Basic Information | |
---|---|
Family ID | F072138 |
Family Type | Metagenome |
Number of Sequences | 121 |
Average Sequence Length | 49 residues |
Representative Sequence | RRWPAFKELATGGPDDVGNRKTLVPDAEKWGSRYEELVQLTALLGR |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.83 % |
% of genes near scaffold ends (potentially truncated) | 91.74 % |
% of genes from short scaffolds (< 2000 bps) | 87.60 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.463 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.744 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.579 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.017 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.08% β-sheet: 2.70% Coil/Unstructured: 66.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF09084 | NMT1 | 7.50 |
PF00672 | HAMP | 5.00 |
PF07355 | GRDB | 5.00 |
PF01850 | PIN | 3.33 |
PF13450 | NAD_binding_8 | 2.50 |
PF13343 | SBP_bac_6 | 1.67 |
PF17203 | sCache_3_2 | 1.67 |
PF09338 | Gly_reductase | 1.67 |
PF07075 | DUF1343 | 1.67 |
PF02776 | TPP_enzyme_N | 1.67 |
PF13551 | HTH_29 | 0.83 |
PF03023 | MurJ | 0.83 |
PF00027 | cNMP_binding | 0.83 |
PF05866 | RusA | 0.83 |
PF01314 | AFOR_C | 0.83 |
PF02452 | PemK_toxin | 0.83 |
PF13578 | Methyltransf_24 | 0.83 |
PF03372 | Exo_endo_phos | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 7.50 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 7.50 |
COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 1.67 |
COG0534 | Na+-driven multidrug efflux pump, DinF/NorM/MATE family | Defense mechanisms [V] | 0.83 |
COG0728 | Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis) | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
COG2244 | Membrane protein involved in the export of O-antigen and teichoic acid | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.83 |
COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 0.83 |
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.46 % |
Unclassified | root | N/A | 35.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664021|ICCgaii200_c0478818 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300000559|F14TC_104125476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 646 | Open in IMG/M |
3300000574|JGI1357J11328_10209445 | Not Available | 523 | Open in IMG/M |
3300003911|JGI25405J52794_10051662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 881 | Open in IMG/M |
3300004070|Ga0055488_10089770 | Not Available | 734 | Open in IMG/M |
3300004114|Ga0062593_101075596 | Not Available | 832 | Open in IMG/M |
3300004145|Ga0055489_10141212 | Not Available | 724 | Open in IMG/M |
3300004463|Ga0063356_102062690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 864 | Open in IMG/M |
3300004633|Ga0066395_10490782 | Not Available | 706 | Open in IMG/M |
3300004778|Ga0062383_10232277 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300004779|Ga0062380_10527365 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005093|Ga0062594_100811912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 867 | Open in IMG/M |
3300005289|Ga0065704_10464991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 694 | Open in IMG/M |
3300005295|Ga0065707_11007724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 537 | Open in IMG/M |
3300005332|Ga0066388_106346086 | Not Available | 596 | Open in IMG/M |
