| Basic Information | |
|---|---|
| Family ID | F072050 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GLYELYRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 7.27 % |
| % of genes near scaffold ends (potentially truncated) | 84.30 % |
| % of genes from short scaffolds (< 2000 bps) | 85.12 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.719 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (64.463 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.736 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (63.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF00211 | Guanylate_cyc | 3.31 |
| PF16177 | ACAS_N | 2.48 |
| PF13565 | HTH_32 | 1.65 |
| PF13683 | rve_3 | 1.65 |
| PF13384 | HTH_23 | 0.83 |
| PF06827 | zf-FPG_IleRS | 0.83 |
| PF04909 | Amidohydro_2 | 0.83 |
| PF00296 | Bac_luciferase | 0.83 |
| PF03352 | Adenine_glyco | 0.83 |
| PF13676 | TIR_2 | 0.83 |
| PF07311 | Dodecin | 0.83 |
| PF07508 | Recombinase | 0.83 |
| PF11294 | DUF3095 | 0.83 |
| PF01527 | HTH_Tnp_1 | 0.83 |
| PF06283 | ThuA | 0.83 |
| PF07366 | SnoaL | 0.83 |
| PF02515 | CoA_transf_3 | 0.83 |
| PF00355 | Rieske | 0.83 |
| PF00872 | Transposase_mut | 0.83 |
| PF03237 | Terminase_6N | 0.83 |
| PF02371 | Transposase_20 | 0.83 |
| PF11149 | DUF2924 | 0.83 |
| PF00118 | Cpn60_TCP1 | 0.83 |
| PF09371 | Tex_N | 0.83 |
| PF00571 | CBS | 0.83 |
| PF13276 | HTH_21 | 0.83 |
| PF06736 | TMEM175 | 0.83 |
| PF04392 | ABC_sub_bind | 0.83 |
| PF04248 | NTP_transf_9 | 0.83 |
| PF13470 | PIN_3 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 3.31 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.83 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.83 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.83 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.83 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.83 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.83 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.83 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.83 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.83 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.72 % |
| All Organisms | root | All Organisms | 46.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100150617 | Not Available | 1815 | Open in IMG/M |
| 3300006854|Ga0075425_101222704 | Not Available | 853 | Open in IMG/M |
| 3300006881|Ga0068865_100523893 | Not Available | 992 | Open in IMG/M |
| 3300010400|Ga0134122_10313611 | Not Available | 1351 | Open in IMG/M |
| 3300012924|Ga0137413_11164751 | Not Available | 613 | Open in IMG/M |
| 3300016294|Ga0182041_11673419 | Not Available | 588 | Open in IMG/M |
| 3300016294|Ga0182041_12236878 | Not Available | 511 | Open in IMG/M |
| 3300016341|Ga0182035_10432020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1113 | Open in IMG/M |
| 3300016341|Ga0182035_11025508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300016357|Ga0182032_10352184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1178 | Open in IMG/M |
| 3300016357|Ga0182032_10479055 | Not Available | 1020 | Open in IMG/M |
| 3300016387|Ga0182040_10477671 | Not Available | 992 | Open in IMG/M |
| 3300016404|Ga0182037_10234996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1442 | Open in IMG/M |
