| Basic Information | |
|---|---|
| Family ID | F072151 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MMKDEELRTLLRKRGYTILELSYSSYSDKKRDELYREILNGLGK |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 24.00 % |
| % of genes near scaffold ends (potentially truncated) | 28.10 % |
| % of genes from short scaffolds (< 2000 bps) | 32.23 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.595 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (44.628 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.587 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.413 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF01909 | NTP_transf_2 | 4.13 |
| PF04307 | YdjM | 2.48 |
| PF01850 | PIN | 2.48 |
| PF13432 | TPR_16 | 1.65 |
| PF05168 | HEPN | 1.65 |
| PF04242 | DUF424 | 1.65 |
| PF03965 | Penicillinase_R | 1.65 |
| PF08241 | Methyltransf_11 | 1.65 |
| PF00801 | PKD | 0.83 |
| PF01351 | RNase_HII | 0.83 |
| PF13361 | UvrD_C | 0.83 |
| PF10137 | TIR-like | 0.83 |
| PF01939 | NucS | 0.83 |
| PF13456 | RVT_3 | 0.83 |
| PF13649 | Methyltransf_25 | 0.83 |
| PF00227 | Proteasome | 0.83 |
| PF01548 | DEDD_Tnp_IS110 | 0.83 |
| PF11867 | DUF3387 | 0.83 |
| PF00254 | FKBP_C | 0.83 |
| PF08774 | VRR_NUC | 0.83 |
| PF01844 | HNH | 0.83 |
| PF02182 | SAD_SRA | 0.83 |
| PF00211 | Guanylate_cyc | 0.83 |
| PF04480 | DUF559 | 0.83 |
| PF02371 | Transposase_20 | 0.83 |
| PF00557 | Peptidase_M24 | 0.83 |
| PF05050 | Methyltransf_21 | 0.83 |
| PF00145 | DNA_methylase | 0.83 |
| PF01546 | Peptidase_M20 | 0.83 |
| PF13439 | Glyco_transf_4 | 0.83 |
| PF13482 | RNase_H_2 | 0.83 |
| PF00534 | Glycos_transf_1 | 0.83 |
| PF05866 | RusA | 0.83 |
| PF01555 | N6_N4_Mtase | 0.83 |
| PF08843 | AbiEii | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 2.48 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 1.65 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.65 |
| COG2412 | Uncharacterized conserved protein, DUF424 domain | Function unknown [S] | 1.65 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.65 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 1.65 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 1.65 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.83 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.83 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.83 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.83 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 0.83 |
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 0.83 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 0.83 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.83 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.60 % |
| All Organisms | root | All Organisms | 31.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002562|JGI25382J37095_10035147 | Not Available | 1963 | Open in IMG/M |
