NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072183

Metagenome / Metatranscriptome Family F072183

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072183
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 47 residues
Representative Sequence MEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHK
Number of Associated Samples 111
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 99.17 %
% of genes from short scaffolds (< 2000 bps) 89.26 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.512 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(12.397 % of family members)
Environment Ontology (ENVO) Unclassified
(30.579 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.455 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.33%    β-sheet: 0.00%    Coil/Unstructured: 41.67%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF03466LysR_substrate 37.19
PF07681DoxX 7.44
PF00248Aldo_ket_red 3.31
PF02436PYC_OADA 2.48
PF04248NTP_transf_9 2.48
PF13343SBP_bac_6 2.48
PF07883Cupin_2 1.65
PF04224DUF417 1.65
PF00596Aldolase_II 0.83
PF02900LigB 0.83
PF13486Dehalogenase 0.83
PF08669GCV_T_C 0.83
PF13453zf-TFIIB 0.83
PF12681Glyoxalase_2 0.83
PF00903Glyoxalase 0.83
PF14686fn3_3 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 7.44
COG4270Uncharacterized membrane proteinFunction unknown [S] 7.44
COG2343Uncharacterized conserved protein, DUF427 familyFunction unknown [S] 2.48
COG3059Reactive chlorine resistance protein RclC/YkgB, DUF417 familyDefense mechanisms [V] 1.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.51 %
UnclassifiedrootN/A21.49 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459017|G14TP7Y01C790GAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium691Open in IMG/M
3300000789|JGI1027J11758_12798479Not Available1072Open in IMG/M
3300001139|JGI10220J13317_10014109Not Available838Open in IMG/M
3300004022|Ga0055432_10098547All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium765Open in IMG/M
3300004050|Ga0055491_10181838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300004058|Ga0055498_10132773All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300004463|Ga0063356_101797851All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria920Open in IMG/M
3300004778|Ga0062383_10142647All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300004779|Ga0062380_10378025All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300005174|Ga0066680_10042763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales2629Open in IMG/M
3300005179|Ga0066684_11129559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300005180|Ga0066685_10158816All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300005186|Ga0066676_10970816All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300005332|Ga0066388_103977556All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium754Open in IMG/M
3300005333|Ga0070677_10275939Not Available845Open in IMG/M
3300005339|Ga0070660_100153374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1853Open in IMG/M
3300005366|Ga0070659_100570183Not Available970Open in IMG/M
3300005458|Ga0070681_11348399Not Available636Open in IMG/M
3300005536|Ga0070697_101974601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300005545|Ga0070695_101115662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300005549|Ga0070704_100208322All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1583Open in IMG/M
3300005558|Ga0066698_10145659All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300005615|Ga0070702_100090397All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1856Open in IMG/M
3300005616|Ga0068852_100957272Not Available874Open in IMG/M
3300005718|Ga0068866_11254483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300005764|Ga0066903_101398224All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300005842|Ga0068858_102238374All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005890|Ga0075285_1032863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium656Open in IMG/M
3300005895|Ga0075277_1030834All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300006794|Ga0066658_10503713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300006804|Ga0079221_11742344All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300006844|Ga0075428_100853050All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300006845|Ga0075421_100480260All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1480Open in IMG/M