| 3300016422|Ga0182039_10354136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1233 | Open in IMG/M |
| 3300016445|Ga0182038_10541806 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300016445|Ga0182038_11059996 | Not Available | 719 | Open in IMG/M |
| 3300016445|Ga0182038_12128892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300021171|Ga0210405_10725038 | Not Available | 766 | Open in IMG/M |
| 3300021474|Ga0210390_11622521 | Not Available | 509 | Open in IMG/M |
| 3300027911|Ga0209698_11170562 | Not Available | 567 | Open in IMG/M |
| 3300031545|Ga0318541_10217624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1058 | Open in IMG/M |
| 3300031545|Ga0318541_10522125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → alpha proteobacterium BAL199 | 664 | Open in IMG/M |
| 3300031546|Ga0318538_10194269 | Not Available | 1082 | Open in IMG/M |
| 3300031561|Ga0318528_10071659 | Not Available | 1785 | Open in IMG/M |
| 3300031564|Ga0318573_10006942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4588 | Open in IMG/M |
| 3300031564|Ga0318573_10259468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 927 | Open in IMG/M |
| 3300031572|Ga0318515_10343129 | Not Available | 801 | Open in IMG/M |
| 3300031573|Ga0310915_10085012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2111 | Open in IMG/M |
| 3300031573|Ga0310915_10180758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1469 | Open in IMG/M |
| 3300031640|Ga0318555_10814372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300031679|Ga0318561_10143940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1277 | Open in IMG/M |
| 3300031679|Ga0318561_10247097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 972 | Open in IMG/M |
| 3300031680|Ga0318574_10109093 | Not Available | 1543 | Open in IMG/M |
| 3300031680|Ga0318574_10400971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
| 3300031681|Ga0318572_10171725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1259 | Open in IMG/M |
| 3300031681|Ga0318572_10216435 | Not Available | 1121 | Open in IMG/M |
| 3300031681|Ga0318572_10536022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300031708|Ga0310686_118832130 | Not Available | 510 | Open in IMG/M |
| 3300031713|Ga0318496_10098504 | Not Available | 1567 | Open in IMG/M |
| 3300031719|Ga0306917_10001311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11626 | Open in IMG/M |
| 3300031719|Ga0306917_10136516 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| 3300031744|Ga0306918_10542237 | Not Available | 911 | Open in IMG/M |
| 3300031747|Ga0318502_10076655 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300031763|Ga0318537_10357207 | Not Available | 539 | Open in IMG/M |
| 3300031768|Ga0318509_10773452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300031781|Ga0318547_11017803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 518 | Open in IMG/M |
| 3300031782|Ga0318552_10273785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300031793|Ga0318548_10329831 | Not Available | 749 | Open in IMG/M |
| 3300031793|Ga0318548_10330603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300031794|Ga0318503_10305261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300031797|Ga0318550_10182219 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300031805|Ga0318497_10087807 | Not Available | 1656 | Open in IMG/M |
