| Basic Information | |
|---|---|
| Family ID | F072110 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAGDETKRT |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 94.12 % |
| % of genes near scaffold ends (potentially truncated) | 98.35 % |
| % of genes from short scaffolds (< 2000 bps) | 92.56 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (70.248 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (36.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.025 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.719 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.11% β-sheet: 0.00% Coil/Unstructured: 88.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.17 % |
| Unclassified | root | N/A | 19.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109234232 | Not Available | 647 | Open in IMG/M |
| 3300003394|JGI25907J50239_1054784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
| 3300004125|Ga0066182_10146001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300005346|Ga0074242_11625860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
| 3300005517|Ga0070374_10208394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
| 3300005581|Ga0049081_10101042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
| 3300006802|Ga0070749_10679899 | Not Available | 551 | Open in IMG/M |
| 3300006803|Ga0075467_10616960 | Not Available | 554 | Open in IMG/M |
| 3300006805|Ga0075464_10256219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1047 | Open in IMG/M |
| 3300006916|Ga0070750_10303510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300007234|Ga0075460_10324000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300007540|Ga0099847_1140818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300007540|Ga0099847_1225355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300007540|Ga0099847_1234856 | Not Available | 529 | Open in IMG/M |
| 3300007541|Ga0099848_1038139 | All Organisms → Viruses → Predicted Viral | 1975 | Open in IMG/M |
| 3300007542|Ga0099846_1147691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300007542|Ga0099846_1161107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300007973|Ga0105746_1333902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300008258|Ga0114840_1040467 | Not Available | 748 | Open in IMG/M |
| 3300008266|Ga0114363_1020450 | All Organisms → Viruses → Predicted Viral | 3691 | Open in IMG/M |
| 3300008266|Ga0114363_1048597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2840 | Open in IMG/M |
| 3300008450|Ga0114880_1014565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3784 | Open in IMG/M |
| 3300008450|Ga0114880_1077719 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
| 3300008450|Ga0114880_1194939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300009149|Ga0114918_10431270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300009181|Ga0114969_10586713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300009183|Ga0114974_10671229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300009184|Ga0114976_10536702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300010157|Ga0114964_10125539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1259 | Open in IMG/M |
| 3300010316|Ga0136655_1073705 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300010318|Ga0136656_1217712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300010354|Ga0129333_11672378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300010885|Ga0133913_12140740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1382 | Open in IMG/M |
