Metagenome Family F072083

Basic Information
Family ID	F072083
Family Type	Metagenome
Number of Sequences	121
Average Sequence Length	43 residues
Representative Sequence	MNQNAKRNLQRRKRQATRLSKREYFRKKKEALNVSAAGKDKVA
Number of Associated Samples	110
Number of Associated Scaffolds	121

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	89.17 %
% of genes near scaffold ends (potentially truncated)	21.49 %
% of genes from short scaffolds (< 2000 bps)	79.34 %
Associated GOLD sequencing projects	103
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Most Common Taxonomy
Group	Bacteria (57.025 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.570 % of family members)
Environment Ontology (ENVO)	Unclassified (28.926 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (36.364 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 121 Family Scaffolds
PF01434	Peptidase_M41	4.96
PF00248	Aldo_ket_red	4.13
PF00155	Aminotran_1_2	3.31
PF06480	FtsH_ext	1.65
PF08719	NADAR	1.65
PF01636	APH	1.65
PF02586	SRAP	1.65
PF04909	Amidohydro_2	1.65
PF02826	2-Hacid_dh_C	0.83
PF00561	Abhydrolase_1	0.83
PF01467	CTP_transf_like	0.83
PF01336	tRNA_anti-codon	0.83
PF14497	GST_C_3	0.83
PF01258	zf-dskA_traR	0.83
PF03602	Cons_hypoth95	0.83
PF13531	SBP_bac_11	0.83
PF01370	Epimerase	0.83
PF06803	DUF1232	0.83
PF13328	HD_4	0.83
PF08309	LVIVD	0.83
PF00975	Thioesterase	0.83
PF04773	FecR	0.83
PF02655	ATP-grasp_3	0.83
PF09084	NMT1	0.83
PF00903	Glyoxalase	0.83
PF01641	SelR	0.83
PF01042	Ribonuc_L-PSP	0.83
PF05598	DUF772	0.83
PF12399	BCA_ABC_TP_C	0.83
PF13458	Peripla_BP_6	0.83
PF02604	PhdYeFM_antitox	0.83

COG ID	Name	Functional Category	% Frequency in 121 Family Scaffolds
COG0465	ATP-dependent Zn proteases	Posttranslational modification, protein turnover, chaperones [O]	6.61
COG3236	N-glycosidase YbiA/RibX (riboflavin biosynthesis, damage control), NADAR superfamily	Defense mechanisms [V]	1.65
COG2135	ssDNA abasic site-binding protein YedK/HMCES, SRAP family	Replication, recombination and repair [L]	1.65
COG2161	Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family	Defense mechanisms [V]	0.83
COG5276	Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain	Function unknown [S]	0.83
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.83
COG4118	Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor	Defense mechanisms [V]	0.83
COG3339	Uncharacterized membrane protein YkvA, DUF1232 family	Function unknown [S]	0.83
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	0.83
COG2265	tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family	Translation, ribosomal structure and biogenesis [J]	0.83
COG2242	Precorrin-6B methylase 2	Coenzyme transport and metabolism [H]	0.83
COG0229	Peptide methionine sulfoxide reductase MsrB	Posttranslational modification, protein turnover, chaperones [O]	0.83
COG1734	RNA polymerase-binding transcription factor DksA	Transcription [K]	0.83
COG1092	23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI	Translation, ribosomal structure and biogenesis [J]	0.83
COG0742	16S rRNA G966 N2-methylase RsmD	Translation, ribosomal structure and biogenesis [J]	0.83
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.83
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.83

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	57.02 %
Unclassified	root	N/A	42.98 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	57.02 %
Unclassified	root	N/A	42.98 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	57.02 %
Unclassified	root	N/A	42.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.98 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	29.75 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	2.48 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.83 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.98 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	19.83 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	2.48 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.65 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.83 %
Tenericutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.98 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	19.83 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	2.48 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.65 %