3300005332|Ga0066388_106409865 | Not Available | 593 | Open in IMG/M |
3300005344|Ga0070661_101755886 | Not Available | 526 | Open in IMG/M |
3300005440|Ga0070705_100686464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 803 | Open in IMG/M |
3300005518|Ga0070699_101172266 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300005518|Ga0070699_101606274 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300005547|Ga0070693_101471556 | Not Available | 531 | Open in IMG/M |
3300005586|Ga0066691_10248214 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300005617|Ga0068859_102912593 | Not Available | 524 | Open in IMG/M |
3300005764|Ga0066903_106673994 | Not Available | 600 | Open in IMG/M |
3300005840|Ga0068870_10871538 | Not Available | 634 | Open in IMG/M |
3300005843|Ga0068860_101413040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 717 | Open in IMG/M |
3300005844|Ga0068862_101775307 | Not Available | 626 | Open in IMG/M |
3300006049|Ga0075417_10088633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1391 | Open in IMG/M |
3300006797|Ga0066659_10519091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
3300006844|Ga0075428_100312398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1689 | Open in IMG/M |
3300006844|Ga0075428_100811457 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300006844|Ga0075428_102738465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
3300006845|Ga0075421_101123718 | Not Available | 881 | Open in IMG/M |
3300006845|Ga0075421_101873271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 643 | Open in IMG/M |
3300006852|Ga0075433_10251733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1567 | Open in IMG/M |
3300006852|Ga0075433_10258121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1545 | Open in IMG/M |
3300006904|Ga0075424_100451436 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300007076|Ga0075435_101491776 | Not Available | 593 | Open in IMG/M |
3300009087|Ga0105107_10788198 | Not Available | 661 | Open in IMG/M |
3300009088|Ga0099830_10403160 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300009098|Ga0105245_10109959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2562 | Open in IMG/M |
3300009162|Ga0075423_11759159 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300009553|Ga0105249_10830953 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300009597|Ga0105259_1056109 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 884 | Open in IMG/M |
3300009610|Ga0105340_1503931 | Not Available | 541 | Open in IMG/M |
3300009837|Ga0105058_1095533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 695 | Open in IMG/M |
3300010046|Ga0126384_10778474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 855 | Open in IMG/M |
3300010359|Ga0126376_10762565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 939 | Open in IMG/M |
3300010366|Ga0126379_11631645 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300010391|Ga0136847_12051831 | Not Available | 701 | Open in IMG/M |
3300010391|Ga0136847_12285860 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300010397|Ga0134124_10590011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1087 | Open in IMG/M |