3300006847|Ga0075431_100065763All Organisms → cellular organisms → Bacteria3743Open in IMG/M
3300006847|Ga0075431_100918173All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300006871|Ga0075434_100052934All Organisms → cellular organisms → Bacteria4034Open in IMG/M
3300006903|Ga0075426_10357052All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300006954|Ga0079219_10033314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2060Open in IMG/M
3300006969|Ga0075419_10674333Not Available731Open in IMG/M
3300007076|Ga0075435_100492294All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300007076|Ga0075435_100651947Not Available914Open in IMG/M
3300009094|Ga0111539_10148408All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2745Open in IMG/M
3300009094|Ga0111539_11690867All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium734Open in IMG/M
3300009101|Ga0105247_11626687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300009162|Ga0075423_10179443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2223Open in IMG/M
3300009162|Ga0075423_11393200All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium750Open in IMG/M
3300009162|Ga0075423_13139670All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300009174|Ga0105241_11637411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300009691|Ga0114944_1121452All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1009Open in IMG/M
3300010036|Ga0126305_10807185All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300010336|Ga0134071_10683190All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300010361|Ga0126378_10514602All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300010366|Ga0126379_10681148All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1121Open in IMG/M
3300010403|Ga0134123_10045278All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3284Open in IMG/M
3300010868|Ga0124844_1156982Not Available857Open in IMG/M
3300012198|Ga0137364_10869216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium682Open in IMG/M
3300012198|Ga0137364_11005055All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium630Open in IMG/M
3300012207|Ga0137381_11364465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium601Open in IMG/M
3300012228|Ga0137459_1057027All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1113Open in IMG/M
3300012582|Ga0137358_10849914Not Available602Open in IMG/M
3300012922|Ga0137394_10516245Not Available1014Open in IMG/M
3300012924|Ga0137413_10099180All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1812Open in IMG/M
3300012925|Ga0137419_10802474Not Available770Open in IMG/M
3300012957|Ga0164303_11143069Not Available565Open in IMG/M
3300013306|Ga0163162_10123399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2695Open in IMG/M
3300014254|Ga0075312_1012798All Organisms → cellular organisms → Bacteria1417Open in IMG/M
3300014314|Ga0075316_1064802All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300015242|Ga0137412_10152630All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1862Open in IMG/M
3300015372|Ga0132256_101980555All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium689Open in IMG/M
3300015372|Ga0132256_103806134All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300015373|Ga0132257_101085721Not Available1010Open in IMG/M
3300015374|Ga0132255_102455557All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300016270|Ga0182036_11839273All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300018031|Ga0184634_10497921Not Available544Open in IMG/M
3300018056|Ga0184623_10233458All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300018063|Ga0184637_10269354All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300018063|Ga0184637_10538346All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium673Open in IMG/M
3300018476|Ga0190274_10353474All Organisms → cellular organisms → Bacteria1399Open in IMG/M
3300018920|Ga0190273_10646730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium808Open in IMG/M
3300019361|Ga0173482_10123177Not Available974Open in IMG/M
3300019362|Ga0173479_10286791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium743Open in IMG/M