| 3300002562|JGI25382J37095_10195670 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 613 | Open in IMG/M |
| 3300005166|Ga0066674_10131979 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1173 | Open in IMG/M |
| 3300005167|Ga0066672_10942182 | All Organisms → cellular organisms → Archaea | 531 | Open in IMG/M |
| 3300005174|Ga0066680_10401784 | Not Available | 870 | Open in IMG/M |
| 3300005176|Ga0066679_10570796 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005447|Ga0066689_10037838 | All Organisms → Viruses → Predicted Viral | 2513 | Open in IMG/M |
| 3300005450|Ga0066682_10418577 | Not Available | 856 | Open in IMG/M |
| 3300005552|Ga0066701_10108992 | All Organisms → cellular organisms → Archaea | 1627 | Open in IMG/M |
| 3300005554|Ga0066661_10836912 | All Organisms → cellular organisms → Archaea | 538 | Open in IMG/M |
| 3300005556|Ga0066707_10882634 | Not Available | 549 | Open in IMG/M |
| 3300005558|Ga0066698_10339538 | All Organisms → cellular organisms → Archaea | 1039 | Open in IMG/M |
| 3300005568|Ga0066703_10741582 | Not Available | 563 | Open in IMG/M |
| 3300005568|Ga0066703_10864838 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 516 | Open in IMG/M |
| 3300005586|Ga0066691_10279094 | Not Available | 984 | Open in IMG/M |
| 3300007265|Ga0099794_10005723 | All Organisms → cellular organisms → Archaea | 5009 | Open in IMG/M |
| 3300009822|Ga0105066_1048090 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 892 | Open in IMG/M |
| 3300010304|Ga0134088_10105432 | All Organisms → cellular organisms → Archaea | 1328 | Open in IMG/M |
| 3300010329|Ga0134111_10475575 | All Organisms → cellular organisms → Archaea | 545 | Open in IMG/M |
| 3300010333|Ga0134080_10030663 | Not Available | 2047 | Open in IMG/M |
| 3300010333|Ga0134080_10168679 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Methanomassiliicoccales → Methanomassiliicoccaceae → Methanomassiliicoccus → Methanomassiliicoccus luminyensis | 935 | Open in IMG/M |
| 3300010333|Ga0134080_10238287 | Not Available | 799 | Open in IMG/M |
| 3300010398|Ga0126383_12527957 | Not Available | 598 | Open in IMG/M |
| 3300011271|Ga0137393_10921273 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300012203|Ga0137399_10000465 | All Organisms → cellular organisms → Archaea | 16004 | Open in IMG/M |
| 3300012203|Ga0137399_10449609 | All Organisms → cellular organisms → Archaea | 1078 | Open in IMG/M |
| 3300012206|Ga0137380_10047402 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3944 | Open in IMG/M |
| 3300012206|Ga0137380_10338923 | All Organisms → cellular organisms → Archaea | 1342 | Open in IMG/M |
| 3300012206|Ga0137380_10591838 | All Organisms → cellular organisms → Archaea → TACK group | 971 | Open in IMG/M |
| 3300012209|Ga0137379_11316036 | Not Available | 628 | Open in IMG/M |
| 3300012349|Ga0137387_10034091 | All Organisms → cellular organisms → Archaea | 3308 | Open in IMG/M |