3300010400|Ga0134122_12835268 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300010401|Ga0134121_10640698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1000 | Open in IMG/M |
3300011430|Ga0137423_1238820 | Not Available | 539 | Open in IMG/M |
3300011436|Ga0137458_1112162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 792 | Open in IMG/M |
3300012166|Ga0137350_1061401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfitobacterium → Desulfitobacterium hafniense → Desulfitobacterium hafniense Y51 | 739 | Open in IMG/M |
3300012199|Ga0137383_11158023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
3300012202|Ga0137363_10586642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 940 | Open in IMG/M |
3300012226|Ga0137447_1128864 | Not Available | 515 | Open in IMG/M |
3300012349|Ga0137387_10050845 | All Organisms → cellular organisms → Bacteria | 2763 | Open in IMG/M |
3300012355|Ga0137369_10033704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4661 | Open in IMG/M |
3300012360|Ga0137375_11125309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
3300012517|Ga0157354_1030021 | Not Available | 687 | Open in IMG/M |
3300012918|Ga0137396_10721799 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300012930|Ga0137407_11802207 | Not Available | 583 | Open in IMG/M |
3300012931|Ga0153915_10868043 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300012948|Ga0126375_11305220 | Not Available | 610 | Open in IMG/M |
3300013306|Ga0163162_10066545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3652 | Open in IMG/M |
3300014154|Ga0134075_10105255 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300014270|Ga0075325_1002249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3075 | Open in IMG/M |
3300014326|Ga0157380_13205372 | Not Available | 522 | Open in IMG/M |
3300014877|Ga0180074_1161030 | Not Available | 501 | Open in IMG/M |
3300015258|Ga0180093_1015915 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1506 | Open in IMG/M |
3300015358|Ga0134089_10025416 | Not Available | 2055 | Open in IMG/M |
3300015374|Ga0132255_103143088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 704 | Open in IMG/M |
3300015374|Ga0132255_105946808 | Not Available | 516 | Open in IMG/M |
3300017939|Ga0187775_10047822 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300018031|Ga0184634_10361592 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300018054|Ga0184621_10291470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 576 | Open in IMG/M |
3300018077|Ga0184633_10111417 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 1414 | Open in IMG/M |
3300018082|Ga0184639_10040481 | Not Available | 2393 | Open in IMG/M |
3300018082|Ga0184639_10040481 | Not Available | 2393 | Open in IMG/M |
3300018082|Ga0184639_10239221 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300018083|Ga0184628_10002488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8832 | Open in IMG/M |
3300018089|Ga0187774_10526494 | Not Available | 750 | Open in IMG/M |
3300018429|Ga0190272_11720968 | Not Available | 650 | Open in IMG/M |
3300018468|Ga0066662_10035299 | All Organisms → cellular organisms → Bacteria | 3025 | Open in IMG/M |
3300021090|Ga0210377_10302327 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300022214|Ga0224505_10166384 | Not Available | 848 | Open in IMG/M |
3300022694|Ga0222623_10075966 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