3300021081|Ga0210379_10016304All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2774Open in IMG/M
3300021081|Ga0210379_10102254All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300021090|Ga0210377_10585594All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300021332|Ga0210339_1521050All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300022534|Ga0224452_1254356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300022756|Ga0222622_10291031All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300025315|Ga0207697_10014429All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3276Open in IMG/M
3300025893|Ga0207682_10325366All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium722Open in IMG/M
3300025912|Ga0207707_10142258All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2097Open in IMG/M
3300025917|Ga0207660_10800119Not Available769Open in IMG/M
3300025933|Ga0207706_10741343All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300025935|Ga0207709_10437382Not Available1008Open in IMG/M
3300025949|Ga0207667_12154461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300025961|Ga0207712_10552898Not Available990Open in IMG/M
3300026089|Ga0207648_10556883Not Available1054Open in IMG/M
3300026324|Ga0209470_1375645All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300026535|Ga0256867_10323174All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300026540|Ga0209376_1374668All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300027614|Ga0209970_1090740All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300027843|Ga0209798_10112685All Organisms → cellular organisms → Bacteria1380Open in IMG/M
3300027843|Ga0209798_10420897Not Available621Open in IMG/M
3300027909|Ga0209382_10362143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1622Open in IMG/M
3300027915|Ga0209069_10914393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300028536|Ga0137415_11181364Not Available580Open in IMG/M
(restricted) 3300031150|Ga0255311_1097239All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium636Open in IMG/M
3300031716|Ga0310813_10153471All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1855Open in IMG/M
3300031820|Ga0307473_10952715Not Available623Open in IMG/M
3300031911|Ga0307412_10032645All Organisms → cellular organisms → Bacteria3302Open in IMG/M
3300031962|Ga0307479_11437035Not Available648Open in IMG/M
3300031965|Ga0326597_11483811All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300031995|Ga0307409_100659283All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300032001|Ga0306922_11587575All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300032075|Ga0310890_11159323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium628Open in IMG/M
3300032076|Ga0306924_10964025All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium939Open in IMG/M
3300032783|Ga0335079_10569710Not Available1198Open in IMG/M
3300033412|Ga0310810_10532461Not Available1155Open in IMG/M
3300033475|Ga0310811_10236855All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2179Open in IMG/M
3300033481|Ga0316600_11092418All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300034164|Ga0364940_0253204All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300034690|Ga0364923_0198155All Organisms → cellular organisms → Bacteria538Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.26%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.44%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment3.31%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.31%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.31%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.48%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.48%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.48%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.65%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.65%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.65%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.65%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.65%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.83%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.83%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.83%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.83%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.83%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005890Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104EnvironmentalOpen in IMG/M