| 3300012349|Ga0137387_10034291 | All Organisms → cellular organisms → Archaea | 3299 | Open in IMG/M |
| 3300012351|Ga0137386_10555930 | All Organisms → cellular organisms → Archaea | 826 | Open in IMG/M |
| 3300012359|Ga0137385_10033348 | All Organisms → cellular organisms → Bacteria | 4618 | Open in IMG/M |
| 3300012359|Ga0137385_10426475 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012359|Ga0137385_10658973 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 876 | Open in IMG/M |
| 3300012359|Ga0137385_11061525 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 667 | Open in IMG/M |
| 3300012930|Ga0137407_10337520 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1385 | Open in IMG/M |
| 3300017654|Ga0134069_1309963 | All Organisms → cellular organisms → Archaea → TACK group | 561 | Open in IMG/M |
| 3300018468|Ga0066662_11018651 | Not Available | 821 | Open in IMG/M |
| 3300025174|Ga0209324_10284646 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1071 | Open in IMG/M |
| 3300025313|Ga0209431_10523834 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 899 | Open in IMG/M |
| 3300026296|Ga0209235_1165997 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 845 | Open in IMG/M |
| 3300026313|Ga0209761_1029439 | All Organisms → cellular organisms → Archaea | 3319 | Open in IMG/M |
| 3300026317|Ga0209154_1136873 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1027 | Open in IMG/M |
| 3300026317|Ga0209154_1283946 | All Organisms → cellular organisms → Archaea | 550 | Open in IMG/M |
| 3300026328|Ga0209802_1085981 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 1447 | Open in IMG/M |
| 3300026548|Ga0209161_10062448 | All Organisms → Viruses → Predicted Viral | 2377 | Open in IMG/M |
| 3300027655|Ga0209388_1013594 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2225 | Open in IMG/M |
| 3300032180|Ga0307471_101556588 | Not Available | 818 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 44.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 18.18% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.83% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_101666081 | 3300002558 | Grasslands Soil | DEELRSLLRKRGYRILELSYGSYTDKKRDELYREILNGLGK* |
| JGI25384J37096_101580481 | 3300002561 | Grasslands Soil | MKDEELRTLLRKKGYRLLELCYDNYSDKKRDELYEEILANLGMT* |
| JGI25382J37095_100351472 | 3300002562 | Grasslands Soil | MTKDEELRTLLRKRGYRILELYYDIYSDKKRDQLYEQILKDLSMQ* |
| JGI25382J37095_101604991 | 3300002562 | Grasslands Soil | HLKTAQMMKDEELRSLLRKRGYRILELSYGTYSDKKRDELYREILNGLGR* |
| JGI25382J37095_101956701 | 3300002562 | Grasslands Soil | MTKDEELRTLLRKRGYRILELSYSSYSDKKRDELYREIMSGLGK* |
| JGI25386J43895_100260192 | 3300002912 | Grasslands Soil | MMKDEELRTLLRKRGYTILELSYSSYSDKKRDELYREILNGLGK* |
| Ga0066674_101319791 | 3300005166 | Soil | MTKDEELRTLLRKRGYRILELFYDSYTDKKREQLYEAILDSLGRQ* |