unclassified Mycoplasmatota	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota	0.83 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.98 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	15.70 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	2.48 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.65 %
Tenericutes bacterium ADurb.BinA155	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota → Tenericutes bacterium ADurb.BinA155	0.83 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.98 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.70 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	2.48 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.65 %
Tenericutes bacterium ADurb.BinA155	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota → Tenericutes bacterium ADurb.BinA155	0.83 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352025\|deepsgr__Contig_47866	All Organisms → cellular organisms → Bacteria	4810	Open in IMG/M
2209111006\|2214746905	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	916	Open in IMG/M
2209111006\|2214775235	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	781	Open in IMG/M
2228664022\|INPgaii200_c1049836	All Organisms → cellular organisms → Bacteria	3339	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c2139650	Not Available	865	Open in IMG/M
3300003991\|Ga0055461_10196443	Not Available	545	Open in IMG/M
3300003991\|Ga0055461_10213824	All Organisms → cellular organisms → Bacteria → Proteobacteria	524	Open in IMG/M
3300003997\|Ga0055466_10000244	All Organisms → cellular organisms → Bacteria → Proteobacteria	4770	Open in IMG/M
3300004009\|Ga0055437_10013825	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1767	Open in IMG/M
3300004011\|Ga0055460_10136317	All Organisms → cellular organisms → Bacteria	728	Open in IMG/M
3300004019\|Ga0055439_10050530	All Organisms → cellular organisms → Bacteria	1128	Open in IMG/M
3300004027\|Ga0055459_10192257	Not Available	567	Open in IMG/M
3300004049\|Ga0055493_10029716	All Organisms → cellular organisms → Bacteria	939	Open in IMG/M
3300004052\|Ga0055490_10147007	All Organisms → cellular organisms → Bacteria → Proteobacteria	691	Open in IMG/M
3300004114\|Ga0062593_101016858	All Organisms → cellular organisms → Bacteria	851	Open in IMG/M
3300004156\|Ga0062589_101675651	Not Available	633	Open in IMG/M
3300004156\|Ga0062589_102718109	Not Available	515	Open in IMG/M
3300004463\|Ga0063356_100513456	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	1589	Open in IMG/M
3300004463\|Ga0063356_100976743	All Organisms → cellular organisms → Bacteria	1206	Open in IMG/M
3300004479\|Ga0062595_101334081	Not Available	648	Open in IMG/M
3300004643\|Ga0062591_101052876	Not Available	779	Open in IMG/M
3300004778\|Ga0062383_10007845	All Organisms → cellular organisms → Bacteria	3400	Open in IMG/M
3300005294\|Ga0065705_10010142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2836	Open in IMG/M
3300005332\|Ga0066388_100829687	Not Available	1513	Open in IMG/M
3300005546\|Ga0070696_100025980	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3983	Open in IMG/M
3300005549\|Ga0070704_100393480	Not Available	1181	Open in IMG/M
3300005830\|Ga0074473_11176916	All Organisms → cellular organisms → Bacteria	948	Open in IMG/M
3300005836\|Ga0074470_10108593	All Organisms → cellular organisms → Bacteria → Proteobacteria	12555	Open in IMG/M
3300005895\|Ga0075277_1018611	Not Available	954	Open in IMG/M
3300006844\|Ga0075428_100040739	All Organisms → cellular organisms → Bacteria	5109	Open in IMG/M
3300006845\|Ga0075421_100679976	Not Available	1199	Open in IMG/M
3300006845\|Ga0075421_101257766	Not Available	822	Open in IMG/M
3300006845\|Ga0075421_101743776	Not Available	672	Open in IMG/M
3300006845\|Ga0075421_102129413	Not Available	594	Open in IMG/M
3300006846\|Ga0075430_100451159	Not Available	1061	Open in IMG/M
3300006852\|Ga0075433_11368545	Not Available	613	Open in IMG/M
3300006853\|Ga0075420_100624295	Not Available	930	Open in IMG/M
3300006880\|Ga0075429_101082555	Not Available	700	Open in IMG/M
3300007004\|Ga0079218_11634506	Not Available	709	Open in IMG/M
3300009087\|Ga0105107_10174563	All Organisms → cellular organisms → Bacteria → Proteobacteria	1509	Open in IMG/M
3300009091\|Ga0102851_11266854	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	814	Open in IMG/M
3300009111\|Ga0115026_11598507	Not Available	546	Open in IMG/M
3300009147\|Ga0114129_12499442	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
3300009162\|Ga0075423_10894365	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	941	Open in IMG/M