| 3300012013|Ga0153805_1020688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10436401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300017699|Ga0181345_101881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300017701|Ga0181364_1012268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1439 | Open in IMG/M |
| 3300017701|Ga0181364_1051330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300017716|Ga0181350_1081953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300017722|Ga0181347_1130108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300017723|Ga0181362_1109174 | Not Available | 546 | Open in IMG/M |
| 3300017736|Ga0181365_1016400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1860 | Open in IMG/M |
| 3300017736|Ga0181365_1135712 | Not Available | 587 | Open in IMG/M |
| 3300017736|Ga0181365_1144821 | Not Available | 564 | Open in IMG/M |
| 3300017736|Ga0181365_1152618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300017761|Ga0181356_1024617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2187 | Open in IMG/M |
| 3300017761|Ga0181356_1112561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
| 3300017761|Ga0181356_1173442 | Not Available | 655 | Open in IMG/M |
| 3300017761|Ga0181356_1226059 | Not Available | 543 | Open in IMG/M |
| 3300017774|Ga0181358_1132224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
| 3300017774|Ga0181358_1216407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300017777|Ga0181357_1271044 | Not Available | 584 | Open in IMG/M |
| 3300017777|Ga0181357_1309930 | Not Available | 533 | Open in IMG/M |
| 3300017778|Ga0181349_1094080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
| 3300017778|Ga0181349_1317209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300017780|Ga0181346_1051331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1668 | Open in IMG/M |
| 3300017780|Ga0181346_1081271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1277 | Open in IMG/M |
| 3300017780|Ga0181346_1139804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
| 3300017780|Ga0181346_1146132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
| 3300017780|Ga0181346_1254035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300017784|Ga0181348_1305852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300017785|Ga0181355_1365293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300019784|Ga0181359_1056927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1501 | Open in IMG/M |
| 3300019784|Ga0181359_1146675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300019784|Ga0181359_1187433 | Not Available | 677 | Open in IMG/M |
| 3300019784|Ga0181359_1270637 | Not Available | 504 | Open in IMG/M |
| 3300020183|Ga0194115_10285538 | Not Available | 761 | Open in IMG/M |
| 3300020548|Ga0208856_1014023 | All Organisms → Viruses → Predicted Viral | 1247 | Open in IMG/M |
| 3300021962|Ga0222713_10048697 | Not Available | 3255 | Open in IMG/M |
| 3300021962|Ga0222713_10574473 | Not Available | 662 | Open in IMG/M |
| 3300021963|Ga0222712_10553322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300022063|Ga0212029_1016309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300022176|Ga0212031_1034729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300022176|Ga0212031_1061546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300022179|Ga0181353_1080658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300022190|Ga0181354_1135417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300022190|Ga0181354_1178547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300022407|Ga0181351_1209546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300023179|Ga0214923_10273236 | Not Available | 937 | Open in IMG/M |