| 3300031805|Ga0318497_10119971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1423 | Open in IMG/M |
| 3300031819|Ga0318568_10739074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300031821|Ga0318567_10587662 | Not Available | 632 | Open in IMG/M |
| 3300031832|Ga0318499_10089053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1188 | Open in IMG/M |
| 3300031835|Ga0318517_10586589 | Not Available | 501 | Open in IMG/M |
| 3300031879|Ga0306919_11325884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 544 | Open in IMG/M |
| 3300031880|Ga0318544_10028276 | Not Available | 1933 | Open in IMG/M |
| 3300031890|Ga0306925_11387878 | Not Available | 693 | Open in IMG/M |
| 3300031893|Ga0318536_10061416 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300031893|Ga0318536_10137206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1240 | Open in IMG/M |
| 3300031893|Ga0318536_10486041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300031910|Ga0306923_10156448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2602 | Open in IMG/M |
| 3300031910|Ga0306923_10308425 | Not Available | 1808 | Open in IMG/M |
| 3300031910|Ga0306923_10683218 | Not Available | 1144 | Open in IMG/M |
| 3300031910|Ga0306923_10700507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1127 | Open in IMG/M |
| 3300031912|Ga0306921_10237270 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300031912|Ga0306921_10484280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1439 | Open in IMG/M |
| 3300031912|Ga0306921_10841264 | Not Available | 1045 | Open in IMG/M |
| 3300031941|Ga0310912_11412164 | Not Available | 525 | Open in IMG/M |
| 3300031945|Ga0310913_10111673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1859 | Open in IMG/M |
| 3300031945|Ga0310913_10582931 | Not Available | 793 | Open in IMG/M |
| 3300031946|Ga0310910_10556256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium caulinodans → Azorhizobium caulinodans ORS 571 | 910 | Open in IMG/M |
| 3300031946|Ga0310910_10964375 | Not Available | 667 | Open in IMG/M |
| 3300031947|Ga0310909_10660621 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300031947|Ga0310909_11648376 | Not Available | 507 | Open in IMG/M |
| 3300031954|Ga0306926_11027097 | Not Available | 979 | Open in IMG/M |
| 3300031959|Ga0318530_10178856 | Not Available | 867 | Open in IMG/M |
| 3300031959|Ga0318530_10242254 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031981|Ga0318531_10065959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1558 | Open in IMG/M |
| 3300031981|Ga0318531_10069632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1520 | Open in IMG/M |
| 3300031981|Ga0318531_10119533 | Not Available | 1169 | Open in IMG/M |
| 3300032001|Ga0306922_12194866 | Not Available | 532 | Open in IMG/M |
| 3300032010|Ga0318569_10422043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
| 3300032035|Ga0310911_10335171 | Not Available | 872 | Open in IMG/M |
| 3300032039|Ga0318559_10273069 | Not Available | 783 | Open in IMG/M |
| 3300032039|Ga0318559_10618222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300032041|Ga0318549_10338944 | Not Available | 677 | Open in IMG/M |