3300025324|Ga0209640_10480980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfitobacterium → Desulfitobacterium hafniense → Desulfitobacterium hafniense Y51 | 1015 | Open in IMG/M |
3300025931|Ga0207644_10366774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1172 | Open in IMG/M |
3300025931|Ga0207644_11004473 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira japonica | 700 | Open in IMG/M |
3300025961|Ga0207712_11054989 | Not Available | 722 | Open in IMG/M |
3300026075|Ga0207708_11529660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
3300026314|Ga0209268_1167247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
3300026323|Ga0209472_1245181 | Not Available | 574 | Open in IMG/M |
3300026324|Ga0209470_1010563 | All Organisms → cellular organisms → Bacteria | 5503 | Open in IMG/M |
3300026333|Ga0209158_1263172 | Not Available | 591 | Open in IMG/M |
3300026548|Ga0209161_10128324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1490 | Open in IMG/M |
3300027513|Ga0208685_1145761 | Not Available | 505 | Open in IMG/M |
3300027815|Ga0209726_10027592 | All Organisms → cellular organisms → Bacteria | 4531 | Open in IMG/M |
3300027815|Ga0209726_10080169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum aliphaticivorans | 2066 | Open in IMG/M |
3300027873|Ga0209814_10072049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1452 | Open in IMG/M |
3300027874|Ga0209465_10629743 | Not Available | 530 | Open in IMG/M |
3300027909|Ga0209382_10874414 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300031538|Ga0310888_10224886 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300031720|Ga0307469_10459315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1105 | Open in IMG/M |
3300031820|Ga0307473_10833831 | Not Available | 660 | Open in IMG/M |
3300031912|Ga0306921_11156917 | Not Available | 864 | Open in IMG/M |
3300031941|Ga0310912_11098597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
3300032059|Ga0318533_10793991 | Not Available | 695 | Open in IMG/M |
3300032144|Ga0315910_10546715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 895 | Open in IMG/M |
3300032157|Ga0315912_10054110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3177 | Open in IMG/M |
3300032180|Ga0307471_101495301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 834 | Open in IMG/M |
3300032770|Ga0335085_12237151 | Not Available | 549 | Open in IMG/M |
3300033417|Ga0214471_11236774 | Not Available | 567 | Open in IMG/M |
3300033475|Ga0310811_10833806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 851 | Open in IMG/M |
3300034148|Ga0364927_0001234 | All Organisms → cellular organisms → Bacteria | 3931 | Open in IMG/M |
3300034354|Ga0364943_0158511 | Not Available | 819 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.74% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.44% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.61% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.13% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.31% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 2.48% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.48% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.65% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.65% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.65% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.65% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.83% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.83% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.83% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300012166 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICCgaii200_04788181 | 2228664021 | Soil | MISKKGQEIAFKQRRWPASKDLAAGGPDDVGNRNTLVPDAEKWGSRYEELVQLTKVLGN |
