1009181731 | 3300006847 | Populus Rhizosphere | MEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPDIEKQLGEHKHIYVVDARLGS |
Ga0075434_1000529346 | 3300006871 | Populus Rhizosphere | VEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKQLGEHKHIYVVDARLGSN |
Ga0075426_103570522 | 3300006903 | Populus Rhizosphere | MELKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKQLGEHKHIYVVDAR |
Ga0079219_100333141 | 3300006954 | Agricultural Soil | MEVKSIKETHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKH |
Ga0075419_106743331 | 3300006969 | Populus Rhizosphere | MEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKW |
Ga0075435_1004922943 | 3300007076 | Populus Rhizosphere | MEQRSVKEVHSELGMHSVRFAKEEQGRRKQQQVLFKWPEVEKKLGEHKHIYVVDARLGSN |
Ga0075435_1006519472 | 3300007076 | Populus Rhizosphere | MEVKSIKERHTELTMHSVKFAKDEQGRRKGQEILFKWP |
Ga0111539_101484084 | 3300009094 | Populus Rhizosphere | MEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKH |
Ga0111539_116908671 | 3300009094 | Populus Rhizosphere | MEVKSVKEVHTDLLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVV |
Ga0105247_116266871 | 3300009101 | Switchgrass Rhizosphere | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVD |
Ga0075423_101794434 | 3300009162 | Populus Rhizosphere | MEVKSIKERHTELTMHSVKFAKDEQGRRKGQEILFKWPDIEKQLG |
Ga0075423_113932001 | 3300009162 | Populus Rhizosphere | MEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPDIEKQ |
Ga0075423_131396701 | 3300009162 | Populus Rhizosphere | MEVKSVKERHTELAMHSVKFAKDEQGRRKGQEILFKWPDIEKQL |
Ga0105241_116374111 | 3300009174 | Corn Rhizosphere | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGE |
Ga0114944_11214521 | 3300009691 | Thermal Springs | MEQRSTKELHGELGMHSVRFAKEEQGRRKEQQVLFKWPEIQKKLGEHKHI |
Ga0126305_108071852 | 3300010036 | Serpentine Soil | MEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQLGEHKHIYVVDAR |
Ga0134071_106831903 | 3300010336 | Grasslands Soil | MKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKW |
Ga0126378_105146024 | 3300010361 | Tropical Forest Soil | MEQRSVKEIHSELGMHSVRFAKEEQGRRKQQQVLFKWPEVEKKLGE |
Ga0126379_106811482 | 3300010366 | Tropical Forest Soil | MEQKSIKEVHTELMMHSVKFAKDEQGRRKQQQVLFKWAEVEKKLGEHKHIYVVDAR |
Ga0134123_100452781 | 3300010403 | Terrestrial Soil | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEH |
Ga0124844_11569822 | 3300010868 | Tropical Forest Soil | MGFMDVKSVKEVHTELMMHSVRFAKDEQGRRKSQDVLFKWPEIEKKLGEHKHIY |
Ga0137364_108692162 | 3300012198 | Vadose Zone Soil | MKQEPRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLGE |
Ga0137364_110050552 | 3300012198 | Vadose Zone Soil | MKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLGE |
Ga0137381_113644652 | 3300012207 | Vadose Zone Soil | MKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLGEHKH |
Ga0137459_10570273 | 3300012228 | Soil | MEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPDI |
Ga0137358_108499142 | 3300012582 | Vadose Zone Soil | MEVKSIKERHTELMMHSVKFAKDEQGRRKGQEILF |
Ga0137394_105162453 | 3300012922 | Vadose Zone Soil | MEVKSIKERHTELTMHSVKFAKDEQGRRKGQEILFKWPDIEKQL |
Ga0137413_100991801 | 3300012924 | Vadose Zone Soil | MEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDARL |
Ga0137419_108024742 | 3300012925 | Vadose Zone Soil | MEVKSIKERHTELTMHSVKFAKDEQGRRKGQEILFKWPDIEKQLGEHKHIYVVD |
Ga0164303_111430691 | 3300012957 | Soil | MEVKSTKEVHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLG |
Ga0163162_101233994 | 3300013306 | Switchgrass Rhizosphere | MEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLF |
Ga0075312_10127981 | 3300014254 | Natural And Restored Wetlands | MEVKSTRELHSELAMHSVRFAKDEQGRRKGQEVLFKW |
Ga0075316_10648022 | 3300014314 | Natural And Restored Wetlands | MEVKSTRELHSELAMHSVRFAKDEQGRRKGQEVLFKWL |
Ga0137412_101526301 | 3300015242 | Vadose Zone Soil | MEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLREHKHIYVVDAR |
Ga0132256_1019805551 | 3300015372 | Arabidopsis Rhizosphere | MEVKSVKEVHTDLLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIY |
Ga0132256_1038061341 | 3300015372 | Arabidopsis Rhizosphere | MEVKSIKETHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKL |
Ga0132257_1010857213 | 3300015373 | Arabidopsis Rhizosphere | MEVKSVKEVHTDLLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHK |
Ga0132255_1024555571 | 3300015374 | Arabidopsis Rhizosphere | MEVKSVKEVHTDLLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYV |
Ga0182036_118392731 | 3300016270 | Soil | MDVKSVKEVHTELMMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDARLGSN |
Ga0184634_104979211 | 3300018031 | Groundwater Sediment | MEVKSVKERNTELMMHSVKFAKEEQGRRKGQEVLFKWQDVEK |
Ga0184623_102334581 | 3300018056 | Groundwater Sediment | MEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFEWPDIEKQLGEHKHI |
Ga0184637_102693542 | 3300018063 | Groundwater Sediment | MDVKSTKEVHTELLMHSVKFAKDEQGRRKQQEVLFKWPDIEKKLGEHKHIYVVD |
Ga0184637_105383461 | 3300018063 | Groundwater Sediment | MEVKSVKERHTELMMHSVKFAKDEQGRRKGQEILFKWPDIE |
Ga0190274_103534743 | 3300018476 | Soil | MEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQLGEHKHIYVVDARLGSN |
Ga0190273_106467302 | 3300018920 | Soil | MEVKSIKETHTELMMHSVKFAKDEQGRRKGQEVLFKWPDI |
Ga0173482_101231772 | 3300019361 | Soil | VEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDARIGSN |
Ga0173479_102867911 | 3300019362 | Soil | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVV |
Ga0210379_100163041 | 3300021081 | Groundwater Sediment | MEVKSIKERNTELMMHSVKFAKDEQARRRGQEILF |
Ga0210379_101022541 | 3300021081 | Groundwater Sediment | MDVKATKQVHAELAMHSVRFAKDEQGRRKGQDVLFKWPDIEKQLGEHK |
Ga0210377_105855941 | 3300021090 | Groundwater Sediment | MDVKTTKQVHTELAMHSVRFAKDEQGRRKGQDVLFKWPDIEKQLG |
Ga0210339_15210502 | 3300021332 | Estuarine | MEVKSIKETHTELMMHSVKFAKDEQGRRKGQEILFKWPDI |
Ga0224452_12543561 | 3300022534 | Groundwater Sediment | MEVKSVKERHSELAMHSVKFAKDEQGRRKGQEILFKWPDIEKQLGEHKHIYVV |
Ga0222622_102910312 | 3300022756 | Groundwater Sediment | MEVKSTQELHTELMMHSVRFAKDEQGRRKGQEVLFKWPDIEKKLGEH |
Ga0207697_100144294 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHK |
Ga0207682_103253661 | 3300025893 | Miscanthus Rhizosphere | VEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKH |
Ga0207707_101422583 | 3300025912 | Corn Rhizosphere | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKW |
Ga0207660_108001191 | 3300025917 | Corn Rhizosphere | MEVKSIKERHTELLMHSVRFAKDEQGRRKGQEVLFKWPDIEKQLGEHKHIYVVDARLG |