| 3300024262|Ga0210003_1207403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300024262|Ga0210003_1391489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300024346|Ga0244775_10306197 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
| 3300024499|Ga0255195_1008826 | All Organisms → Viruses → Predicted Viral | 1652 | Open in IMG/M |
| 3300025508|Ga0208148_1035565 | Not Available | 1312 | Open in IMG/M |
| 3300025630|Ga0208004_1133496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300027130|Ga0255089_1059647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300027393|Ga0209867_1013405 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300027707|Ga0209443_1017975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3204 | Open in IMG/M |
| 3300027782|Ga0209500_10079506 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
| 3300027785|Ga0209246_10049731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1615 | Open in IMG/M |
| 3300027785|Ga0209246_10305814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300027798|Ga0209353_10121375 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
| 3300027808|Ga0209354_10410777 | Not Available | 525 | Open in IMG/M |
| 3300031539|Ga0307380_10644595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
| 3300031539|Ga0307380_10940346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300031565|Ga0307379_10280719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1654 | Open in IMG/M |
| 3300031565|Ga0307379_10638589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300031566|Ga0307378_10952893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300031746|Ga0315293_10793582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300031772|Ga0315288_10969462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
| 3300031772|Ga0315288_11122364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300031834|Ga0315290_11198367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300031857|Ga0315909_10025112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5899 | Open in IMG/M |
| 3300031951|Ga0315904_10713526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| 3300031999|Ga0315274_12006770 | Not Available | 520 | Open in IMG/M |
| 3300032050|Ga0315906_10203232 | All Organisms → Viruses → Predicted Viral | 1861 | Open in IMG/M |
| 3300032173|Ga0315268_10531136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1163 | Open in IMG/M |
| 3300032177|Ga0315276_11122960 | Not Available | 831 | Open in IMG/M |
| 3300032401|Ga0315275_10580777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1253 | Open in IMG/M |
| 3300034063|Ga0335000_0338993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
| 3300034063|Ga0335000_0788386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300034105|Ga0335035_0121068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1670 | Open in IMG/M |
| 3300034105|Ga0335035_0200447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1229 | Open in IMG/M |
| 3300034105|Ga0335035_0339307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300034112|Ga0335066_0412708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