3300005895Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009691Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014254Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2EnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021332Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
4ZMR_008272102170459017Switchgrass, Maize And Mischanthus LitterMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVGRAPWVK
JGI1027J11758_1279847913300000789SoilMEVKSTKEVHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKL
JGI10220J13317_1001410913300001139SoilMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDAR
Ga0055432_1009854713300004022Natural And Restored WetlandsMEVKSIKERHTELMMHSVKFAKDEQGRRKGQDVLFKWPDI
Ga0055491_1018183813300004050Natural And Restored WetlandsMEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQLGEHKHIYVVDARL
Ga0055498_1013277313300004058Natural And Restored WetlandsMEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQ
Ga0063356_10179785123300004463Arabidopsis Thaliana RhizosphereMLKHEGGSMDVKSVKETHTELMMHSVRFAKDEQGRRKGQDVLFKWRDV
Ga0062383_1014264713300004778Wetland SedimentMEVKSIKETHTELMMQSVKFAKDEQGRRKGQEILFKWPDIEKQLGEHKHIYVVDA
Ga0062380_1037802523300004779Wetland SedimentMEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPDIEKQLGEHKHIY
Ga0066680_1004276333300005174SoilMKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQK
Ga0066684_1112955913300005179SoilMKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLGEHKHIYVV
Ga0066685_1015881613300005180SoilMKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKL
Ga0066676_1097081613300005186SoilMKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLG
Ga0066388_10397755613300005332Tropical Forest SoilMDVKSVKEVHTELMMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHI
Ga0070677_1027593913300005333Miscanthus RhizosphereVEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKQLG
Ga0070660_10015337413300005339Corn RhizosphereMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEI
Ga0070659_10057018323300005366Corn RhizosphereVEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEK
Ga0070681_1134839913300005458Corn RhizosphereMEVKSIKERHTELLMHSVRFAKDEQGRRKGQEVLFKWPDIEKQL
Ga0070697_10197460123300005536Corn, Switchgrass And Miscanthus RhizosphereMEVKSVKERHTELMMHSVKFAKDEQGRRQGQEILFKWPDIE
Ga0070695_10111566213300005545Corn, Switchgrass And Miscanthus RhizosphereMEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPDIEKQLGEHKH
Ga0070704_10020832213300005549Corn, Switchgrass And Miscanthus RhizosphereMEVKSTQELHTELMMHSVRFAKDEQGRRKGQEVLFKWPDIEK
Ga0066698_1014565913300005558SoilMKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPE
Ga0070702_10009039713300005615Corn, Switchgrass And Miscanthus RhizosphereMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKL
Ga0068852_10095727223300005616Corn RhizosphereMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKQLGEHK
Ga0068866_1125448313300005718Miscanthus RhizosphereMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKK
Ga0066903_10139822423300005764Tropical Forest SoilMDVKSVKEVHTELMMHSVRFAKDEQGRRKGQDVLFKWPE
Ga0068858_10223837423300005842Switchgrass RhizosphereMEVKSTQELHTELMMHSVRFAKDEQGRRKGQEVLFKWPDIEKKLGEHKHIYV
Ga0075285_103286323300005890Rice Paddy SoilMEVKSTRELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDARL
Ga0075277_103083423300005895Rice Paddy SoilMEVKSTRELHSELAMHSVRFAKDEQGRRKGQEVLFKWPEIEKKLGEHKH
Ga0066658_1050371323300006794SoilMKQEQRSVKEVHNELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLGEHKHI
Ga0079221_1174234413300006804Agricultural SoilMEVKSIKETHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGE
Ga0075428_10085305013300006844Populus RhizosphereMEVKSVKERNTELMMHSVKLAKDEQARRKGQEILFKWPD
Ga0075421_10048026013300006845Populus RhizosphereMEVKSIKERNTELMMHSVKFAKDEQARRKGQEILFK
Ga0075431_10006576363300006847Populus RhizosphereMDVKSVKETHTELMMHSVRFAKDEQGRRKGQDVLFKW
Ga0075431_10091817313300006847Populus RhizosphereMEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPDIEKQLGEHKHIYVVDARLGS