F14TC_1041254761 | 3300000559 | Soil | RWPALKELATGGPDDVGNRNTLVPDSEKWGSRYEELVQLTALLGR* |
JGI1357J11328_102094452 | 3300000574 | Groundwater | MLSRKAQEIAQRQIRWPAHKDLATGATDEVGNRKTLVPDGDKWGARFEELVQLTGLLER* |
JGI25405J52794_100516622 | 3300003911 | Tabebuia Heterophylla Rhizosphere | KRWPAFKELAAGGPDDVGNRNTLVPDADKWGSRYQELVQLSAVLGR* |
Ga0055488_100897701 | 3300004070 | Natural And Restored Wetlands | AFKELATGGPDDIGNRNTLVPDAEKWGSRYQELVQLTALLGG* |
Ga0062593_1010755962 | 3300004114 | Soil | IAFKQRRWPAFKDLATGGPDDVGNRNTLVPDAEKWGSRYEELVQLMALLGR* |
Ga0055489_101412122 | 3300004145 | Natural And Restored Wetlands | HKDLASGATDEVGNRKTLVPDAEQWGARFEELVQLTGLLER* |
Ga0063356_1020626902 | 3300004463 | Arabidopsis Thaliana Rhizosphere | QRRWPAFKDLATGGPDDVGNRNTLVPDAEKWGSRYEELVQLTKVLGN* |
Ga0066395_104907822 | 3300004633 | Tropical Forest Soil | KKGQEIAFKQRRWPAFKDLATGGADDVGNRNTLVPDPDKWGSRYEELVQLTSLLGR* |
Ga0062383_102322773 | 3300004778 | Wetland Sediment | MLSKKGQEIAYRQTRWPAHKDLATGATDEVGNRKTLVPDADKWGARFEELVQLTGLLER* |
Ga0062380_105273651 | 3300004779 | Wetland Sediment | QTRWPAHKDLATGATDEVGNRKTLVPDADKWGARFEELVQLTGLLER* |
Ga0062594_1008119122 | 3300005093 | Soil | KQRRWPAFKELATGGPDDVGNRKTLVPDAEKWGSRYEELVQLTALLGR* |
Ga0065704_104649912 | 3300005289 | Switchgrass Rhizosphere | FRQRRWPAFKELATGGPDDVGNRKTLVPDADKWGSRYQELVQLSAVLGR* |
Ga0065707_110077242 | 3300005295 | Switchgrass Rhizosphere | KELATGGPDDVGNRKTLVPDADKWGSRYQELVQLSAVLGR* |
Ga0066388_1063460862 | 3300005332 | Tropical Forest Soil | KGQELAFRQKRWPAFKELAAGGPDDVGNRNTLVPDADKWGSRYQELVQLSAVLGR* |
Ga0066388_1064098652 | 3300005332 | Tropical Forest Soil | KGQELAFRQKRWPAFKELAAGGPDDVGNRNTLVPDADKWGSRYQELVQLSVVLGR* |
Ga0070661_1017558862 | 3300005344 | Corn Rhizosphere | KRGQEIAFKQRRWPAFKELATGGPDDVGNRKTLVPDAEKWGSRYEELVQLTALLGR* |
Ga0070705_1006864641 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RQNRWPAHRDLATGGPDEVGNRKTLVPDSEKWGARYEELVQLTGLLER* |
Ga0070699_1011722661 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RWPALKDLATGGPDDVGNRNTLVPDAEKWGSRYEELVQLTALLGR* |
Ga0070699_1016062742 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | IAYRQNRWPAYKELATGGPDDVGNRKTLVPDGDKWGSRYEELVQLSALLGR* |
Ga0070693_1014715561 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | KDLATGGPDEVGNRKTVVPDADKWGARFEELVQLTGLLER* |
Ga0066691_102482141 | 3300005586 | Soil | YKALASGGPDDVGNRKTLIPDGDKWGSRYEELVQLTALLGR* |
Ga0068859_1029125931 | 3300005617 | Switchgrass Rhizosphere | GQEIAFKQRRWPAFKELATGGPDDVGNRKTLVPDAEKWGSRYEELVQLTALLGR* |
Ga0066903_1066739941 | 3300005764 | Tropical Forest Soil | QELAFRQKRWPAFKELAAGGPDDVGNRNTLVPDADKWGSRYQELVQLSAVLGR* |
Ga0068870_108715382 | 3300005840 | Miscanthus Rhizosphere | FKQRRWPAFKDLAVGGPDDVGSRKTLVPDADKWGSRYEELVQLTALLGR* |
Ga0068860_1014130402 | 3300005843 | Switchgrass Rhizosphere | FKQRRWPAFKELATGGPDDVGNRKTLVPDAEKWGSRYEELVQLTALLGR* |