| 3300034117|Ga0335033_0258043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
| 3300034121|Ga0335058_0706073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300034200|Ga0335065_0740469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300034356|Ga0335048_0134128 | All Organisms → Viruses → Predicted Viral | 1440 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 36.36% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.44% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 4.13% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.31% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.48% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.48% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.65% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.65% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.83% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.83% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.83% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.83% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.83% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300017699 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024499 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027130 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1092342322 | 3300002408 | Freshwater | MATTPYPFVAGAVLTASQLNSTFNVPVNNQTASYVL |
| JGI25907J50239_10547841 | 3300003394 | Freshwater Lake | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAGDETKRTMMNN |
| Ga0066182_101460011 | 3300004125 | Freshwater Lake | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAGDETKRTIMNSAS |
| Ga0074242_116258604 | 3300005346 | Saline Water And Sediment | MATPFPFVSGAVLPASSLNAITTLPINDQTASYTLVVGDVGKR |
| Ga0070374_102083941 | 3300005517 | Freshwater Lake | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAGDETKRT |
| Ga0049081_101010422 | 3300005581 | Freshwater Lentic | MTTPFPFVAGTVLTAAKLNAITTLPINDQTASYVA |
| Ga0070749_106798991 | 3300006802 | Aqueous | MTTPFPFVASTVLTAQQLNDITNLPINDQTANYVLLVSDAGKRVIMNNAGATTITVN |
| Ga0075467_106169602 | 3300006803 | Aqueous | MTTPFPFVAGQVLTATQLNDIQNLPISDKTASYTLIAGDETK |
| Ga0075464_102562191 | 3300006805 | Aqueous | MTTPFPFVAGAVLTAQQLNDITNLPINDQTASYVLVVGDAGKRVVMNV |
| Ga0070750_103035102 | 3300006916 | Aqueous | MATPYPYVSGTVLTAAQLNDGQNLPINDVTANYVLVNNDR |
| Ga0075460_103240002 | 3300007234 | Aqueous | MPTTPYPFVSGEVLLASDLNAIQNLPLNDKTDSYTLEVADAYKRVVMN |
| Ga0099847_11408182 | 3300007540 | Aqueous | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLLATDVFKRTIMNAAGA |
| Ga0099847_12253552 | 3300007540 | Aqueous | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLLATDVFKRTIMNAAGATTI |
| Ga0099847_12348561 | 3300007540 | Aqueous | MTTPFPFVAGAVLTAAQLNAITTLPINDQTDDYTLVVGDVGKRVIMNKATANT |
| Ga0099848_10381393 | 3300007541 | Aqueous | MATPFPFVAGAVLEAAELNAITTLPINDQTASYILVA |
| Ga0099846_11476911 | 3300007542 | Aqueous | MTTPFPFISGSVLQAQQLNDITNLPINDQTTSYTLAV |
| Ga0099846_11611072 | 3300007542 | Aqueous | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLVATDVFKRTIMNN |
| Ga0105746_13339022 | 3300007973 | Estuary Water | MTTPFPFVANAVLTAAQMNAITTLPVAAKTANYTLAVGDVGY |
| Ga0114840_10404671 | 3300008258 | Freshwater, Plankton | MTTPFPFVASAVLTAQQLNDITNLPINDQTANYTLVAGDAGKRV |
| Ga0114363_10204501 | 3300008266 | Freshwater, Plankton | MTTPFPFQASAVLTAQQLNDITNLPINDQTANYTLVAGDAGKRVIMN |
| Ga0114363_10485971 | 3300008266 | Freshwater, Plankton | MTTPFPFVASAVLTAQQLNDITNLPINDQTANYTLVAGDAGKRVIMN |