Ga0075434_10005293463300006871Populus RhizosphereVEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKQLGEHKHIYVVDARLGSN
Ga0075426_1035705223300006903Populus RhizosphereMELKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKQLGEHKHIYVVDAR
Ga0079219_1003331413300006954Agricultural SoilMEVKSIKETHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKH
Ga0075419_1067433313300006969Populus RhizosphereMEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKW
Ga0075435_10049229433300007076Populus RhizosphereMEQRSVKEVHSELGMHSVRFAKEEQGRRKQQQVLFKWPEVEKKLGEHKHIYVVDARLGSN
Ga0075435_10065194723300007076Populus RhizosphereMEVKSIKERHTELTMHSVKFAKDEQGRRKGQEILFKWP
Ga0111539_1014840843300009094Populus RhizosphereMEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKH
Ga0111539_1169086713300009094Populus RhizosphereMEVKSVKEVHTDLLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVV
Ga0105247_1162668713300009101Switchgrass RhizosphereMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVD
Ga0075423_1017944343300009162Populus RhizosphereMEVKSIKERHTELTMHSVKFAKDEQGRRKGQEILFKWPDIEKQLG
Ga0075423_1139320013300009162Populus RhizosphereMEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPDIEKQ
Ga0075423_1313967013300009162Populus RhizosphereMEVKSVKERHTELAMHSVKFAKDEQGRRKGQEILFKWPDIEKQL
Ga0105241_1163741113300009174Corn RhizosphereMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGE
Ga0114944_112145213300009691Thermal SpringsMEQRSTKELHGELGMHSVRFAKEEQGRRKEQQVLFKWPEIQKKLGEHKHI
Ga0126305_1080718523300010036Serpentine SoilMEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQLGEHKHIYVVDAR
Ga0134071_1068319033300010336Grasslands SoilMKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKW
Ga0126378_1051460243300010361Tropical Forest SoilMEQRSVKEIHSELGMHSVRFAKEEQGRRKQQQVLFKWPEVEKKLGE
Ga0126379_1068114823300010366Tropical Forest SoilMEQKSIKEVHTELMMHSVKFAKDEQGRRKQQQVLFKWAEVEKKLGEHKHIYVVDAR
Ga0134123_1004527813300010403Terrestrial SoilMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEH
Ga0124844_115698223300010868Tropical Forest SoilMGFMDVKSVKEVHTELMMHSVRFAKDEQGRRKSQDVLFKWPEIEKKLGEHKHIY
Ga0137364_1086921623300012198Vadose Zone SoilMKQEPRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLGE
Ga0137364_1100505523300012198Vadose Zone SoilMKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLGE
Ga0137381_1136446523300012207Vadose Zone SoilMKQEQRSVKEVHSELGMHSVRFAKDEQGRRKEQQVLFKWPEVQKKLGEHKH
Ga0137459_105702733300012228SoilMEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPDI
Ga0137358_1084991423300012582Vadose Zone SoilMEVKSIKERHTELMMHSVKFAKDEQGRRKGQEILF
Ga0137394_1051624533300012922Vadose Zone SoilMEVKSIKERHTELTMHSVKFAKDEQGRRKGQEILFKWPDIEKQL
Ga0137413_1009918013300012924Vadose Zone SoilMEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDARL
Ga0137419_1080247423300012925Vadose Zone SoilMEVKSIKERHTELTMHSVKFAKDEQGRRKGQEILFKWPDIEKQLGEHKHIYVVD
Ga0164303_1114306913300012957SoilMEVKSTKEVHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLG
Ga0163162_1012339943300013306Switchgrass RhizosphereMEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLF
Ga0075312_101279813300014254Natural And Restored WetlandsMEVKSTRELHSELAMHSVRFAKDEQGRRKGQEVLFKW
Ga0075316_106480223300014314Natural And Restored WetlandsMEVKSTRELHSELAMHSVRFAKDEQGRRKGQEVLFKWL
Ga0137412_1015263013300015242Vadose Zone SoilMEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLREHKHIYVVDAR
Ga0132256_10198055513300015372Arabidopsis RhizosphereMEVKSVKEVHTDLLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIY
Ga0132256_10380613413300015372Arabidopsis RhizosphereMEVKSIKETHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKL
Ga0132257_10108572133300015373Arabidopsis RhizosphereMEVKSVKEVHTDLLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHK
Ga0132255_10245555713300015374Arabidopsis RhizosphereMEVKSVKEVHTDLLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYV
Ga0182036_1183927313300016270SoilMDVKSVKEVHTELMMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDARLGSN
Ga0184634_1049792113300018031Groundwater SedimentMEVKSVKERNTELMMHSVKFAKEEQGRRKGQEVLFKWQDVEK
Ga0184623_1023345813300018056Groundwater SedimentMEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFEWPDIEKQLGEHKHI
Ga0184637_1026935423300018063Groundwater SedimentMDVKSTKEVHTELLMHSVKFAKDEQGRRKQQEVLFKWPDIEKKLGEHKHIYVVD