| 3300032042|Ga0318545_10244658 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300032044|Ga0318558_10074629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1548 | Open in IMG/M |
| 3300032055|Ga0318575_10332471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300032059|Ga0318533_11265069 | Not Available | 539 | Open in IMG/M |
| 3300032063|Ga0318504_10151432 | Not Available | 1068 | Open in IMG/M |
| 3300032063|Ga0318504_10237616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 856 | Open in IMG/M |
| 3300032066|Ga0318514_10227724 | Not Available | 979 | Open in IMG/M |
| 3300032066|Ga0318514_10746927 | Not Available | 520 | Open in IMG/M |
| 3300032076|Ga0306924_10096569 | Not Available | 3335 | Open in IMG/M |
| 3300032076|Ga0306924_11440076 | Not Available | 733 | Open in IMG/M |
| 3300032076|Ga0306924_11471652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300032076|Ga0306924_11529171 | Not Available | 706 | Open in IMG/M |
| 3300032089|Ga0318525_10680521 | Not Available | 524 | Open in IMG/M |
| 3300032090|Ga0318518_10614540 | Not Available | 554 | Open in IMG/M |
| 3300032094|Ga0318540_10477036 | Not Available | 602 | Open in IMG/M |
| 3300032261|Ga0306920_100308692 | Not Available | 2355 | Open in IMG/M |
| 3300032261|Ga0306920_100958090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1248 | Open in IMG/M |
| 3300032261|Ga0306920_101823940 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300033289|Ga0310914_11718589 | Not Available | 531 | Open in IMG/M |
| 3300033290|Ga0318519_10471819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300033290|Ga0318519_10671328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 64.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.93% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1001506172 | 3300004152 | Bog Forest Soil | MNGEGLLEFYRQHAEAAAQRSKPQHAQTVPQPGSMEWVKAQEQKG* |
| Ga0075425_1012227042 | 3300006854 | Populus Rhizosphere | EGIYEWYRQQSAAAAQRSKPQPAQTVPQPGSMEWSEAQKKQG* |
| Ga0068865_1005238932 | 3300006881 | Miscanthus Rhizosphere | MTGEGIYEWYRQQSAAAAQRSKPQPAQTVPQPGSMEWSEAQKKQG* |
| Ga0134122_103136111 | 3300010400 | Terrestrial Soil | MPGEGIYEWYRQQSAAAAQRSKPQPAQTVPQPGSMEWSEAQKKQG* |
| Ga0137413_111647511 | 3300012924 | Vadose Zone Soil | MKGEAMFELARRNAEAAEQRRKPQPVETVPQPGSMEWFEAQKKKG* |
| Ga0182041_116734192 | 3300016294 | Soil | YEWYRQQAKAAAQPSKPQPAQTVPQPGSIEWFKAQKNKG |
| Ga0182041_122368781 | 3300016294 | Soil | GLYEFYRQQAEAAAQPSKPQPAQTVPQPGSMEWLEARKNKG |
| Ga0182035_104320203 | 3300016341 | Soil | YRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0182035_110255081 | 3300016341 | Soil | EGLYEFYRQQAKAAAQPSKPQPAQTVPQPGSTEWFQAQKNKG |
| Ga0182032_103521844 | 3300016357 | Soil | FYRQQAKAAAQPSNPQPAQTVPQPGLMEWLEAQEKKG |
| Ga0182032_104790552 | 3300016357 | Soil | LYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQKNKG |
| Ga0182034_103394941 | 3300016371 | Soil | GEGLYEFYRQQAEAAAQPSKPQPAQTVAQPGSMEWLAQQGKLG |
| Ga0182040_104776712 | 3300016387 | Soil | EGLYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWFEAEKKKG |
| Ga0182037_102349963 | 3300016404 | Soil | FYRQQAKAAAQPSKPQPAQTVPQPGSMEWFEAEKMKG |
| Ga0182039_103541361 | 3300016422 | Soil | PMPGEGLYEFYRQQAKAAAQPSNPQPAQTVPQPGLMEWLEAQEKKG |