| Ga0114880_10145651 | 3300008450 | Freshwater Lake | MTTPFPFVAGQILTAAQLNDIQNLPISDKTASYVLIA |
| Ga0114880_10777192 | 3300008450 | Freshwater Lake | MTTPFPFVASAVLTAQQLNDITNLPINDQTANYTLVAGDAGKRVI |
| Ga0114880_11949392 | 3300008450 | Freshwater Lake | MTTPYPFVSGSVLTAQQLNYIQNLPISDKTTSYVLDVNDAYK |
| Ga0114918_104312701 | 3300009149 | Deep Subsurface | MTTPFPFVASTVLLAEQLNNIQNLPISVKTASYTLLATVVFTRTIMIAA |
| Ga0114969_105867131 | 3300009181 | Freshwater Lake | MTTPFPFVAAQVLTAQQLNDIQNLPISDKTASYTLTATDTYKRTIMNNAS |
| Ga0114974_106712292 | 3300009183 | Freshwater Lake | MTTPFPFVANTVLTAAQLNAITTLPVNAKTASYTLVVGDVGQR |
| Ga0114976_105367022 | 3300009184 | Freshwater Lake | MTTPFPFVANTVLTAAQLNAITTLPVNAKTASYTLVVGDVGQRVQM |
| Ga0114964_101255391 | 3300010157 | Freshwater Lake | MTTPFPFVANTVLTAAQLNAITTLPISAQTANYTLVVGDVGKR |
| Ga0136655_10737052 | 3300010316 | Freshwater To Marine Saline Gradient | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLLATDVFKRTIMNAAG |
| Ga0136656_12177121 | 3300010318 | Freshwater To Marine Saline Gradient | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLVATDVFK |
| Ga0129333_116723782 | 3300010354 | Freshwater To Marine Saline Gradient | MPTTPYPFVSGEVLLASDLNAIQNLPLNDKTDSYTLEVADAY |
| Ga0133913_121407402 | 3300010885 | Freshwater Lake | MTTPFPFVAAQVLTAAQLNDIQNLPISDKTASYTLI |
| Ga0153805_10206881 | 3300012013 | Surface Ice | MTTPFPFVASQVLTAQQLNDIQNLPISDKTASYTLIAGDE |
| (restricted) Ga0172373_104364012 | 3300013131 | Freshwater | MTTPFPFSSGEVLLAQDLNDIQNLPISDKTDSYTLAAGDETKRTIMN |
| Ga0181345_1018811 | 3300017699 | Freshwater Lake | MTTPFPFVANTILTAAQLNAVTTLPISAKTASATLVV |
| Ga0181364_10122681 | 3300017701 | Freshwater Lake | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAGDE |
| Ga0181364_10513301 | 3300017701 | Freshwater Lake | MTTPFPFVSGTVLTAQKLNDITNLPIEDKTANYVLVVGDAGKRVIMNAAGATTI |
| Ga0181350_10819532 | 3300017716 | Freshwater Lake | MSTPFPFVASSVLTAQQLNDIQNLPISDKTASYVLIAGDETKRTMMNSASATTITV |
| Ga0181347_11301081 | 3300017722 | Freshwater Lake | MTTPFPFVASQVLTAQQLNDIQNLPISDKTASYVL |
| Ga0181362_11091742 | 3300017723 | Freshwater Lake | MTTPFPFVSGTVLTAQKLNDITTLPLNDQVASYTAIVG |
| Ga0181365_10164003 | 3300017736 | Freshwater Lake | MTTPFPFVASQVLTAQQLNDIQNLPISDKTASYTLIAGDETKRTMMNNASAT |
| Ga0181365_11357121 | 3300017736 | Freshwater Lake | MTTPFPFVAGTVLTAAKLNAITTLPINDQTASYVALVGDVGKRIV |
| Ga0181365_11448212 | 3300017736 | Freshwater Lake | MTTPFPFVSGTVLTAAQLNDITNLPLNDQVASYTALVGDAGKRIVMNVA |
| Ga0181365_11526182 | 3300017736 | Freshwater Lake | MTTPYPFVSGQVLTAAQLNDIQNLPISDKTASYVLIAGDETKRTIMNAAGATTIT |
| Ga0181356_10246173 | 3300017761 | Freshwater Lake | MTTPFPFVANTILTAAQLNAVTTLPISAKTASATLVVGDVGYRVQ |
| Ga0181356_11125612 | 3300017761 | Freshwater Lake | MTTPFPFTQGQVLTAAQMNAITTLPINDQTASYVALVGDVG |
| Ga0181356_11734422 | 3300017761 | Freshwater Lake | MTTPFPFVSGTVLTAAQLNAITTLPINDQTASYVALVGDVGKRIVMNVA |
| Ga0181356_12260592 | 3300017761 | Freshwater Lake | MTTPFPLVSGTVLTAAQLNDITNLPLNDQVASYTALV |
| Ga0181358_11322242 | 3300017774 | Freshwater Lake | MTTPFPFVANTVLNASQLNAITTLPVNARTANYTL |
| Ga0181358_12164072 | 3300017774 | Freshwater Lake | MTTPFPFVASQVLTAQQLNDIQNLPISDKTASYTLVAGDETKRTIMNNASA |
| Ga0181357_12710442 | 3300017777 | Freshwater Lake | MTTPFPFQSAAVLTAAQMNAITTLATSTKTASHTLTIA |
| Ga0181357_13099302 | 3300017777 | Freshwater Lake | MTTPFPFVSGTVLTAAKLNDITNLPLNDQVASYTALVGDAGKR |
| Ga0181349_10940802 | 3300017778 | Freshwater Lake | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAGDETKRTMMNNASATT |
| Ga0181349_13172092 | 3300017778 | Freshwater Lake | MTTPFPFVANTILTAAQLNAVTTLPVNARTANYTLVVGDVGYRV |
| Ga0181346_10513311 | 3300017780 | Freshwater Lake | MATPFPFTFGQKLTSAQMNAITTLPINDQTASYTAVLGDVGKRIVMNVA |
| Ga0181346_10812712 | 3300017780 | Freshwater Lake | MTTPFPFVAAQVLTAQQLNDIQNLPISDKTASYTLIAGDE |
| Ga0181346_11398041 | 3300017780 | Freshwater Lake | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAGDETKRTMMNNAS |
| Ga0181346_11461322 | 3300017780 | Freshwater Lake | MTTPFPFVANTVLNASQLNAITTLPVNARTANYTLVVGDVGYRVQ |
| Ga0181346_12540352 | 3300017780 | Freshwater Lake | MTTPFPFVANTILTAAQLNAVTTLPISAKTASATLVVGDVGYRV |
| Ga0181346_12695332 | 3300017780 | Freshwater Lake | MATPFPFQAAAVLTAAQMNAITTLPVSTKTASYTAVVGDVGSRLVMNVA |
| Ga0181348_13058521 | 3300017784 | Freshwater Lake | MTTPFPFVANTILTAAQLNAVTTLPISAKTASATLVVGDVGYR |
| Ga0181355_13652931 | 3300017785 | Freshwater Lake | MTTPFPFVSGQVLTAAQLNDIQNLPISDKTASYTLIAGDE |
| Ga0181359_10569273 | 3300019784 | Freshwater Lake | MTTPFPFVSGTVLTAAQLNDITNLPLNDQVASYTALVGDAGKRIV |
| Ga0181359_11466751 | 3300019784 | Freshwater Lake | MTTPFPFVANTVLNASQLNAITTLPVNARTANYTLVVGDVGYRVQMTAA |
| Ga0181359_11874331 | 3300019784 | Freshwater Lake | MTTPFPFTQGQVLTAAQMNAITTLPINDQTASYVALVGDVGKR |
| Ga0181359_12706371 | 3300019784 | Freshwater Lake | MATPFPFSSGNTLLASQLNAITTLPINDQTASYVALVGDVGKRIVI |
| Ga0194115_102855381 | 3300020183 | Freshwater Lake | MATPFPFVANTVLTAAQLNAITELVINDKTASYTLVAGDAGERVI |
| Ga0208856_10140231 | 3300020548 | Freshwater | MATPFPFVSGSVLEASELNAITELPINAKTANHTLV |
| Ga0222713_100486973 | 3300021962 | Estuarine Water | VTTPFPFSTGQVLTATQLNNITTLPINDQTASYILVVGD |
| Ga0222713_105744731 | 3300021962 | Estuarine Water | MTTPFPFVAAATLTAAQMNAITTIPISTKTASYTA |
| Ga0222712_105533221 | 3300021963 | Estuarine Water | MTTPFPFVAGAVLTAQQLNDIQNLPISDKTASYTLIAGDETKRTI |
| Ga0212029_10163092 | 3300022063 | Aqueous | MTTPFPFVSGQILTAAQLNDIQNLPISDKTASYTLVVTDVFKRTIMNNAGAT |
| Ga0212031_10347292 | 3300022176 | Aqueous | MATPFPFVAGSVLEASELNAITELPINAKTANHTL |
| Ga0212031_10615462 | 3300022176 | Aqueous | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLVATDVFKRTIM |
| Ga0181353_10806581 | 3300022179 | Freshwater Lake | MTTPFPFTAGQVLTAAQMNDITNLPINDQTASYTLVVG |
| Ga0181354_11354171 | 3300022190 | Freshwater Lake | MTTPFPFVAAQVLTAQQLNDIQNLPISDKTASYTLIA |
| Ga0181354_11785472 | 3300022190 | Freshwater Lake | MTTPFPFVASTVLTAQQLNDIQNLPISDKTASYVLIAG |
| Ga0181351_12095462 | 3300022407 | Freshwater Lake | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYVLIAGDETKRTIMNNASATTIT |
| Ga0214923_102732361 | 3300023179 | Freshwater | MTTPFPFVSGAVLTAAQLNAITTLPINDQTASYTLVVGDVG |
| Ga0210003_12074032 | 3300024262 | Deep Subsurface | MATPFPFVSGAVLTAAQLNDIQNLPISDKTASYTLLVTDVFKRTIMNNAG |
| Ga0210003_13914891 | 3300024262 | Deep Subsurface | MTTPFPFVSGAVLTAAQLNDIQNLPISDKTASYTLLVT |
| Ga0244775_103061971 | 3300024346 | Estuarine | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTL |
| Ga0255195_10088261 | 3300024499 | Freshwater | MTTPFPFVAGQILTAAQLNDIQNLPISDKTASYVLVATDVFKRTI |
| Ga0208148_10355652 | 3300025508 | Aqueous | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYVLIAGDET |
| Ga0208004_11334961 | 3300025630 | Aqueous | MTTPFPFTAGQVLTAAELNDITNLPINDQTASYVLVAGDAGKRVIMNNAG |
| Ga0255089_10596472 | 3300027130 | Freshwater | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIASDVYKRTIM |
| Ga0209867_10134051 | 3300027393 | Sand | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAGDETKRTIMN |
| Ga0209443_10179751 | 3300027707 | Freshwater Lake | MTTPFPFVASQVLTAQQLNDIQNLPISDKTASYTLIA |
| Ga0209500_100795063 | 3300027782 | Freshwater Lake | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLTAT |
| Ga0209246_100497313 | 3300027785 | Freshwater Lake | MTTPFPFVAGTVLTAAKLNDITNLPLNDQVASYTALVGDAGKRIVMNVA |
| Ga0209246_103058141 | 3300027785 | Freshwater Lake | MTTPFPFVANTILTAAQLNAVTTLPISAKTASATLVVG |
| Ga0209353_101213751 | 3300027798 | Freshwater Lake | MTTPFPFVSGTVLTAAKLNDITNLPLNDQVASYTALVGD |
| Ga0209354_104107771 | 3300027808 | Freshwater Lake | MATPFPFGSGNTLLASQLNAITTLPINDQTASYVALVGDV |
| Ga0307380_106445952 | 3300031539 | Soil | MTTPFPFVSGAVLQAQQLNDIQNLPISDKTADYVLVVGDV |
| Ga0307380_109403462 | 3300031539 | Soil | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLLVTDVFKRTIMNAAGATTIT |
| Ga0307379_102807191 | 3300031565 | Soil | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLLVGDVTKRTIMNSASATTITVDD |
| Ga0307379_106385892 | 3300031565 | Soil | MATPFPFVAGSVLEASELNAITELPINAKTANHTLVAADA |
| Ga0307378_109528932 | 3300031566 | Soil | MTTPFPFVSGAVLQAQQLNDIQNLPISDKTASYTLLVGDV |
| Ga0315293_107935822 | 3300031746 | Sediment | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLI |
| Ga0315288_109694621 | 3300031772 | Sediment | MTTPFPFVASTVLTAQQLNDIQNLPISDKTASYVLIAGDETKRTMMNNAS |
| Ga0315288_111223642 | 3300031772 | Sediment | MTTPFPFVASTVLTAQQLNDIQNLPISDKTANYVL |
| Ga0315290_111983671 | 3300031834 | Sediment | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLTATDTYKRTIM |
| Ga0315909_1002511210 | 3300031857 | Freshwater | MTTPFPFQASAVLTAQQLNDITNLPINDQTANYTLVAGDAGKRVIMNNAGA |
| Ga0315285_106276761 | 3300031885 | Sediment | MATPFPFQAAAVLTAAQMNAITTLPISTKTASYVALVGDVGSRI |
| Ga0315904_107135261 | 3300031951 | Freshwater | MTTPFPFVSGAVLTAQQLNDITNLPINDQTASYILVVGDAGKRVIMNAAGATT |
| Ga0315274_120067702 | 3300031999 | Sediment | MTTPFPFQSAAVLTSTQMNAITTLPITTKTASAVAVVGDVGSRL |
| Ga0315906_102032321 | 3300032050 | Freshwater | MTTPFPFVASAVLTAQQLNDITNLPINDQTANYTLVAGDAGKRVIMNNAGA |
| Ga0315268_105311362 | 3300032173 | Sediment | MTTPFPFVAAQVLTAQQLNDIQNLPISDKTASYTLIAGDVTKRTIMNNASATTITVN |
| Ga0315276_111229603 | 3300032177 | Sediment | MTTPFPFVAAATLTAQQLNDIQNLPISDKTVSYVLIAGDETKRTIMN |
| Ga0315275_105807771 | 3300032401 | Sediment | MTTPFPFVASSVLTAQQLNDIQNLPISDKTANYVLIAGDETKRTIMN |
| Ga0335000_0338993_1_159 | 3300034063 | Freshwater | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAGDVTKRTIMNSASATT |
| Ga0335000_0788386_3_167 | 3300034063 | Freshwater | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAGDETKRTMMNNASATTIT |
| Ga0335035_0121068_1549_1668 | 3300034105 | Freshwater | MTTPFPFVSGAVLTAAQLNAITTLPISAKTANYTLAVGDV |
| Ga0335035_0200447_1104_1229 | 3300034105 | Freshwater | MTTPYPFVAGSVLTAQQLNDIQNLPISDKTASYVLIAGDETK |
| Ga0335035_0339307_3_158 | 3300034105 | Freshwater | MTTPFPFVASQVLTAQQLNDIQNLPISDKTASYTLIAGDETKRTMMNSASAT |
| Ga0335066_0412708_2_115 | 3300034112 | Freshwater | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAG |
| Ga0335033_0258043_755_910 | 3300034117 | Freshwater | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYVLIAGDETKRTIMNNASAT |
| Ga0335058_0706073_1_141 | 3300034121 | Freshwater | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYVLIAGDETKRTIMN |
| Ga0335065_0740469_430_555 | 3300034200 | Freshwater | MTTPFPFVAGNILEAQQLNDIQNLPISDKTASYVLTVADVYK |
| Ga0335048_0134128_1315_1440 | 3300034356 | Freshwater | MTTPFPFVAGQVLTAAQLNDIQNLPISDKTASYTLIAGDETK |
| ⦗Top⦘ |