3300009162\|Ga0075423_11886095	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	645	Open in IMG/M
3300009167\|Ga0113563_10919959	Not Available	1000	Open in IMG/M
3300009553\|Ga0105249_11187060	Not Available	834	Open in IMG/M
3300009609\|Ga0105347_1008017	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3688	Open in IMG/M
3300009610\|Ga0105340_1046240	All Organisms → cellular organisms → Bacteria	1696	Open in IMG/M
3300010373\|Ga0134128_11586135	All Organisms → cellular organisms → Bacteria	720	Open in IMG/M
3300011414\|Ga0137442_1041999	Not Available	899	Open in IMG/M
3300011436\|Ga0137458_1135703	Not Available	728	Open in IMG/M
3300011441\|Ga0137452_1089113	Not Available	1008	Open in IMG/M
3300011443\|Ga0137457_1146443	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	782	Open in IMG/M
3300011444\|Ga0137463_1367994	Not Available	513	Open in IMG/M
3300012035\|Ga0137445_1062837	Not Available	734	Open in IMG/M
3300012113\|Ga0137328_1030363	Not Available	544	Open in IMG/M
3300012133\|Ga0137329_1010395	Not Available	1003	Open in IMG/M
3300012200\|Ga0137382_10070701	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2236	Open in IMG/M
3300012473\|Ga0157340_1022044	Not Available	544	Open in IMG/M
3300012513\|Ga0157326_1002669	All Organisms → cellular organisms → Bacteria	1895	Open in IMG/M
3300012891\|Ga0157305_10185188	Not Available	587	Open in IMG/M
3300012931\|Ga0153915_11002655	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	973	Open in IMG/M
3300012989\|Ga0164305_11584877	Not Available	584	Open in IMG/M
3300013297\|Ga0157378_12194907	Not Available	603	Open in IMG/M
3300013306\|Ga0163162_11036305	Not Available	928	Open in IMG/M
3300014296\|Ga0075344_1059825	All Organisms → cellular organisms → Bacteria	705	Open in IMG/M
3300014304\|Ga0075340_1053640	Not Available	712	Open in IMG/M
3300014317\|Ga0075343_1017685	All Organisms → cellular organisms → Bacteria	1205	Open in IMG/M
3300015245\|Ga0137409_10746128	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	814	Open in IMG/M
3300015371\|Ga0132258_13402243	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1092	Open in IMG/M
3300015372\|Ga0132256_103761555	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	510	Open in IMG/M
3300015373\|Ga0132257_100172714	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2546	Open in IMG/M
3300015373\|Ga0132257_100932686	All Organisms → cellular organisms → Bacteria	1090	Open in IMG/M
3300017930\|Ga0187825_10029881	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1834	Open in IMG/M
3300017936\|Ga0187821_10422919	Not Available	548	Open in IMG/M
3300018074\|Ga0184640_10259367	Not Available	789	Open in IMG/M
3300018079\|Ga0184627_10509295	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	619	Open in IMG/M
3300018083\|Ga0184628_10038105	All Organisms → cellular organisms → Bacteria	2413	Open in IMG/M
3300018084\|Ga0184629_10011042	All Organisms → cellular organisms → Bacteria → Proteobacteria	3513	Open in IMG/M
3300018422\|Ga0190265_10075987	All Organisms → cellular organisms → Bacteria → Proteobacteria	3054	Open in IMG/M
3300018422\|Ga0190265_13335796	Not Available	536	Open in IMG/M
3300018469\|Ga0190270_10131683	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1991	Open in IMG/M
3300018481\|Ga0190271_10050280	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3545	Open in IMG/M
3300020003\|Ga0193739_1013003	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2178	Open in IMG/M
3300021560\|Ga0126371_13019845	Not Available	570	Open in IMG/M
3300025324\|Ga0209640_10082637	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2775	Open in IMG/M
3300025537\|Ga0210061_1022524	All Organisms → cellular organisms → Bacteria	1029	Open in IMG/M
3300025912\|Ga0207707_10005952	All Organisms → cellular organisms → Bacteria	10669	Open in IMG/M
3300025933\|Ga0207706_10810496	Not Available	795	Open in IMG/M
3300025936\|Ga0207670_10669598	Not Available	857	Open in IMG/M
3300025959\|Ga0210116_1005303	All Organisms → cellular organisms → Bacteria	2244	Open in IMG/M
3300025961\|Ga0207712_11025429	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	733	Open in IMG/M
3300025988\|Ga0208141_1002503	All Organisms → cellular organisms → Bacteria	1344	Open in IMG/M
3300026535\|Ga0256867_10007540	All Organisms → cellular organisms → Bacteria → Proteobacteria	4780	Open in IMG/M