Ga0068862_1017753071 | 3300005844 | Switchgrass Rhizosphere | DLATGGPDEVGNRKTVVPDADKWGARFEELVQLTGLLER* |
Ga0075417_100886332 | 3300006049 | Populus Rhizosphere | SKKGQEIAFKQRRWPALKELATGGPDDVGNRNTLVPDSEKWGSRYEELVQLTALLGR* |
Ga0066659_105190911 | 3300006797 | Soil | MLSKRGQETAFRQRRWPAFKELASGGPDDVGNRNTLVPDADKWGSRYRELVQLSAVLKR* |
Ga0075428_1003123983 | 3300006844 | Populus Rhizosphere | FKELAAGGPDDVGNRNTLVPDADKWGSRYQELVQLSAVLGR* |
Ga0075428_1008114572 | 3300006844 | Populus Rhizosphere | QEIAFKQRRWPASKDLAAGGPDDVGNRNTLVPDAEKWGSRYEELVQLTKVLGN* |
Ga0075428_1027384651 | 3300006844 | Populus Rhizosphere | TGGPDDVGNRNTLVPDTEKWGSRYEELVQLTGLLGR* |
Ga0075421_1011237181 | 3300006845 | Populus Rhizosphere | YRQNRWPAHRDLATGGADEVGNRKTLVPDSEKWGARFEELVQLTGLLER* |
Ga0075421_1018732712 | 3300006845 | Populus Rhizosphere | QEMAYRQNRWPAHRDLATGGPDEVGNRKTLVPDSEKWGARYEELVQLTGLLER* |
Ga0075433_102517331 | 3300006852 | Populus Rhizosphere | QEIAFKQRRWPALKDLATGGPDDVGNRNTLVPDAEKWGSRYEELVQLTALLGR* |
Ga0075433_102581211 | 3300006852 | Populus Rhizosphere | RRWPAFKELATGGPDDVGNRKTLVPDAEKWGSRYQELVQLSAMLGR* |
Ga0075424_1004514362 | 3300006904 | Populus Rhizosphere | QGRWPAYKELATGGRDDVGNRKTVVPDGDKWGSRYEELVQLTSLLGR* |
Ga0075435_1014917762 | 3300007076 | Populus Rhizosphere | TGGRDDVGNRKTVVPDGDKWGSRYEELVQLTSLLGR* |
Ga0105107_107881982 | 3300009087 | Freshwater Sediment | AYRQTRWPAHKDLATGATDEVGNRKTLVPDADKWGARFEELVQLTGLLER* |
Ga0099830_104031602 | 3300009088 | Vadose Zone Soil | RWPAYKELATGGPDDVGNRKTLVPDGDKWGSRYEELVQLSALLGR* |
Ga0105245_101099595 | 3300009098 | Miscanthus Rhizosphere | AVGGPDDVGSRKTLVPDADKWGSRYEELVQLTALLGR* |
Ga0075423_117591592 | 3300009162 | Populus Rhizosphere | RQRRWPAFKDLATGGPDDVGNRKTLVPDADKWGSRYQELVQLSTVLAR* |
Ga0105249_108309532 | 3300009553 | Switchgrass Rhizosphere | AFKQRRWPAFKELATGGPDDVGNRNTLVPDAEKWGSRYEELVQLTALLGR* |
Ga0105259_10561091 | 3300009597 | Soil | KGQEIAFRQRRWPAFKELATGGPDDIGNRNTLVPDAEKWGSRYQELVQLTALLGR* |
Ga0105340_15039311 | 3300009610 | Soil | RQNRWPAHRDLATGGADEVGNRKTLVPDSEKWGVRYEELVQLTGLLER* |
Ga0105058_10955332 | 3300009837 | Groundwater Sand | FKELATAGPDDVGNRNTLVPDADKWGSRYQELVQLSAVLGR* |
Ga0126384_107784741 | 3300010046 | Tropical Forest Soil | RWPAFRELAAGGPDDVGNRNTLVPDADKWGSRYQELVQLSAVLGR* |
Ga0126376_107625652 | 3300010359 | Tropical Forest Soil | FRQKRWPAFKELAAGGPDDVGNRNTLVPDADKWGSRYQELVQLSAVLGR* |
Ga0126379_116316452 | 3300010366 | Tropical Forest Soil | YRQNRWPAPKELATGGSDDVGNRKTVVPNADKWGSRYEELVQLSNLLDR* |
Ga0136847_120518312 | 3300010391 | Freshwater Sediment | MLSRKCLEIACRQNRWPAHRDLATGGPDEVGTRKTLVPDSEKWGARFEELVQLTGLLER* |
Ga0136847_122858601 | 3300010391 | Freshwater Sediment | LATGGADEVGNRKTLVPDSDKWGARFEELVQLTGLLER* |
Ga0134124_105900112 | 3300010397 | Terrestrial Soil | RRWPAFKELATGGPDDVGNRKTLVPDAEKWGSRYEELVQLTALLGR* |
Ga0134122_128352681 | 3300010400 | Terrestrial Soil | GQEMAYRQNRWPAHRDLATGGPDEVGNRKTLVPDSEKWGARYEELVQLTGLLER* |
Ga0134121_106406981 | 3300010401 | Terrestrial Soil | RQNRWPAYKELATGGPDEVGNRKTVVPDAEKWGARFEELVQLSGILQK* |
Ga0137423_12388202 | 3300011430 | Soil | RKGQEIAFRQRRWPAHRELATGGPDDVGSRKTLVPDAEKWGSRYEELVQLTALFGR* |
Ga0137458_11121622 | 3300011436 | Soil | RWPAHRDLATGGADEVGNRKTLVPDSEKWGVRYEELVQLTGLLER* |
Ga0137350_10614011 | 3300012166 | Soil | GGPDDVGSRKTLVPDAEKWGSRYEELVQLTALFGR* |