Ga0184637_1053834613300018063Groundwater SedimentMEVKSVKERHTELMMHSVKFAKDEQGRRKGQEILFKWPDIE
Ga0190274_1035347433300018476SoilMEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQLGEHKHIYVVDARLGSN
Ga0190273_1064673023300018920SoilMEVKSIKETHTELMMHSVKFAKDEQGRRKGQEVLFKWPDI
Ga0173482_1012317723300019361SoilVEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDARIGSN
Ga0173479_1028679113300019362SoilMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVV
Ga0210379_1001630413300021081Groundwater SedimentMEVKSIKERNTELMMHSVKFAKDEQARRRGQEILF
Ga0210379_1010225413300021081Groundwater SedimentMDVKATKQVHAELAMHSVRFAKDEQGRRKGQDVLFKWPDIEKQLGEHK
Ga0210377_1058559413300021090Groundwater SedimentMDVKTTKQVHTELAMHSVRFAKDEQGRRKGQDVLFKWPDIEKQLG
Ga0210339_152105023300021332EstuarineMEVKSIKETHTELMMHSVKFAKDEQGRRKGQEILFKWPDI
Ga0224452_125435613300022534Groundwater SedimentMEVKSVKERHSELAMHSVKFAKDEQGRRKGQEILFKWPDIEKQLGEHKHIYVV
Ga0222622_1029103123300022756Groundwater SedimentMEVKSTQELHTELMMHSVRFAKDEQGRRKGQEVLFKWPDIEKKLGEH
Ga0207697_1001442943300025315Corn, Switchgrass And Miscanthus RhizosphereMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHK
Ga0207682_1032536613300025893Miscanthus RhizosphereVEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKH
Ga0207707_1014225833300025912Corn RhizosphereMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKW
Ga0207660_1080011913300025917Corn RhizosphereMEVKSIKERHTELLMHSVRFAKDEQGRRKGQEVLFKWPDIEKQLGEHKHIYVVDARLG
Ga0207706_1074134323300025933Corn RhizosphereMEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVD
Ga0207709_1043738213300025935Miscanthus RhizosphereMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEK
Ga0207667_1215446113300025949Corn RhizosphereMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDARL
Ga0207712_1055289813300025961Switchgrass RhizosphereVEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIY
Ga0207648_1055688313300026089Miscanthus RhizosphereMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIY
Ga0209470_137564513300026324SoilMEVKSVKERHTELMMHSVKFAKDEQGRRKGQEILFKWPDIEKQLGEHKHIYV
Ga0256867_1032317413300026535SoilMDVKATKQVHAELAMHSVRFAKDEQGRRKGQDVLFKWPDIEKQLGEHKHIYVVD
Ga0209376_137466813300026540SoilMKQEQRSVKEVHSELGMHSVRFAKDEQGRRREQQVLFKWPEVQKKLGEHKH
Ga0209970_109074013300027614Arabidopsis Thaliana RhizosphereMEVKSTKELHSELTMHSVRFAKDEQGRRKGQDVLFKWSEIEKKLGEHKHIYVVDA
Ga0209798_1011268513300027843Wetland SedimentMEVKSIKETHTELMMQSVKFAKDEQGRRKGQDVLFKWQEVEKQLGEHGHIYVVDK
Ga0209798_1042089713300027843Wetland SedimentMEVKSIKETHTELMMQSVKFAKDEQGRRKGQEILFKWPDIEKQLGEHKHIYVVDARL
Ga0209382_1036214333300027909Populus RhizosphereMEVKSVKERNTELMMHSVKFAKDEQARRKGQEILFKWPD
Ga0209069_1091439323300027915WatershedsMEVKSIKEKHTELMMQSVKFAKDEQSRRKGQEVLFKWPDIEKQLGEQTRP
Ga0137415_1118136423300028536Vadose Zone SoilMEVKSTKELHSELAMHSVRFAKDEQGRRKGQDVLFKWPEIETQ
(restricted) Ga0255311_109723923300031150Sandy SoilMEVKSVKETHTELMMHSVRFAKDEQGRRKGQEVLFKWRDVEKQLGEHKHIYVVDARLGSN
Ga0310813_1015347113300031716SoilMEVKSIKETHTELLMHSVRFAKDEQGRRKGQDVLFKWPEI
Ga0307473_1095271513300031820Hardwood Forest SoilMEQRSVKEVHSELGMHSVRFAKEEQGRRKQQQVLFKWPEVEKKLGEHKHIYVVDAR
Ga0307412_1003264553300031911RhizosphereMEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKW
Ga0307479_1143703513300031962Hardwood Forest SoilMEQRSVKEVHSELGMHSVRFAKEEQGRRKQQQVLFK
Ga0326597_1148381123300031965SoilMDVKTTKQVHTELAMHSVRFAKDEQGRRKGQDVLFKWPDIEKQLGEHKHIYV
Ga0307409_10065928333300031995RhizosphereMEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQLGEHK
Ga0306922_1158757523300032001SoilMDVKSVKEVHTELMMHSVRFAKDEQGRRKGQDVLFKWPEVEKKL
Ga0310890_1115932313300032075SoilMEVKSVKEVHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKHIYVVDA
Ga0306924_1096402523300032076SoilMEQKSTKEVHSELGMHSVRFAKEEQGRRKQQQVLFKWPEVQKKL
Ga0335079_1056971013300032783SoilMEQKSIKEVHTELMMHSVKFAKDEQGRRKQQQVLFKWAEVE
Ga0310810_1053246133300033412SoilMEVKSVKEVHTDLLMHSVRFAKDEQGRRKGQDVLFKWPEIEKKLGEHKH
Ga0310811_1023685523300033475SoilMEVKSIKETHTELLMHSVRFAKDEQGRRKGQDVLFKWPEIE
Ga0316600_1109241833300033481SoilMEVKSIKETHTELMMQSVKFAKDEQGRRKGQAILFKWPEIEKQLGEHKHIYV
Ga0364940_0253204_1_1683300034164SedimentMDVKSTKEVHTELLMHSVKFAKDEQGRRKQQEVLFKWPEIEKKLGEHKHIYVVDAR
Ga0364923_0198155_376_5373300034690SedimentMDVKTTKEVHTELAMHSVRFAKDEQGRRKGQDVLFKWPDIEKQLGEHKHIYVVD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.