| Ga0182038_105418061 | 3300016445 | Soil | EFYRQQAKAAAQPSKPQPAQTVPQPGSLEWLEAQKDKG |
| Ga0182038_110599961 | 3300016445 | Soil | MKGEGIYELYRQMAEAAAQRSKPQPAQTVPQPGSTEWFEARKKQG |
| Ga0182038_121288921 | 3300016445 | Soil | RQQAKAAAQPSKPQPAQTVPQPGSMEWFKAQKNKG |
| Ga0210405_107250382 | 3300021171 | Soil | VPEPECEKAAAQRSKPQPAQTVPQPGSMEWFEAQKKKG |
| Ga0210390_116225211 | 3300021474 | Soil | LYRRRDAEAAAQRSKPQPAQTVPQPGSMEWFEAQKKKG |
| Ga0209698_111705622 | 3300027911 | Watersheds | MESAGIFELYHQKAEAAAQRNKPQPAQSVPQPGSMEWFEAQKK |
| Ga0318541_102176243 | 3300031545 | Soil | ELLVEPMPGEGLYEFYRQQAKAAAQPSNPQPAQTVPQPGLMEWLEAQEKKG |
| Ga0318541_105221252 | 3300031545 | Soil | GEGLYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWLQAQEKKG |
| Ga0318538_101942691 | 3300031546 | Soil | LVEPMPGEGIYEFYRQQAKAAAQPSKPQPAQTVPQPGPMEWLEAQEKKG |
| Ga0318528_100716592 | 3300031561 | Soil | YEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWFEAEKKKG |
| Ga0318573_100069421 | 3300031564 | Soil | YELYRGQAEAAAQRSKPQPAQTVPQPGSMEWFKAQKNKG |
| Ga0318573_102594683 | 3300031564 | Soil | RRQAEADAERSKPQPVQSVPQPGSMEWFEAQKKKA |
| Ga0318515_103431291 | 3300031572 | Soil | LYEWYRQQAKAAAQPSKLQPTQTVPQPGSMEWLEAQKNKG |
| Ga0318515_104660031 | 3300031572 | Soil | GFYELLRRQAEADAERSKPQPVQSVPQPGSMEWFEAQKKKA |
| Ga0310915_100850124 | 3300031573 | Soil | PGEGIYELYRQQAKAAAQPSKPQPAQTVPQPGSMEWFEAQKKSR |
| Ga0310915_101807581 | 3300031573 | Soil | GLYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0318555_108143721 | 3300031640 | Soil | YRQQAKAAAQPSKPQPAQTVPQPGSMEWLAEQEKSG |
| Ga0318561_101439401 | 3300031679 | Soil | GLYELYRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0318561_102470972 | 3300031679 | Soil | LLVEPMPGEGLYEFYRQQAKAAAQPSNPQPAQTVPQPGSMEWFKAQKNKG |
| Ga0318574_101090934 | 3300031680 | Soil | DKRRAEAAAQRNKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0318574_104009711 | 3300031680 | Soil | IFELYRQQAKAAAQPSKPQPAQTVPQPGSMEWLAEQEKSG |
| Ga0318572_101717254 | 3300031681 | Soil | LLVEPMPGEGLYEFYRQQAKAAAQPSNPQPAQTVPQPGLMEWLEAQEKKG |
| Ga0318572_102164351 | 3300031681 | Soil | VEPMPGEGLYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWFEAEKKKG |
| Ga0318572_105360221 | 3300031681 | Soil | IYELYRQQAKAAAQPSKTQPAQTVPQPGSTEWLEARKKQG |
| Ga0310686_1188321301 | 3300031708 | Soil | SAGIYALYRQKAAAAAEHSKPQPVKTVPQPGSTEWFEAQKKKG |
| Ga0318496_100985041 | 3300031713 | Soil | PMPGEGLYEFYRQQAEPAAQPSKPQPPQTVPQPGSMEWFEAEKKKG |
| Ga0306917_100013111 | 3300031719 | Soil | QLYNQQAEAAAQRSKPQPAQTVPQPGSMEWLAEQEKSR |
| Ga0306917_101365164 | 3300031719 | Soil | RQMAEAAAQRSKPQPAQTVPQPGSTEWFEARIKQG |
| Ga0306918_105422372 | 3300031744 | Soil | EPMPGEAIYELYRQQAKAAAQPSKPQPAQTVPQPGSMEWFQAQKNKG |
| Ga0318502_100766552 | 3300031747 | Soil | YEWYRQQAKAAQPSKPQPAQTVPQPGSMEWFKAQDKKG |
| Ga0318502_105929391 | 3300031747 | Soil | FELLRRRAEAAAERSKPPPVQSVPQPGSMEWFEEQKKKA |
| Ga0318537_103572072 | 3300031763 | Soil | LYEFYREQAKAAAQPSNPQPAQTVPQPGSTEWLEAQEKKG |
| Ga0318509_107734521 | 3300031768 | Soil | RQQAEAAAQRSKPQPVQSAPQPGSMEWFAWVEAQKKKG |
| Ga0318543_100426912 | 3300031777 | Soil | RRQAEADAERSKPQPVQSVPQPGSMEWFEAQKKKG |
| Ga0318547_110178031 | 3300031781 | Soil | LYEWYRHQAKATAQPSNPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0318552_102737851 | 3300031782 | Soil | LYRQQAKAAAQPSKPQPAQTVPQPGSMEWFEAQKKSR |