3300027364\|Ga0209967_1042372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	693	Open in IMG/M
3300027695\|Ga0209966_1150322	Not Available	542	Open in IMG/M
3300027778\|Ga0209464_10026275	All Organisms → cellular organisms → Bacteria	1852	Open in IMG/M
3300027876\|Ga0209974_10186743	Not Available	761	Open in IMG/M
3300027907\|Ga0207428_10035024	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	4107	Open in IMG/M
3300027909\|Ga0209382_10314763	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota → Tenericutes bacterium ADurb.BinA155	1762	Open in IMG/M
3300028587\|Ga0247828_11068704	Not Available	532	Open in IMG/M
3300030619\|Ga0268386_10033375	All Organisms → cellular organisms → Bacteria	4073	Open in IMG/M
3300030620\|Ga0302046_11399329	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	544	Open in IMG/M
(restricted) 3300031197\|Ga0255310_10053917	Not Available	1051	Open in IMG/M
3300031226\|Ga0307497_10194287	All Organisms → cellular organisms → Bacteria → Proteobacteria	875	Open in IMG/M
(restricted) 3300031237\|Ga0255334_1042096	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	509	Open in IMG/M
(restricted) 3300031248\|Ga0255312_1126659	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	630	Open in IMG/M
3300031547\|Ga0310887_11048126	Not Available	522	Open in IMG/M
3300031720\|Ga0307469_11363417	All Organisms → cellular organisms → Bacteria	675	Open in IMG/M
3300032004\|Ga0307414_11863220	Not Available	561	Open in IMG/M
3300032144\|Ga0315910_11426070	Not Available	540	Open in IMG/M
3300033412\|Ga0310810_10021885	All Organisms → cellular organisms → Bacteria	7724	Open in IMG/M
3300033413\|Ga0316603_12336155	Not Available	504	Open in IMG/M
3300033433\|Ga0326726_10338909	All Organisms → cellular organisms → Bacteria	1417	Open in IMG/M
3300033480\|Ga0316620_10163612	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1805	Open in IMG/M
3300033513\|Ga0316628_102288902	Not Available	715	Open in IMG/M
3300033513\|Ga0316628_104251953	All Organisms → cellular organisms → Bacteria → Proteobacteria	509	Open in IMG/M
3300033551\|Ga0247830_10599364	Not Available	872	Open in IMG/M
3300034149\|Ga0364929_0001726	All Organisms → cellular organisms → Bacteria	5116	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	72.73%
Host-Associated	Host-Associated	27.27%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	42.98%
Aquatic	Environmental → Aquatic	29.75%
Plants	Host-Associated → Plants	27.27%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	41.32%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.53%
Sediment	Environmental → Aquatic → Sediment	13.22%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.74%
Marine	Environmental → Aquatic → Marine	9.09%
Freshwater	Environmental → Aquatic → Freshwater	7.44%
Peat	Environmental → Terrestrial → Peat	0.83%
Floodplain	Environmental → Terrestrial → Floodplain	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	25.62%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.88%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	13.22%
Wetlands	Environmental → Aquatic → Marine → Wetlands	9.09%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	7.44%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.61%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	5.79%
Loam	Environmental → Terrestrial → Soil → Loam	5.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.13%
Sand	Environmental → Terrestrial → Soil → Sand	2.48%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.65%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.65%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.83%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	15.70%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.88%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	13.22%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	9.09%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	7.44%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.61%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.96%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	4.13%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.13%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.13%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.48%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	2.48%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.65%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.65%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.65%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.83%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.83%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.83%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.83%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	11.