Ga0207706_107413432 | 3300025933 | Corn Rhizosphere | MEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVD |
Ga0207709_104373821 | 3300025935 | Miscanthus Rhizosphere | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEK |
Ga0207667_121544611 | 3300025949 | Corn Rhizosphere | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDARL |
Ga0207712_105528981 | 3300025961 | Switchgrass Rhizosphere | VEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIY |
Ga0207648_105568831 | 3300026089 | Miscanthus Rhizosphere | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIY |
Ga0209470_13756451 | 3300026324 | Soil | MEVKSVKERHTELMMHSVKFAKDEQGRRKGQEILFKWPDIEKQLGEHKHIYV |
Ga0256867_103231741 | 3300026535 | Soil | MDVKATKQVHAELAMHSVRFAKDEQGRRKGQDVLFKWPDIEKQLGEHKHIYVVD |
Ga0209376_13746681 | 3300026540 | Soil | MKQEQRSVKEVHSELGMHSVRFAKDEQGRRREQQVLFKWPEVQKKLGEHKH |
Ga0209970_10907401 | 3300027614 | Arabidopsis Thaliana Rhizosphere | MEVKSTKELHSELTMHSVRFAKDEQGRRKGQDVLFKWSEIEKKLGEHKHIYVVDA |
Ga0209798_101126851 | 3300027843 | Wetland Sediment | MEVKSIKETHTELMMQSVKFAKDEQGRRKGQDVLFKWQEVEKQLGEHGHIYVVDK |
Ga0209798_104208971 | 3300027843 | Wetland Sediment | MEVKSIKETHTELMMQSVKFAKDEQGRRKGQEILFKWPDIEKQLGEHKHIYVVDARL |
Ga0209382_103621433 | 3300027909 | Populus Rhizosphere | MEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPD |
Ga0209069_109143932 | 3300027915 | Watersheds | MEVKSIKEKHTELMMQSVKFAKDEQSRRKGQEVLFKWPDIEKQLGEQTRP |
Ga0137415_111813642 | 3300028536 | Vadose Zone Soil | MEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIETQ |
(restricted) Ga0255311_10972392 | 3300031150 | Sandy Soil | MEVKSVKETHTELMMHSVRFAKDEQGRRKGQEVLFKWRDVEKQLGEHKHIYVVDARLGSN |
Ga0310813_101534711 | 3300031716 | Soil | MEVKSIKETHTELLMHSVRFAKDEQGRRKGQDVLFKWPEI |
Ga0307473_109527151 | 3300031820 | Hardwood Forest Soil | MEQRSVKEVHSELGMHSVRFAKEEQGRRKQQQVLFKWPEVEKKLGEHKHIYVVDAR |
Ga0307412_100326455 | 3300031911 | Rhizosphere | MEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKW |
Ga0307479_114370351 | 3300031962 | Hardwood Forest Soil | MEQRSVKEVHSELGMHSVRFAKEEQGRRKQQQVLFK |
Ga0326597_114838112 | 3300031965 | Soil | MDVKTTKQVHTELAMHSVRFAKDEQGRRKGQDVLFKWPDIEKQLGEHKHIYV |
Ga0307409_1006592833 | 3300031995 | Rhizosphere | MEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQLGEHK |
Ga0306922_115875752 | 3300032001 | Soil | MDVKSVKEVHTELMMHSVRFAKDEQGRRKGQDVLFKWPEVEKKL |
Ga0310890_111593231 | 3300032075 | Soil | MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDA |
Ga0306924_109640252 | 3300032076 | Soil | MEQKSTKEVHSELGMHSVRFAKEEQGRRKQQQVLFKWPEVQKKL |
Ga0335079_105697101 | 3300032783 | Soil | MEQKSIKEVHTELMMHSVKFAKDEQGRRKQQQVLFKWAEVE |
Ga0310810_105324613 | 3300033412 | Soil | MEVKSVKEVHTDLLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKH |
Ga0310811_102368552 | 3300033475 | Soil | MEVKSIKETHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIE |
Ga0316600_110924183 | 3300033481 | Soil | MEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQLGEHKHIYV |
Ga0364940_0253204_1_168 | 3300034164 | Sediment | MDVKSTKEVHTELLMHSVKFAKDEQGRRKQQEVLFKWPEIEKKLGEHKHIYVVDAR |
Ga0364923_0198155_376_537 | 3300034690 | Sediment | MDVKTTKEVHTELAMHSVRFAKDEQGRRKGQDVLFKWPDIEKQLGEHKHIYVVD |
⦗Top⦘ |