| Ga0318548_103298312 | 3300031793 | Soil | IYELYRQQAKAAAQGSKPQPAQTVPQPGSMEWFAEQEKSR |
| Ga0318548_103306031 | 3300031793 | Soil | PGEGLYEFYRQQAKAAAQPSNPQPAQTVPQPGSMEWFKAQKNKG |
| Ga0318503_103052611 | 3300031794 | Soil | SPGEGISEFDRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0318550_100914161 | 3300031797 | Soil | LLRRQAEADAERSKPQPVQSVPQPGSMEWFEAQKKKG |
| Ga0318550_101822193 | 3300031797 | Soil | MPGEGLLEFYRQRAEAAAQPSKPQPAQTVPQPGSMEWFKAQKNKG |
| Ga0318497_100878072 | 3300031805 | Soil | PGEGLYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWFEAEKKKG |
| Ga0318497_101199712 | 3300031805 | Soil | LYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0318568_107390742 | 3300031819 | Soil | GIYEWYRQQAKAAQPSKPQPAQTVPQPGSMEWFKAQDKKG |
| Ga0318567_105876622 | 3300031821 | Soil | GIYEWYRQQAEAAAQRSRPQPVQTVPQPGSMEWFEARNKQG |
| Ga0318499_100890532 | 3300031832 | Soil | GIYKLYRQQAKAAAQPSKPQPAQTVPQPGSMEWLAEQEKSG |
| Ga0318517_105865891 | 3300031835 | Soil | GIYELYRQEEEAAEQRRKPQPAQTVPQPGSMEWFEARENQG |
| Ga0306919_113258842 | 3300031879 | Soil | KGRAPQPASPGEGISEFDRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0318544_100282761 | 3300031880 | Soil | QQEEAAAQRSKPQPAQTLPQPGSTEWFAWLEAQEKNG |
| Ga0318544_102555712 | 3300031880 | Soil | FGSMRGEGIYEWYRQQAKAAAQPSKPQPAQTVAQPGSMEWLAQQGKLG |
| Ga0306925_113878781 | 3300031890 | Soil | LSRCRAKVYELYCQQAKAAAQPSKPQPAQTVPQPGSVEWSEAQKKKG |
| Ga0318536_100614161 | 3300031893 | Soil | IYELYRQQAKAAAQPSKPQPAQTVPQPGSMEWFQAQKNKG |
| Ga0318536_101372062 | 3300031893 | Soil | PMPGEGIYELYRQQAEAAAQRSRPQHVQTVPQPGSMEWFEAQKKSR |
| Ga0318536_104860411 | 3300031893 | Soil | EWYRQQAKAAQPSKPQPAQTVPQPGSMEWFKAQDKKG |
| Ga0306923_101564484 | 3300031910 | Soil | LLVEPMPGEGLYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0306923_103084251 | 3300031910 | Soil | VEPMPGEGLYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWLQAQEKKG |
| Ga0306923_106832183 | 3300031910 | Soil | LLVEPMPGEGLYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWFEAEKKKG |
| Ga0306923_107005072 | 3300031910 | Soil | MKGEDIFELYHRDGEAGAQRSKPQPAQTVPQPGSMEWFEAQEKKG |
| Ga0306921_102372705 | 3300031912 | Soil | GIYEFYRQQAEAAAQRSKPQPAQTVPQPGSMEWFEAQKKQG |
| Ga0306921_104842801 | 3300031912 | Soil | LYEFYRQQAKAAAQPSNPQPAQTVPQPGLMEWLEAQEKKG |
| Ga0306921_108412641 | 3300031912 | Soil | EGIYELYRQQAEAAAQRSRPQPVQTVPQPGSMEWFEAQKKSR |
| Ga0310912_114121641 | 3300031941 | Soil | EGIYEWYRQQAEAAAQRSRPQPVQTVPQPGSMEWFEARNKQG |
| Ga0310913_101116731 | 3300031945 | Soil | IYELYHQQAEAAAQRSKPQPAQTVPQPGSTEWLEARKKQG |
| Ga0310913_105829311 | 3300031945 | Soil | IYELYRQQAEAAAQRSKPQPAQTVPQPGSMEWSEAQKKQG |
| Ga0310910_105562561 | 3300031946 | Soil | PMKGEGIYELYRQQAKAAAQPSKPQPAQTVPQPGSMEWLAEQEKSG |
| Ga0310910_109643751 | 3300031946 | Soil | FVLYRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0310909_106606213 | 3300031947 | Soil | MPGEGLFEFYRHQAKAAAQPSKPQPAQTVPQPGSTEWFQAQKNKG |
| Ga0310909_116483762 | 3300031947 | Soil | PMPGEGLYEFYRQQAKAAAQPSNPQPAQTVPQPGSMEWFKAQKNKG |
| Ga0306926_110270971 | 3300031954 | Soil | ELYRQQAKAAAQPSKPQPAQTVPQPGSMEWFEAQKKSR |
| Ga0318530_101788561 | 3300031959 | Soil | GIYELYRQQAEAAAQRSRPQPVQTVPQPGSMEWFEAQKKSR |