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.74%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	9.09%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	8.26%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	4.13%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.13%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	4.13%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.31%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.48%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.48%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	2.48%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	1.65%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.65%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.65%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	1.65%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.65%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.65%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.65%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.65%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	1.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.65%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.83%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.83%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.83%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.83%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.83%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.83%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.83%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.83%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.83%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.83%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.83%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.83%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental	Open in IMG/M
2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0	Host-Associated	Open in IMG/M
2228664022	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300003991	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1	Environmental	Open in IMG/M
3300003997	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1	Environmental	Open in IMG/M
3300004009	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2	Environmental	Open in IMG/M
3300004011	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2	Environmental	Open in IMG/M
3300004019	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2	Environmental	Open in IMG/M
3300004027	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2	Environmental	Open in IMG/M
3300004049	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2	Environmental	Open in IMG/M
3300004052	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300004778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005830	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005895	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300011414	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2	Environmental	Open in IMG/M
3300011436	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2	Environmental	Open in IMG/M
3300011441	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2	Environmental	Open in IMG/M
3300011443	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012035	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2	Environmental	Open in IMG/M
3300012113	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT100_2	Environmental	Open in IMG/M
3300012133	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012473	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610	Host-Associated	Open in IMG/M
3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Host-Associated	Open in IMG/M
3300012891	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014296	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1	Environmental	Open in IMG/M
3300014304	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1	Environmental	Open in IMG/M
3300014317	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental	Open in IMG/M