| Ga0066674_105018671 | 3300005166 | Soil | LKTTQIVKDEELRSLLGKRGYRVLELAYSSYSDKKRDELYEKILDNLGRS* |
| Ga0066672_109421821 | 3300005167 | Soil | MSKDEELRTLLRKRGYRILELFYESYSDKKRDQLYEEIQN |
| Ga0066680_100537565 | 3300005174 | Soil | MMKDEELWTLLRKRGYRILELSYSSYTNKKGDELFREIVNKVGRE* |
| Ga0066680_104017841 | 3300005174 | Soil | KDEELRSLLRKRGYRVLELCYNSYSDKKRDQLYEGILTGLGKQ* |
| Ga0066679_104526491 | 3300005176 | Soil | LRTLLRKRGYKVMELVYGSYSDKKRDELYQEIVMQLGKE* |
| Ga0066679_105707962 | 3300005176 | Soil | TAQMMKDEELRTLLRKKGYRVLEPYYDSYSDKKRDQLYEEILTNLARI* |
| Ga0066685_108644252 | 3300005180 | Soil | MAKDEEPRTLLRKRGYKVLELIYRSYSDKKRDELYQEIIKELGRE* |
| Ga0066689_100378381 | 3300005447 | Soil | MAKDEELRTLLRKRGYRILELFYESYSDKKRDQLYEEIQNSLAKLGT* |
| Ga0066682_104185771 | 3300005450 | Soil | SQMTKDEETRTLLRKKGYRILELYYESYSDKKRDQLYREILAAIGMSSPL* |
| Ga0070699_1000585193 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKDEKLRSLLRKRGYRVLELSYTGYSDKKRDELYREIMSQLGK* |
| Ga0070699_1003522822 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQMIRDGETRSLLRKRGYRALELSYTGYTDKKRDELCREIMSHLGK* |
| Ga0066701_1000282411 | 3300005552 | Soil | KDEELRTLLRKRGYRILELVYGSYTDKKGDELYREILNGLG* |
| Ga0066701_101089921 | 3300005552 | Soil | DEELRLLLRKRGYRILELYHDSYSDKKRDELYNEIRNGLRIARS* |
| Ga0066661_108369121 | 3300005554 | Soil | DEELRGLLRKRGYRILELYYDSYSDKKRDELYEEMMNSLGRE* |
| Ga0066707_108826342 | 3300005556 | Soil | KDEELRSLLRKRGYRVLELRYDSYSDKKRDQLYEQILSDLRRT* |
| Ga0066698_103395381 | 3300005558 | Soil | MSKDEELRTLLRKRGYRTLELFYESYSDKKRDQLYEEIQNSLAKLAT* |
| Ga0066703_107415822 | 3300005568 | Soil | HLNTAQMMKDEELRTLLRKKGYRVLEPYYDSYSDKKRDQLYEEILTNLARI* |
| Ga0066703_108648381 | 3300005568 | Soil | VKDEELRSLLRKRGYRIIELFYDSYSDKKRDELYEQILSDLNRR* |
| Ga0066708_102401521 | 3300005576 | Soil | QMVKDEELRSLLRKRGYRILKLSYSSYTDKKRDELYREILNGLGK* |
| Ga0066691_102790942 | 3300005586 | Soil | MAKDEEVRSLLRKRGYRVLELTYNSYSDKKRDDLYEEISNSL |
| Ga0066656_100311401 | 3300006034 | Soil | TLLRKRGYKVMELIYRSYSDKKRDELYQEIVTQLGRE* |
| Ga0066665_111474382 | 3300006796 | Soil | HLARAQMIRDKETRLLLRKRGYGILELSYGSYTDKKRDRLYREILNGLGK* |
| Ga0099791_101332562 | 3300007255 | Vadose Zone Soil | MKDEELRTLLRKRGYRVLELSYTGYTDKKRDELYREILNGLGK* |
| Ga0099794_100057234 | 3300007265 | Vadose Zone Soil | MVKDEELRSLLRKRGYRVLELLYIKYSEKKRDQLYEEILDNLVGSGAIH* |
| Ga0066710_10000322112 | 3300009012 | Grasslands Soil | MAKDEELRTLLRKRGYKVVELVYRSYSGKKRDELYQEIVKQLGRE |
| Ga0066710_1025780021 | 3300009012 | Grasslands Soil | DEELRTLLRKRGYRVLELSYTGYTDKKRDELYRELVERLGRE |
| Ga0099829_110513122 | 3300009038 | Vadose Zone Soil | LRTLLRKRGYRVLELSYSSYSDKKRDKLYREMVSALGK* |
| Ga0099830_117088291 | 3300009088 | Vadose Zone Soil | MSQMKDEELRTILRKGGYRILELSYSSYSDKRRDELYR |
| Ga0099828_100868795 | 3300009089 | Vadose Zone Soil | MSQMKDEELRTILRKGGYRILELSYSSYSDKKRDELYREIMSGLGK* |
| Ga0099827_100525833 | 3300009090 | Vadose Zone Soil | MSQMKDEELRTILRKRGYRILEPSYSSYSDKKRDELYREIMSGLGK* |