Ga0137383_111580231 | 3300012199 | Vadose Zone Soil | IAYRQGRWPAYKELASGGPDDVGNRTVIPDGDKWGSRYEELVQLTALLGR* |
Ga0137363_105866421 | 3300012202 | Vadose Zone Soil | ETAFRQRRWPAFKELASGGPDDVGNRNTLVPDADKWGSRYRELVQLSAVLKRLWVKS* |
Ga0137447_11288642 | 3300012226 | Soil | WPAHRDLATGGADEVGTRKTLVPDSEKWGARFEELVQLTGWLER* |
Ga0137387_100508454 | 3300012349 | Vadose Zone Soil | AYKELASGGPDDVGNRTVIPDGDKWGSRYEELVQLTALLGR* |
Ga0137369_100337045 | 3300012355 | Vadose Zone Soil | SKKGQEIAFKQRRWPALKELATGGPDDVGNRNTLVPDAEKWGSRYEELVQLTGLLGR* |
Ga0137375_111253091 | 3300012360 | Vadose Zone Soil | IAFKRGRWPALKELATGGPDDVGNRNTLVPDSEKWGSRYEELVQLTALLGR* |
Ga0157354_10300211 | 3300012517 | Unplanted Soil | KELATGGADDVGNRKTLVPDADKWGSRYQELVQLSTVLAR* |
Ga0137396_107217991 | 3300012918 | Vadose Zone Soil | QRRWPALKDLATGGPDDVGNRNTLVPDAEKWGSRYEELVQLTALLGR* |
Ga0137407_118022071 | 3300012930 | Vadose Zone Soil | RRWPAFKELATGGPDDVGNRNTLVPDADKWGSRYQELVQLSAVLGR* |
Ga0153915_108680431 | 3300012931 | Freshwater Wetlands | RWPAFKELASGGPDDVGNRNTLVPDAEKWGSRYEELVQLTKVLER* |
Ga0126375_113052202 | 3300012948 | Tropical Forest Soil | MLSKKGQELAFRQKRWPAFKELAAGGPDDVGNRKTLVPDADKWGSRYQELVQLSAVLGR* |
Ga0163162_100665454 | 3300013306 | Switchgrass Rhizosphere | LSKKGQELAFKQRRWPAFKELATGGPDDVGNRNTLVPDAEKWGSRYEELVQLTALLGR* |
Ga0134075_101052551 | 3300014154 | Grasslands Soil | WPAYKELASGGPDDVGNRKTLIPDGDKWGSRYEELVQLTALLGR* |
Ga0075325_10022494 | 3300014270 | Natural And Restored Wetlands | QEIAFKQRRWPAFKDLASGGPDDVGNRNTLVPDAEKWGSRYEELVQLSAVLGR* |
Ga0157380_132053721 | 3300014326 | Switchgrass Rhizosphere | QTRWPAHKDLATGGPDEVGNRKTLVPASEKWGARYEELVQLTGLLER* |
Ga0180074_11610301 | 3300014877 | Soil | MTGWLFHALEKGQEIAYRQTRWPAHKDLATGGPDEVGNRKTLVPDADKWGARFEELVQ |
Ga0180093_10159153 | 3300015258 | Soil | SRKGQEIAFRQRRWPAFKELATGGPDDIGNRNTLVPDAEKWGSRYQELVQLTALLGR* |
Ga0134089_100254161 | 3300015358 | Grasslands Soil | AYRQGRWPAYKALASGGPDDVGNRKTLIPDGDKWGSRYEELVQLTALLGR* |
Ga0132255_1031430882 | 3300015374 | Arabidopsis Rhizosphere | WPALKELATGGPDHVGNRKTLVPDAEKWGSRYEELVQLTALLGR* |
Ga0132255_1059468081 | 3300015374 | Arabidopsis Rhizosphere | KKGQEIAYRQNRWPAYKELATGGPDEVGTRKTVVPDAEKWGARFEELVQLSGSLQK* |
Ga0187775_100478222 | 3300017939 | Tropical Peatland | RQTRWPAYKELSTGATDEVGNRKTLVPDGDKWGARFEELVQLTGLLER |
Ga0184634_103615922 | 3300018031 | Groundwater Sediment | VPMSFFAHAVRWPAHKDLATGGADEVGNRKTLVPDADKWGARFEELVQITRLLEW |
Ga0184621_102914702 | 3300018054 | Groundwater Sediment | RWPAFKELATGGPDDVGNRNTLVPDADKWGSRYQELVQLSTVLGR |
Ga0184633_101114172 | 3300018077 | Groundwater Sediment | VAYRQNRWPGYRDLATGGADEVGNRKTLVPDSEKWDARLEELVQLTGLLKR |
Ga0184639_100404814 | 3300018082 | Groundwater Sediment | VAYRQNRWPGYRDLATGGADEVGNRKTLVPDSEKWDARFEELVQLTGLLKR |
Ga0184639_100404816 | 3300018082 | Groundwater Sediment | FMLSTKGQEMASRQNRRPAPNDVAAGGPDEVGNRKTLVPDSEKWGARFEELVQLTGLLER |
Ga0184639_102392214 | 3300018082 | Groundwater Sediment | ELATGGPDEVGNRKTLVPDSEKWGARFEELVQLTGLLEK |
Ga0184628_100024881 | 3300018083 | Groundwater Sediment | TGATDEVGNRKTLVPDSDKWGARFEELVQLTALLER |
Ga0187774_105264942 | 3300018089 | Tropical Peatland | AYKYLCAGATDEVGNRKTLVPDGDKWGARFEELVQLTGLLER |
Ga0190272_117209682 | 3300018429 | Soil | QEIAYRQTRWPAHKDLATGATDEVGSRKTVVPDADKWGARFEELVQLTALLER |
Ga0066662_100352991 | 3300018468 | Grasslands Soil | LASGGPDDVGNRKTLIPDGDKWGSRYEELVQLTALLGR |