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018079	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300020003	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025324	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)	Environmental	Open in IMG/M
3300025537	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025959	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025988	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes)	Environmental	Open in IMG/M
3300026535	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)	Environmental	Open in IMG/M
3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)	Host-Associated	Open in IMG/M
3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)	Host-Associated	Open in IMG/M
3300027778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)	Environmental	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300030619	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)	Environmental	Open in IMG/M
3300030620	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111	Environmental	Open in IMG/M
3300031197 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031237 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_35cm_T3_129	Environmental	Open in IMG/M
3300031248 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
deepsgr_00495180	2199352025	Soil	MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKVA
2213757312	2209111006	Arabidopsis Rhizosphere	MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVLAAG
2213796119	2209111006	Arabidopsis Rhizosphere	MNQNAKRNLQRRKRQAMRLSKREYFRKKKEAANXSAGXDKVD
INPgaii200_10498363	2228664022	Soil	MNQNAKRNLQRRKRQATRLSKREYFKQKKEAINVSAAGKDKVS
ICChiseqgaiiDRAFT_21396503	3300000033	Soil	MNQNAKRNSQRRKRQANRLSKREYFKTKKEALNVAAAAKDXAP*
Ga0055461_101964431	3300003991	Natural And Restored Wetlands	MNQNAKRNLQRRKRQAARLSQREYFKSKKEAALKVPAEDKPKAA*
Ga0055461_102138242	3300003991	Natural And Restored Wetlands	MNQNAKRNLQRRKRQATRFSKREYFRKKKEAAIGSATGKSL*
Ga0055466_100002443	3300003997	Natural And Restored Wetlands	MNQNAKRNLQRRKRQAMRLAKREYFKKKKAAADPTSAVKNKVA*
Ga0055437_100138252	3300004009	Natural And Restored Wetlands	MNQNAKRNLQRRKRQATRLSKREYFRKKKEALNVSAAGKDKVG*
Ga0055460_101363173	3300004011	Natural And Restored Wetlands	MNQNAKRNLQRRKRQATRLSQREYFKSKKEAALKVPAEAKPKAA*
Ga0055439_100505302	3300004019	Natural And Restored Wetlands	MNQNAKRNLQRRKRQATRLSKREYFRKKKEAISVSAAGKDKVG*
Ga0055459_101922572	3300004027	Natural And Restored Wetlands	MNQNAKRNLQRRKRQAARLSQREYFKSKKEAALKVPAEAKPKAA*
Ga0055493_100297163	3300004049	Natural And Restored Wetlands	MNQNAKRNSQRRKRQANRLSKREYFKAKKEALKVAAAAKDGTA*
Ga0055490_101470072	3300004052	Natural And Restored Wetlands	MNQNAKRNLQRRKRQATRLSKREYFRKKKEAAIGSATGKSL*
Ga0062593_1010168582	3300004114	Soil	MNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATAVKAKTE*
Ga0062589_1016756511	3300004156	Soil	MNQNAKRNSQRRKRQANRLSKREYFKTKKEALNVAAAAKDRVA*
Ga0062589_1027181091	3300004156	Soil	GGHPVNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATAVKAKTE*
Ga0063356_1005134562	3300004463	Arabidopsis Thaliana Rhizosphere	MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVSAAGKGKVA*
Ga0063356_1009767433	3300004463	Arabidopsis Thaliana Rhizosphere	MNENAKRNLQRRKRQATRLSKREYFRKKKEAVDTAAAGKDNVAKPPSERK*
Ga0062595_1013340811	3300004479	Soil	MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKVA*
Ga0062591_1010528762	3300004643	Soil	MNQNAKRNSQRRKRQANRLSKREYFKTKKEALNVAAAAKDRAP*
Ga0062383_100078453	3300004778	Wetland Sediment	MNQNAKRNLHRRKQLAIRLSKRDYFRKKKEAALTVPAAEPIKVA*
Ga0065705_100101423	3300005294	Switchgrass Rhizosphere	MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALSVPAAGKDKVA*
Ga0066388_1008296871	3300005332	Tropical Forest Soil	MNQNAKHNLQRRKRQAIRLSRREYFRKKKEAANQSAGKDKVD*
Ga0070680_1000097128	3300005336	Corn Rhizosphere	MNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATATTTKTN*
Ga0070696_1000259804	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	MNQNAKRNLPRRKRQAARLSKREYFRKKKEALEAATATTTKTN*
Ga0070704_1003934802	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MNQNAKRNLQHRKRQVARLAKREYFKKKKEALNAPAAGKDKVV*
Ga0074473_111769162	3300005830	Sediment (Intertidal)	MNQNAKRNLQRRKRQASRLSKREYFRQKKEAANVSAAGKDNVKK*
Ga0074470_1010859313	3300005836	Sediment (Intertidal)	MNQNAKRNLQRRKRQATRLSKREYFRQKKEALKVSTPGQKDKAG*
Ga0075277_10186112	3300005895	Rice Paddy Soil	MNQNAKRNLQRRKRQANRLSKREYFRKKKETLTAAAAGKDKVA*