| Ga0066709_1001067042 | 3300009137 | Grasslands Soil | MAKDEELRTLLRNRGYKVMELVYRSYSDKKRDELFQEIVKQLGREESG* |
| Ga0066709_1017641061 | 3300009137 | Grasslands Soil | MMKDEELRTLLRKRGYRILELRYSSYSDKKRDELYREIMSGLGK* |
| Ga0066709_1024573692 | 3300009137 | Grasslands Soil | DEELRTLLRKRGYRILELTYDNYSDKKRDELYEEILDSLGREI* |
| Ga0105066_10480903 | 3300009822 | Groundwater Sand | VKDEELRSLLRKRGYRVLELYYNSYSNKKRDQLYSEILNSLGREYP* |
| Ga0134088_101054324 | 3300010304 | Grasslands Soil | AQMAKDEELSSLLRKRGYRILELCYNNYSDKKRDELYKEIRHSLHS* |
| Ga0134088_101959822 | 3300010304 | Grasslands Soil | LKTSQMMKDEELRTLLRKRGYGILELSYGSYTDKKRDRLYREILNGLGK* |
| Ga0134111_104013591 | 3300010329 | Grasslands Soil | EELRTLLRKRGYKVMELIYRNYSDKKRDELYQELVQQLGREQGGNT* |
| Ga0134111_104755751 | 3300010329 | Grasslands Soil | AQMAKDEELRSLLRKRGYRILELFYDSYSDKKRDQLYEEIRKGLHSSSS* |
| Ga0134111_105542862 | 3300010329 | Grasslands Soil | MAKDEELRTLLRKRGYKVMELIYRSYSDKKRDELYEEIVTQLGRE* |
| Ga0134080_100306631 | 3300010333 | Grasslands Soil | KDEETRTLLRKKGYRILELSYSNYSDKKRDQLYQDILAGLGREL* |
| Ga0134080_101686792 | 3300010333 | Grasslands Soil | DEELRSLLRKRGYRILELFYDSYSDKKRDMMYEQILYDLGTE* |
| Ga0134080_102382871 | 3300010333 | Grasslands Soil | KDEELRTLLRKRGYRILELYYNSYSDKKRDQLFKELLDNLGKL* |
| Ga0126383_125279572 | 3300010398 | Tropical Forest Soil | MKDEEVRSLLRKKGYKVLEPYDESYSEKKRHELYLEIIKTLGRE* |
| Ga0137393_109212731 | 3300011271 | Vadose Zone Soil | TSQMTKDEETRTLLRKKGYRILELPYDSYSDKKRDELYQEILDSLGTNEVD* |
| Ga0137388_110398962 | 3300012189 | Vadose Zone Soil | HLKTAQMMKDEELRTLLRKRGYRVLELSYSSYTDKKTDELYREILNGLGK* |
| Ga0137364_109984912 | 3300012198 | Vadose Zone Soil | ELRTLLRKRGYKIVELAYTDYSDKKRDELFQQLLAGLGQE* |
| Ga0137399_100004655 | 3300012203 | Vadose Zone Soil | MVKDEELRSLLRKRGYRVLELLYIKYSEKKRDQLYEEILDNLVGSGPIR* |
| Ga0137399_104496092 | 3300012203 | Vadose Zone Soil | MVKDEELRTLLRKRGYRIIELVYSSYTDKKRDELYREILNGLGK* |
| Ga0137374_110264191 | 3300012204 | Vadose Zone Soil | RTLLRKRGYKVMELIYRSYSDKKRDALYQEIVRQLERK* |
| Ga0137362_111335751 | 3300012205 | Vadose Zone Soil | MVKDEELRALLRKRGYRVLELSYSGYSDKKRDELYEEILNGRGRSLAAR |
| Ga0137380_100181751 | 3300012206 | Vadose Zone Soil | LRTLLRKRGYKVMELVYHNYSDKKRDELYQEIVKELGRE* |
| Ga0137380_100474021 | 3300012206 | Vadose Zone Soil | QMAKDGELRILLRKKGYRVLELYYENYTDKKRDQLYHEILDKLGME* |
| Ga0137380_103389231 | 3300012206 | Vadose Zone Soil | MSKDEELRTLLRKRGYRILEIFYESYSDKKRDQLYEEIQNSLAKLGT* |
| Ga0137380_105123013 | 3300012206 | Vadose Zone Soil | MMKDEELRTLLRKRGYRVLELNYTGYTDKKRDELYREIVKQLGRE* |
| Ga0137380_105918381 | 3300012206 | Vadose Zone Soil | QMMKDEELRILLRKRGYRVLELYYDSYSNLKRDKLYRQLLGSLGKE* |
| Ga0137380_114697152 | 3300012206 | Vadose Zone Soil | KDEELRTLLRNRGYMVLELYYASYSDKKRDELYREILTSLGRS* |
| Ga0137381_104188381 | 3300012207 | Vadose Zone Soil | PHLRTIQMAKDEELRTLLRKRGYKVMELIYNSYSDKKRDELYQEILTQLGRE* |
| Ga0137381_104910793 | 3300012207 | Vadose Zone Soil | GLPHLRTIQMAKDEELRTLLRKRGYEVMELIYLSYSDKKRDELYQEIVKQLGRE* |
| Ga0137381_107097353 | 3300012207 | Vadose Zone Soil | QMAKDEELRSLLRKRGYRILELCYECYSDKKRDELYEGILSGLGNQ* |
| Ga0137379_108864971 | 3300012209 | Vadose Zone Soil | KDEELRSLLRKRGYRILELCYECYSDKKRDELYEGILSGLGNQ* |
| Ga0137379_113160361 | 3300012209 | Vadose Zone Soil | RSLLRRRGYRILELFYESYSDKKRDHLYEEILASLNRLTR* |
| Ga0137379_113272202 | 3300012209 | Vadose Zone Soil | RKKGYRVLELFYHNYSDKKRDELYEEILASLGRAGLW* |
| Ga0137379_117163402 | 3300012209 | Vadose Zone Soil | RTLLRKRGYRVLELSYTGYTDKKRDELYREILNGLGK* |
| Ga0137378_104747141 | 3300012210 | Vadose Zone Soil | IQMAKDEELRTLLRKRGYKVMELIYRSYSDKKRDELYQELVEQLGRE* |
| Ga0137378_104993962 | 3300012210 | Vadose Zone Soil | MMKDEELRTLLRKRGYRVLELSYTGYTDKKRDEFYREIANGLGK* |
| Ga0137378_110315171 | 3300012210 | Vadose Zone Soil | EELRSLLRKRGYRILELRYDRYSDKKRDKLYEEILEGLGIG* |
| Ga0137378_117435842 | 3300012210 | Vadose Zone Soil | QMVKDEELRTLLRKRGYRILELNYDSYSNKRRDELYQEILSNLGKE* |
| Ga0137387_100340912 | 3300012349 | Vadose Zone Soil | MSKDEELRTLLRKRGYRILEIFYESYSDKKRDQLYEEIQNSLAKLATSRV* |
| Ga0137387_100342911 | 3300012349 | Vadose Zone Soil | MKDEELRSLLLKRGYRILELSYNNYSDSKRDQLYEEIQNSLAKLTH* |
| Ga0137387_113294312 | 3300012349 | Vadose Zone Soil | QMIKDEELRTLLRKRGYRVVELGYANYSDKKRDELYQQLLSSLGRE* |
| Ga0137386_100175844 | 3300012351 | Vadose Zone Soil | MAKDEELRTLLRKRGYKVMELVYHNYSDKKRDELYQEIVKELGRE* |
| Ga0137386_100621705 | 3300012351 | Vadose Zone Soil | TEKDEELRTLLRKRGYRVLELCYDNYSDKKRDELCEEILANQGTN* |
| Ga0137386_100800863 | 3300012351 | Vadose Zone Soil | MRAIQMAKDEELRTLLRKRGYKIMELVYRSYSDKKRDELYQEIVKQLGRE* |
| Ga0137386_102518331 | 3300012351 | Vadose Zone Soil | QMMKDEELRTLLRKRGYRILEVSYSSYSDKKRDELYREILNGLGKQ* |
| Ga0137386_105559302 | 3300012351 | Vadose Zone Soil | MMKDEELRTLLRRRGYRVLELSYTGYTDKKRDEFYREIMNGLGK* |
| Ga0137366_111269521 | 3300012354 | Vadose Zone Soil | KDEELRTLLRKRGYRILELSYSSYTDRKRDELYQEIFQQLGRE* |
| Ga0137369_101956631 | 3300012355 | Vadose Zone Soil | RSLLRKRGYRILELVYSSYTDKKRDELYQEIFQQLGRE* |
| Ga0137384_100185441 | 3300012357 | Vadose Zone Soil | EELRSLLRKRGYRILELSYDYYSDKKRDELYEEVLNSLNRR* |
| Ga0137384_114543251 | 3300012357 | Vadose Zone Soil | VMKDEELRTLLRKKGHTLLELCYDNYSDKKRDQLYDEILANLGII* |
| Ga0137385_100333483 | 3300012359 | Vadose Zone Soil | MSKDEELRTLLRKRGYRILEIFYESYSDKKRDQLYEEIQNSLA |
| Ga0137385_104264753 | 3300012359 | Vadose Zone Soil | QMTKDEETRTLLRKRGYRVLELRYNDYSDKKRDQLYEELLDNLGKEYPVNSEN* |
| Ga0137385_106589731 | 3300012359 | Vadose Zone Soil | DEELRTLLRKRGYRILEIFYESYSDKKRDQLYEEIQNSLAKLGT* |
| Ga0137385_110615251 | 3300012359 | Vadose Zone Soil | DEELRTLLRKRGYRILEIFYESYSDKKRDQLYEEIQNSLAKLATSRV* |
| Ga0137361_108186131 | 3300012362 | Vadose Zone Soil | MMKDEELWPLLRKRGYRILELSYSSYTDKKRDEFYREIMNGLGK* |
| Ga0137419_106039081 | 3300012925 | Vadose Zone Soil | VKDEELRTLLRKRGYTILELSYSSYTDKKRDELYREILNGIGK* |