Ga0210377_103023273 | 3300021090 | Groundwater Sediment | MTGWLFHALEKGQEIAYRQTRWPAHKDLATGGPDEVGNRKTLVPDADKWGARFEELVQLT |
Ga0224505_101663843 | 3300022214 | Sediment | AHKDLATGATDEVGHKKTLVPDADKWGARFEELVQLTGLLER |
Ga0222623_100759661 | 3300022694 | Groundwater Sediment | WPALKELATGGPDDVGNRNTLVPDAEKWGSRYEELVQLTGLLGR |
Ga0209640_104809802 | 3300025324 | Soil | GGPDDVGSRKTLVPDAEKWGSRYEELVQLTALFGR |
Ga0207644_103667741 | 3300025931 | Switchgrass Rhizosphere | LAVGGPDDVGSRKTLVPDADKWGSRYEELVQLTALLGR |
Ga0207644_110044731 | 3300025931 | Switchgrass Rhizosphere | KGQEIAYKQNRWPAYRELASGGADDVGNRKTLVPDADKWGARFEELVQLSNLLDK |
Ga0207712_110549892 | 3300025961 | Switchgrass Rhizosphere | SRKGQEIAYRQTRWPAHKDLATGGPDEVGNRKTVVPDADKWGARFEELVQLTGLLER |
Ga0207708_115296602 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSKKGQEMAYRQNRWPAHRDLATGGPDEVGNRKTLVPDSEKWGARYEELVQLTGLLER |
Ga0209268_11672472 | 3300026314 | Soil | PAYKELASGGPDDVGNRKTLIPDGDKWGSRYEELVQLTALLGR |
Ga0209472_12451811 | 3300026323 | Soil | QGRWPAYKELASGGPDDVGNRKTLIPDGDKWGSRYEELVQLTALLGR |
Ga0209470_10105636 | 3300026324 | Soil | FMLSKRGQGIAYRQGRWPAYKELASGGPDDVGNRTVIPDGDKWGSRYEELVQLTALLGR |
Ga0209158_12631721 | 3300026333 | Soil | ALASGGPDDVGNRKTLIPDGDKWGSRYEELVQLTALLGR |
Ga0209161_101283242 | 3300026548 | Soil | MLSKKGQGIAYRQGRWPAYKALASGGPDDVGNRKTLIPDGDKWGSRYEELVQLTALLGR |
Ga0208685_11457611 | 3300027513 | Soil | RDLATGATDEVGNRKTVVPDSDKWGARFEELVQLTALLER |
Ga0209726_100275924 | 3300027815 | Groundwater | MLSRKAQEIAQRQIRWPAHKDLATGATDEVGNRKTLVPDGDKWGARFEELVQLTGLLER |
Ga0209726_100801691 | 3300027815 | Groundwater | MLSRKAQEIAYRQTRWPAHKDLATGAADEVGNRKTVVPDSDKWGARFEELVQLTGLLEK |
Ga0209814_100720492 | 3300027873 | Populus Rhizosphere | KKGQEIAFKQRRWPALKELATGGPDDVGNRNTLVPDSEKWGSRYEELVQLTALLGR |
Ga0209465_106297431 | 3300027874 | Tropical Forest Soil | KKGQEIAFKQRRWPAFKDLATGGADDVGNRNTLVPDPDKWGSRYEELVQLTSLLGR |
Ga0209382_108744143 | 3300027909 | Populus Rhizosphere | YRQNRWPAHRDLATGGADEVGNRKTLVPDSEKWGARFEELVQLTGLLER |
Ga0310888_102248862 | 3300031538 | Soil | TGGPDDVGNRNTLVPDAEKWGSRYEELVQLTALLGR |
Ga0307469_104593151 | 3300031720 | Hardwood Forest Soil | QELAFRQKRWPAFKELAAGGPDDVGNRNTLVPDADKWGSRYQELVQLSAVLGR |
Ga0307473_108338311 | 3300031820 | Hardwood Forest Soil | ATGGSDDVGNRKTVVPNGDKWGSRYEELVQLSGLLGR |
Ga0306921_111569171 | 3300031912 | Soil | DLATGGADDVGNRNTLVPDPDKWGSRYEELVQLTSLLGR |
Ga0310912_110985972 | 3300031941 | Soil | MLSKKGQETAFRQRRWPAFKELASGGPDDVGNRNTLVPDADKWGSRYQELVQLSAVLRR |
Ga0318533_107939911 | 3300032059 | Soil | PAFKDLATGGADDVGNRNTLVPDPDKWGSRYEELVQLTSLLGR |
Ga0315910_105467152 | 3300032144 | Soil | GGPDDVGNRNTLVPDAEKWGSRYEELVQLTAVLGR |
Ga0315912_100541104 | 3300032157 | Soil | MLSKKGQEIAYRQTRWPAHKDLATGATDEVGNRKTLVPDSDKWGARFEELVQLTGLLER |
Ga0307471_1014953011 | 3300032180 | Hardwood Forest Soil | GGADEVGNRKTLVPDSEKWGARFEELVQLTGLLER |
Ga0335085_122371511 | 3300032770 | Soil | GQEIAFRQRRWPAFKELASGGPDDVGNRNTLVPDADKWGSRYQELVQLSAVLRR |
Ga0214471_112367742 | 3300033417 | Soil | QRRWPALKELATGGPDDVGSRKTVVPDAEKWGSRYEELVQLTALFGR |
Ga0310811_108338062 | 3300033475 | Soil | PAFKELATGGPDDVGNRKTLVPDAEKWGSRYEELVQLTALLGR |
Ga0364927_0001234_3_113 | 3300034148 | Sediment | TGGPDDIGNRNTLVPDAEKWGSRYQELVQLTALLGR |
Ga0364943_0158511_3_179 | 3300034354 | Sediment | LSKKGQEIAYRQTRWPAHRDLATGATDEVGNRKTLVPDSDKWGARFEELVQLTALLER |
⦗Top⦘ |