Ga0075428_1000407395	3300006844	Populus Rhizosphere	MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALNVPAAGKDKFV*
Ga0075421_1006799762	3300006845	Populus Rhizosphere	MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPVTEKDKVT*
Ga0075421_1012577662	3300006845	Populus Rhizosphere	MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKVKSV*
Ga0075421_1017437762	3300006845	Populus Rhizosphere	MNQNAKRNLQHRKRQVARLAKREYFKKKKEALTAPAAGKDKVV*
Ga0075421_1021294132	3300006845	Populus Rhizosphere	MNQNAKRNLQRRKRQAIRLSRREYFRKKKEATNVPAAGKDKVD*
Ga0075430_1004511592	3300006846	Populus Rhizosphere	MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKDKSA*
Ga0075433_113685452	3300006852	Populus Rhizosphere	MNQNAKRNLQRRKRQATRLSKREYFKQKKEAINVSAAGKDKVS*
Ga0075420_1006242952	3300006853	Populus Rhizosphere	MNQNAKRNLQHRKRQVARLVKREYFRKKKEALNVPVTEKDKVA*
Ga0075429_1010825552	3300006880	Populus Rhizosphere	MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALNVPPAGKDKFV*
Ga0079218_116345062	3300007004	Agricultural Soil	MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKDKSV*
Ga0105107_101745632	3300009087	Freshwater Sediment	MNQNAKRNSQRRKRQANRLSKREYFKTKKEALNVAAAGKVKTA*
Ga0102851_112668542	3300009091	Freshwater Wetlands	MNQNAKRNSQRRKRQANRLSKREYFKAKKEALNVAAAGKSKPA*
Ga0115026_115985071	3300009111	Wetland	MNQNAKRNSQRRKRQANRLSKREYFKAKKEALNAAAA
Ga0114129_124994421	3300009147	Populus Rhizosphere	MNQNAKRNLQRRKRQAIRLSRREYFRKKKEATNVPAAGKDK
Ga0075423_108943652	3300009162	Populus Rhizosphere	MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKDKVA*
Ga0075423_118860952	3300009162	Populus Rhizosphere	RNLQRRKRQAMRLSKREYFRKKKEALNVPAAGKDKFV*
Ga0113563_109199592	3300009167	Freshwater Wetlands	MNQNAKRNSQRRKRQANRLSKREYFKTKKEALKVAAAAKDRAA*
Ga0105249_111870603	3300009553	Switchgrass Rhizosphere	MNQNAKRNLQHRKRQVARLAKREYFRNKKEALNVSAAGKGKLA*
Ga0105347_10080171	3300009609	Soil	MNQNAKRNSQRRKRQATRLSNREYFRKKKEAVDVSAAGQNKAA*
Ga0105340_10462402	3300009610	Soil	MNQNARRNSQRRKRQATRLSNREYFRKKKEAVDMSAAGQNKAA*
Ga0134128_115861352	3300010373	Terrestrial Soil	VNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATAVKAKTE*
Ga0137442_10419991	3300011414	Soil	MNQIAQRNLQRRKRQATRLSKREYFRKKKEALSVSAAGKGKVA*
Ga0137458_11357031	3300011436	Soil	MNQNAKRNSQRRKRQATRLSKREYFRKKKEALNVSAAGKAKVA*
Ga0137452_10891131	3300011441	Soil	VNQNAKRNSQRRKRQANRLSKREYFKAKKEALNVAAAGKDKAA*
Ga0137457_11464431	3300011443	Soil	MNQIAKRNLQRRKRHATRASKREYFRKKKEAINVSAAG
Ga0137463_13679942	3300011444	Soil	MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNGAAAGKDKVA*
Ga0137445_10628371	3300012035	Soil	MNQIAQRNLQRRKRQATRLSKREYFRKKKEALSVSAAGKDKVA*
Ga0137328_10303631	3300012113	Soil	MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALNVSAAGKAKVA*
Ga0137329_10103952	3300012133	Soil	MNQNAKRNLQRRKRQATRLSKREYFRKKKEALSVSAAGKDKVA*
Ga0137382_100707013	3300012200	Vadose Zone Soil	MNQNAKSNLQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKVA*
Ga0157340_10220441	3300012473	Arabidopsis Rhizosphere	MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNMPAAGKDKVA*
Ga0157326_10026692	3300012513	Arabidopsis Rhizosphere	MNQNAKRNLQRRKRQSIRLSKREYFRKKKEALNVPAAGKDKVA*
Ga0157305_101851882	3300012891	Soil	KMNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVSAAGKGKVA*
Ga0153915_110026552	3300012931	Freshwater Wetlands	MNQNAKRNLQRRKRQATRLAKREYFRKKKEALNAAAGKVKAG*
Ga0164305_115848771	3300012989	Soil	MNQNAKRNLQRRKRQAIRLSKREYFRKKKETLNVPAAGKDKVA*
Ga0157378_121949073	3300013297	Miscanthus Rhizosphere	LQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKVA*
Ga0163162_110363052	3300013306	Switchgrass Rhizosphere	MDQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAVGKDKVA*
Ga0075344_10598252	3300014296	Natural And Restored Wetlands	KRNSQRRKRQANRLSKREYFKAKKEALKVAAAAKDRTA*
Ga0075340_10536402	3300014304	Natural And Restored Wetlands	MNQNAKRNSQRRKRQANRLSKREYFKAKKEALKVAAAAKDRTA*
Ga0075343_10176851	3300014317	Natural And Restored Wetlands	NQNAKRNSQRRKRQANRLSKREYFKAKKEALKVAAAAKDRTA*
Ga0137409_107461281	3300015245	Vadose Zone Soil	MNQNAKRNLQRRKRQAIRLSRREYFRKKKEATNVPAAGK
Ga0132258_134022431	3300015371	Arabidopsis Rhizosphere	MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKFV*
Ga0132256_1037615552	3300015372	Arabidopsis Rhizosphere	MNQNAKRNLQRRKRQATRAAKREYFRKKKEAINASAPGKDT
Ga0132257_1001727143	3300015373	Arabidopsis Rhizosphere	MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKVG*
Ga0132257_1009326863	3300015373	Arabidopsis Rhizosphere	MNQNAKRNLQRRKRQAMRLSKREYFRKKKEAANPSAG