| Ga0137416_109986063 | 3300012927 | Vadose Zone Soil | MKDEELRTLLRKRGYRVLELSYTGYTDKKRDELCREILNGLGR* |
| Ga0137407_103375203 | 3300012930 | Vadose Zone Soil | MKGEELRTLLRNKGYRLLELCYDNYSDKKRDELYDEILANLGII* |
| Ga0134087_105013711 | 3300012977 | Grasslands Soil | RSLLRKRGYRILELYYDSYSGQKRDELYEQILDDLRRK* |
| Ga0134069_13099631 | 3300017654 | Grasslands Soil | SRIVKDEELRSLLRKRGYRVSELCYESYSDKIRDHLYEEIRNSLAKLAT |
| Ga0066655_107787411 | 3300018431 | Grasslands Soil | EELRTLLRKRGYRILELVYGSYTDKKGDALYREILNGLG |
| Ga0066667_109389242 | 3300018433 | Grasslands Soil | MAKDGELRTLLRKRGYKVIELVYRSYSGKKRDELYQEIVKQLGR |
| Ga0066662_100496594 | 3300018468 | Grasslands Soil | MMKDEELWTLLRKRGYRILELSYSSYTNKKGDELFREIVNKVGRE |
| Ga0066662_110186511 | 3300018468 | Grasslands Soil | MAKDEELRSLLRKRGYRVLELCYNSYSDKARDRLYQQVLNDLR |
| Ga0066662_117702491 | 3300018468 | Grasslands Soil | RTKNYRSLLRKRGYRILELSYSSYSDKKRNELYREILNGLGK |
| Ga0066662_121756921 | 3300018468 | Grasslands Soil | MAKDEELRTLLRKRGYKVMELIYRSYSDKKRDELYQEIVKQLGRE |
| Ga0209324_102846462 | 3300025174 | Soil | GKDEELRSLLRKRGYRVLELYYDNYSEKKRDKLYEEILDGLGKE |
| Ga0209431_105238341 | 3300025313 | Soil | KDEELRSLLRKRGYRVLELYYNSYSDKKRDQLYGEILNGLGKE |
| Ga0209234_10235793 | 3300026295 | Grasslands Soil | MAKDEELRTLLRNRGYKVMELVYRSYSDKKRDELFQEIVKQLGREESG |
| Ga0209235_11659971 | 3300026296 | Grasslands Soil | KTSQMTKDEETRTLLRKKGYRILELYYSNYSDKKRDQLYQDILAGLGRES |
| Ga0209236_10680983 | 3300026298 | Grasslands Soil | AQMMKDEELRTLLRKKGYRVLELSYTGYSDKKRDELYGEIMSHIGR |
| Ga0209055_11271663 | 3300026309 | Soil | EELRTLLLKKGYRLLELFYDNYSDKKRDELYDEILANLGII |
| Ga0209761_10294395 | 3300026313 | Grasslands Soil | MKDEELRTLLRKKGYRLLELCYDNYSDKKRDELYEEILANLGMT |
| Ga0209761_10526641 | 3300026313 | Grasslands Soil | DEELRTLLRKRGYRILELSYGSYTDKKRDELYREILNGLGK |
| Ga0209154_11368732 | 3300026317 | Soil | MSKDEELRTLLRKRGYRILELFYESYSDKKRDQLYEEIQNSLAKLGT |
| Ga0209154_12839461 | 3300026317 | Soil | MSKDEELRTLLRKRGYRILELFYESYSDKKRDQLYEEIQNSL |
| Ga0209472_10614711 | 3300026323 | Soil | EKSQMLKDEELRSLLRKRGYRVLELSYNSYSDKKRDELHEEIRSGLARLAS |
| Ga0209802_10859811 | 3300026328 | Soil | MAKDEELRTLLRKRGYRILELFYESYSDKKRDQLYEEIQNSLAKLGT |
| Ga0209056_100373436 | 3300026538 | Soil | DEELRTILRKRGYRILELVYSSYSDKKRDELYREVLNGLGK |
| Ga0209161_100624484 | 3300026548 | Soil | QMTKDEELRSLLRKRGYRILELFYDNYSDKKRDQLYQQVLDDLR |
| Ga0209388_10135943 | 3300027655 | Vadose Zone Soil | MKDEELRTLLRKRGYRVLELSYTGYTDKKRDELYREILNGLGK |
| Ga0209283_107401521 | 3300027875 | Vadose Zone Soil | KDEELRTLLRKRGYQILELYYSSYSEKKRDELYQEIVKQLGRE |
| Ga0209590_100280361 | 3300027882 | Vadose Zone Soil | MSQMKDEELRTILRKRGYRILELSYSSYSDKKRDELYREIMSGLGK |
| Ga0137415_100867894 | 3300028536 | Vadose Zone Soil | MKDEELRTLLRKRGYRVLELSYTGYTDKKRDELCREILNGLGR |
| Ga0307471_1015565882 | 3300032180 | Hardwood Forest Soil | MMKDEELRGILRKRGYRILELYYDSYSGKKRDELYNEILNGLGKENSGS |
| ⦗Top⦘ |