| Ga0318530_102422541 | 3300031959 | Soil | LYEFYRQQAKAAAQPSKPQPAQTVPQPGSVEWSEAQKKKG |
| Ga0318531_100659593 | 3300031981 | Soil | WYREQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0318531_100696324 | 3300031981 | Soil | PQPASPGEGISEFDRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0318531_101195332 | 3300031981 | Soil | IYELYRQQAEAAAQRSRPQPVQTVPQPGSMEWFEAQKKSR |
| Ga0306922_121948662 | 3300032001 | Soil | LVEPMKGEGIYEWYRQQAEAAAQRSRPQPVQTVPQPGSMEWFEARNKQG |
| Ga0318569_104220431 | 3300032010 | Soil | LYEWYRQQAKPAAQPSKPQPPQTVPQPGSMEWFKAQAEKG |
| Ga0310911_103351712 | 3300032035 | Soil | GEAIYELYRQQAKAAAQPSKPQPAQTVPQPGSMEWFQAQKNKG |
| Ga0318559_102730691 | 3300032039 | Soil | AIYELYRQQAKAAAQPSKPQPAQTVPQPGSMEWFQAQKNKG |
| Ga0318559_106182221 | 3300032039 | Soil | GIYELYRQQAKAAAQPSKPQPAQTVPQPGSMEWFKAQKNKG |
| Ga0318549_103389441 | 3300032041 | Soil | YHQQAEAAAQRSKPQPAQTVPQPGSTEWFEARKKQG |
| Ga0318545_102446581 | 3300032042 | Soil | LYRQMAEAAAPRSKPQPAQTVPQPGSTEWFEARKKQG |
| Ga0318556_102733881 | 3300032043 | Soil | YELLRRQAEADAERSKPQPVQSVPQPGSMEWFEAQKKKA |
| Ga0318558_100746294 | 3300032044 | Soil | PMPGEGLYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0318506_102797732 | 3300032052 | Soil | SWGSYELCRQQAEAAAQRSKPQPVQSVPQPGSMEWFAWVEAQKKKG |
| Ga0318575_103324713 | 3300032055 | Soil | MPGEGLYEFYRQQAKAAAQPSNPQPAQTVPQPGLMEWLEAQEKKG |
| Ga0318533_112650692 | 3300032059 | Soil | EPMKGEGIYEWYRQQAEAAAQRSRPQPVQTVPQPGSMEWFEARNKQG |
| Ga0318504_101514321 | 3300032063 | Soil | GLYELYRQQAKAAAQPSKPQPAQTVPQPGSMEWFKAQKNKG |
| Ga0318504_102376162 | 3300032063 | Soil | IYELYCQEEEAAEQRRKPQPAQTVPQPGSMEWFEAQENQG |
| Ga0318513_103860522 | 3300032065 | Soil | GEGIYELYRQQAKAAAQGSKPQPAQTVPQPGSMEWFAEQEKSR |
| Ga0318514_102277242 | 3300032066 | Soil | LYEFYRQQAKAAAQPSKPQPAQTVPQPGSMEWLQAQEKKG |
| Ga0318514_107469271 | 3300032066 | Soil | GIYELYRQQAKAAAQPSKTQPAQTVPQPGSMEWFEAQENQG |
| Ga0306924_100965697 | 3300032076 | Soil | ASPGEGISEFDRQQAKAAAQPSKPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0306924_114400761 | 3300032076 | Soil | IFELSRQQAEAAAQRGKPQPAQTVPQPGSMEWLAEQEKSG |
| Ga0306924_114716521 | 3300032076 | Soil | EGIYELYRQQAKAAAQPSKPQPAQTVPQPGSMEWLAEQEKSG |
| Ga0306924_115291712 | 3300032076 | Soil | GLFEFYRHQAKAAAQPSKPQPAQTVPQPGSTEWFQAQKNKG |
| Ga0318525_106805211 | 3300032089 | Soil | IYELYRQQAEAAAQRSKPQPAQTVPQPGSTEWFEARKKQG |
| Ga0318518_106145401 | 3300032090 | Soil | GISEFDRQQAKAAAQPSKPEPAQTVPQPGSIEWLAAQEKKG |
| Ga0318540_104770361 | 3300032094 | Soil | YRQQAEPAAQPSKPQPPQTVPQPGSMEWFEAEKKKG |
| Ga0307470_113171601 | 3300032174 | Hardwood Forest Soil | LDVQCNELYRQQAEAAAERSKPQPVQSLPQPGSMEWFEAQK |
| Ga0306920_1003086922 | 3300032261 | Soil | PGEGLYEFYRQQAKAAAQPSKPQPAQTVPQPGWMEWLEAQEKKG |
| Ga0306920_1009580902 | 3300032261 | Soil | MPGEGLYEWYRHQAKATAQPSNPQPAQTVPQPGSMEWLEAQEKKG |
| Ga0306920_1018239401 | 3300032261 | Soil | YRQQAKAAAQPSKPQPAQTVPQPGSMEWFEAQKNKG |
| Ga0306920_1021314621 | 3300032261 | Soil | NVYELYRQQAEAAAERSKPQPVQSLPQPGSMEWFEAQK |
| Ga0310914_117185892 | 3300033289 | Soil | IFELYHRDGEAGAQRSKPQPAQTVPQPGSMEWFEAQEKKG |
| Ga0318519_104718192 | 3300033290 | Soil | GEGIYEWYRQQAKAAQPSKPQPAQTVPQPGSMEWFKAQDKKG |
| Ga0318519_106713282 | 3300033290 | Soil | GIYELYHQQAKAAAQCSKPQPAQTVPQPGSIEWLKTQANKE |
| ⦗Top⦘ |