Ga0187825_100298813	3300017930	Freshwater Sediment	MNQNAKRNLQRRKRQATRLAKREYFRKKKEALNAAAAGKVKAG
Ga0187821_104229192	3300017936	Freshwater Sediment	MNQNAKRNLQRRKRQAMRLSKREYFRKKKEAANQSAG
Ga0184640_102593671	3300018074	Groundwater Sediment	MNQNAKRNLQRRKRQATRLSKREYFRKKKEALSVSAAGKDKVA
Ga0184627_105092951	3300018079	Groundwater Sediment	MNQNAKRNLQRRKRQATRLSKREYFRKKKEALNVSAAGKDKVA
Ga0184628_100381051	3300018083	Groundwater Sediment	RNSQRRKRQATRLSNREYFRKKKEAVDMSAAGQNKAA
Ga0184629_100110424	3300018084	Groundwater Sediment	MNQNAQRNLQRRKRQATRLSKREYFRKKKEALSVSAAGKAKVA
Ga0190265_100759874	3300018422	Soil	MNQIAKRNLQRRKRQATRLAKREYFKKKKEALNAVAAGKDKVI
Ga0190265_133357962	3300018422	Soil	NQNAKRNLQRRKRQAIRLSKREYFRKKQEAANPPAAGKEKSA
Ga0190270_101316832	3300018469	Soil	MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKDKSA
Ga0190271_100502802	3300018481	Soil	MNQNAKRNSQRRKRLATRLSNREYFRKKKEAVAVSAAGQDKAA
Ga0193739_10130034	3300020003	Soil	MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKEKVA
Ga0126371_130198451	3300021560	Tropical Forest Soil	RNVSNGGTNMNQNAKHNLQRRKRQAIRLSRREYFRKKKEAANQSAGKDKVD
Ga0209640_100826373	3300025324	Soil	MNQNAKRNLQRRKRQAIRLSRREYFKKKQEAVIVPAAEKKKVG
Ga0210061_10225242	3300025537	Natural And Restored Wetlands	MNQNAKRNLQRRKRQAMRLAKREYFKKKKAAADPTSAVKNKVA
Ga0207707_100059529	3300025912	Corn Rhizosphere	MNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATATTTKTN
Ga0207706_108104961	3300025933	Corn Rhizosphere	MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAVGKDKVA
Ga0207670_106695983	3300025936	Switchgrass Rhizosphere	MNQNAKRNLQRRKRQATRAAKREYFRKKKEASNVSAAGKDKTT
Ga0210116_10053031	3300025959	Natural And Restored Wetlands	MNQNAKRNSQRRKRQANRLSKREYFKAKKEALKVAAAAKDRTA
Ga0207712_110254292	3300025961	Switchgrass Rhizosphere	MNQNAKRNLQRRKRQAIRLSKREYFRKKKKALNVPAAGKDKVA
Ga0208141_10025032	3300025988	Rice Paddy Soil	MNQNAKRNLQRRKRQANRLSKREYFRKKKETLTAAAAGKDKVA
Ga0256867_100075401	3300026535	Soil	MNQNAKRNLQRRKRQATRLSKREYFRKKKEAINVSAAGKD
Ga0209967_10423721	3300027364	Arabidopsis Thaliana Rhizosphere	MNENAKRNLQRRKRQATRLSKREYFRKKKEAVDTAAAGKDNVAKPPSERK
Ga0209966_11503221	3300027695	Arabidopsis Thaliana Rhizosphere	TEGLNMNENAKRNLQRRKRQATRLSKREYFRKKKEAVDTAAAGKDNVAKPPSERK
Ga0209464_100262752	3300027778	Wetland Sediment	MNQNAKRNLHRRKQLAIRLSKRDYFRKKKEAALTVPAAEPIKVA
Ga0209974_101867432	3300027876	Arabidopsis Thaliana Rhizosphere	MNENAKRNLQRRKRQATRLSKREYFRKKKEAVDAAAAGKDNVAKP
Ga0207428_100350242	3300027907	Populus Rhizosphere	MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALNVPAAGKDKFV
Ga0209382_103147632	3300027909	Populus Rhizosphere	MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPVTEKDKVT
Ga0247828_110687041	3300028587	Soil	MNENAKRNLQRRKRQATRLSKREYFRKKKEAVDAAAAGKDNVAKPSLERK
Ga0268386_100333755	3300030619	Soil	MNQNAKRNLQRRKRQATRLSKREYFRKKKEAINVSAAGKDKVG
Ga0302046_113993292	3300030620	Soil	NLQRRKRQATRLSKREYFRKKKEAINVSAAGKDKVD
(restricted) Ga0255310_100539172	3300031197	Sandy Soil	MNQNAKRNLQRRKRQATRLSKREYFRKKKEALSMPAVGKDKVT
Ga0307497_101942872	3300031226	Soil	VFHGGTRMNQNAKRNLQRRKRQANRLSKREYFKTKKDTLNVTAAGKDKAA
(restricted) Ga0255334_10420962	3300031237	Sandy Soil	MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALSVPAAGKDKVA
(restricted) Ga0255312_11266592	3300031248	Sandy Soil	MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALSVPTAGKDKVA
Ga0310887_110481261	3300031547	Soil	MIQNAKRNSQRRKRQANRLSKREYFKAKKEALNVAAAAKDKAA
Ga0307469_113634171	3300031720	Hardwood Forest Soil	MNQNAKRNLQRRKRQATRLSKREYFKQKKEAINVS
Ga0307414_118632201	3300032004	Rhizosphere	MNQNAKRNLQRRKRQAMRLAKREYFKKKKEAGNPAAAEKSTTGGTNQ
Ga0315910_114260701	3300032144	Soil	MNQIAKRNLQRRKRQAMRLAKREYFRKKKEAVIAAAAGTDKAS
Ga0310810_100218855	3300033412	Soil	VNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATAVKAKTE
Ga0316603_123361552	3300033413	Soil	MNQNAKRNSQRRKRQANRLSKREYFKTKKEALKVAAAAKDRAA
Ga0326726_103389092	3300033433	Peat Soil	MNQIAKRNLQRRKRQANRLSKREYFRTKKDALNIAAAGKDKAA
Ga0316620_101636123	3300033480	Soil	MNQNAKRNLQRRKRQATRLAKREYFRKKKEALNAAAGKVKAG
Ga0316628_1022889021	3300033513	Soil	MNQNAKRNLQRRKRQATRLAKREYFRKKKEALNAAAAGKVKAD
Ga0316628_1042519531	3300033513	Soil	RMNQNAKRNLQRRKRQANRLSKREYFRAKKDALNVTAAGKDKAA
Ga0247830_105993642	3300033551	Soil	MNENAKRNLQRRKRQATRLSKREYFRKKKEAVDTAPAGKNNVAKPPLERK
Ga0364929_0001726_817_948	3300034149	Sediment	MNQNARRNSQRRKRQATRLSNREYFRKKKEAVDASAAGQNKAA

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters