NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F071914

Metagenome Family F071914

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071914
Family Type Metagenome
Number of Sequences 121
Average Sequence Length 108 residues
Representative Sequence MSPDMKDEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK
Number of Associated Samples 84
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 54.55 %
% of genes near scaffold ends (potentially truncated) 24.79 %
% of genes from short scaffolds (< 2000 bps) 93.39 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.421 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(88.430 % of family members)
Environment Ontology (ENVO) Unclassified
(89.256 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(93.388 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 70.91%    β-sheet: 0.00%    Coil/Unstructured: 29.09%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF07883Cupin_2 11.57
PF01381HTH_3 8.26
PF08241Methyltransf_11 8.26
PF13417GST_N_3 5.79
PF13350Y_phosphatase3 2.48
PF01575MaoC_dehydratas 2.48
PF10041DUF2277 2.48
PF03372Exo_endo_phos 1.65
PF06472ABC_membrane_2 1.65
PF13649Methyltransf_25 1.65
PF01494FAD_binding_3 1.65
PF00080Sod_Cu 1.65
PF132794HBT_2 0.83
PF02566OsmC 0.83
PF01740STAS 0.83
PF06146PsiE 0.83
PF13673Acetyltransf_10 0.83
PF08386Abhydrolase_4 0.83
PF01797Y1_Tnp 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 3.31
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.65
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 1.65
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 1.65
COG2032Cu/Zn superoxide dismutaseInorganic ion transport and metabolism [P] 1.65
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.83
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.83
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.83
COG3223Phosphate starvation-inducible membrane PsiE (function unknown)General function prediction only [R] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.42 %
UnclassifiedrootN/A30.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_10351618All Organisms → cellular organisms → Bacteria2325Open in IMG/M
3300004463|Ga0063356_101059216All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300004463|Ga0063356_102611129Not Available776Open in IMG/M
3300009053|Ga0105095_10497862All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b676Open in IMG/M
3300009597|Ga0105259_1069873All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. AJA081-3803Open in IMG/M
3300009609|Ga0105347_1027408All Organisms → cellular organisms → Bacteria → Proteobacteria1979Open in IMG/M
3300009609|Ga0105347_1082960Not Available1189Open in IMG/M
3300009609|Ga0105347_1450059Not Available557Open in IMG/M
3300009610|Ga0105340_1017771All Organisms → cellular organisms → Bacteria2785Open in IMG/M
3300009610|Ga0105340_1058062All Organisms → cellular organisms → Bacteria → Proteobacteria1514Open in IMG/M
3300009610|Ga0105340_1072685All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter1358Open in IMG/M
3300009678|Ga0105252_10009352All Organisms → cellular organisms → Bacteria3488Open in IMG/M
3300009678|Ga0105252_10014606All Organisms → cellular organisms → Bacteria2775Open in IMG/M
3300009678|Ga0105252_10050155All Organisms → cellular organisms → Bacteria → Proteobacteria1577Open in IMG/M
3300009678|Ga0105252_10065865All Organisms → cellular organisms → Bacteria → Proteobacteria1399Open in IMG/M
3300011397|Ga0137444_1009200Not Available1266Open in IMG/M
3300011399|Ga0137466_1027907Not Available791Open in IMG/M
3300011402|Ga0137356_1005158All Organisms → cellular organisms → Bacteria → Proteobacteria2223Open in IMG/M
3300011405|Ga0137340_1090773Not Available590Open in IMG/M
3300011406|Ga0137454_1012306Not Available1033Open in IMG/M
3300011406|Ga0137454_1065222All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300011407|Ga0137450_1003203All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter2237Open in IMG/M
3300011407|Ga0137450_1057428Not Available723Open in IMG/M
3300011408|Ga0137460_1065200Not Available692Open in IMG/M
3300011413|Ga0137333_1013916All Organisms → cellular organisms → Bacteria → Proteobacteria1755Open in IMG/M
3300011415|Ga0137325_1033254All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b1058Open in IMG/M
3300011415|Ga0137325_1040104All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. JS666977Open in IMG/M
3300011417|Ga0137326_1041299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales995Open in IMG/M
3300011417|Ga0137326_1169847Not Available504Open in IMG/M
3300011420|Ga0137314_1149481Not Available570Open in IMG/M
3300011421|Ga0137462_1022837All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1239Open in IMG/M
3300011422|Ga0137425_1009173All Organisms → cellular organisms → Bacteria1967Open in IMG/M
3300011423|Ga0137436_1008785All Organisms → cellular organisms → Bacteria2486Open in IMG/M
3300011424|Ga0137439_1032144All Organisms → cellular organisms → Bacteria → Proteobacteria933Open in IMG/M
3300011424|Ga0137439_1036354All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300011425|Ga0137441_1016972All Organisms → cellular organisms → Bacteria1476Open in IMG/M
3300011425|Ga0137441_1064714All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales847Open in IMG/M
3300011427|Ga0137448_1011265Not Available1905Open in IMG/M
3300011430|Ga0137423_1036552All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300011430|Ga0137423_1060171All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter1128Open in IMG/M
3300011432|Ga0137428_1055805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium sullae1054Open in IMG/M
3300011432|Ga0137428_1163789All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. A23658Open in IMG/M
3300011432|Ga0137428_1238967Not Available537Open in IMG/M
3300011433|Ga0137443_1044263Not Available1202Open in IMG/M
3300011433|Ga0137443_1168216All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales653Open in IMG/M
3300011434|Ga0137464_1024369All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1626Open in IMG/M
3300011434|Ga0137464_1047259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales1201Open in IMG/M
3300011435|Ga0137426_1011479All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b2051Open in IMG/M
3300011436|Ga0137458_1020949All Organisms → cellular organisms → Bacteria → Proteobacteria1607Open in IMG/M
3300011436|Ga0137458_1024763All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1499Open in IMG/M
3300011438|Ga0137451_1106284All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium859Open in IMG/M
3300011439|Ga0137432_1084388All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300011439|Ga0137432_1148105All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300011440|Ga0137433_1134391All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b790Open in IMG/M
3300011441|Ga0137452_1040808All Organisms → cellular organisms → Bacteria → Proteobacteria1462Open in IMG/M
3300011443|Ga0137457_1034370All Organisms → cellular organisms → Bacteria → Proteobacteria1413Open in IMG/M
3300011443|Ga0137457_1286273Not Available563Open in IMG/M
3300011445|Ga0137427_10051659All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. A231627Open in IMG/M
3300011445|Ga0137427_10191054All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300011445|Ga0137427_10466866All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b520Open in IMG/M
3300012034|Ga0137453_1121564All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300012035|Ga0137445_1064608All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b725Open in IMG/M
3300012035|Ga0137445_1122881Not Available529Open in IMG/M
3300012039|Ga0137421_1038144All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b1266Open in IMG/M
3300012039|Ga0137421_1121217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium762Open in IMG/M
3300012040|Ga0137461_1076437Not Available939Open in IMG/M
3300012041|Ga0137430_1074662All Organisms → cellular organisms → Bacteria → Proteobacteria939Open in IMG/M
3300012129|Ga0137345_1055707Not Available513Open in IMG/M
3300012133|Ga0137329_1037703Not Available620Open in IMG/M
3300012134|Ga0137330_1034188All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria657Open in IMG/M
3300012137|Ga0137346_1058149All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300012137|Ga0137346_1063388Not Available511Open in IMG/M
3300012157|Ga0137353_1043861Not Available802Open in IMG/M
3300012161|Ga0137336_1018100All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b1239Open in IMG/M
3300012161|Ga0137336_1076956Not Available620Open in IMG/M
3300012171|Ga0137342_1139622Not Available516Open in IMG/M
3300012175|Ga0137321_1039929All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b1010Open in IMG/M
3300012179|Ga0137334_1082031Not Available714Open in IMG/M
3300012179|Ga0137334_1164031All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria503Open in IMG/M
3300012225|Ga0137434_1028071Not Available778Open in IMG/M
3300012226|Ga0137447_1015146All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300012227|Ga0137449_1120958Not Available572Open in IMG/M
3300012228|Ga0137459_1066393All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300012228|Ga0137459_1069651All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter1008Open in IMG/M
3300014861|Ga0180061_1066284Not Available602Open in IMG/M
3300014863|Ga0180060_1032131Not Available678Open in IMG/M
3300014865|Ga0180078_1054165Not Available676Open in IMG/M
3300014866|Ga0180090_1093636Not Available539Open in IMG/M
3300014868|Ga0180088_1059522Not Available672Open in IMG/M
3300014870|Ga0180080_1035869All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300014871|Ga0180095_1014173All Organisms → cellular organisms → Bacteria → Proteobacteria1222Open in IMG/M
3300014872|Ga0180087_1024634All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300014874|Ga0180084_1020178All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b1223Open in IMG/M
3300014875|Ga0180083_1010280All Organisms → cellular organisms → Bacteria → Proteobacteria1608Open in IMG/M
3300014875|Ga0180083_1116402Not Available589Open in IMG/M
3300014876|Ga0180064_1043453All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300014878|Ga0180065_1108161Not Available637Open in IMG/M
3300014879|Ga0180062_1035504All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b1049Open in IMG/M
3300014880|Ga0180082_1022956All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300014880|Ga0180082_1080040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium722Open in IMG/M
3300014883|Ga0180086_1209391Not Available505Open in IMG/M
3300014885|Ga0180063_1149167All Organisms → cellular organisms → Bacteria → Proteobacteria738Open in IMG/M
3300015248|Ga0180079_1070852Not Available536Open in IMG/M
3300015257|Ga0180067_1009899All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b1655Open in IMG/M
3300018055|Ga0184616_10041615All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. 17-46-581507Open in IMG/M
3300018070|Ga0184631_10222236All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales778Open in IMG/M
3300018083|Ga0184628_10324108All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria809Open in IMG/M
3300018084|Ga0184629_10117492All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b1320Open in IMG/M
3300018084|Ga0184629_10447663All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales677Open in IMG/M
3300021081|Ga0210379_10108967All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1157Open in IMG/M
3300027513|Ga0208685_1070995All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b750Open in IMG/M
3300027513|Ga0208685_1085621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → Micavibrio → Micavibrio aeruginosavorus678Open in IMG/M
3300027513|Ga0208685_1089601Not Available661Open in IMG/M
3300027533|Ga0208185_1038459All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300027533|Ga0208185_1074015All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium807Open in IMG/M
3300027573|Ga0208454_1037531All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13b1131Open in IMG/M
3300027573|Ga0208454_1158188All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria529Open in IMG/M
3300028803|Ga0307281_10270159All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales628Open in IMG/M
3300034147|Ga0364925_0409595Not Available515Open in IMG/M
3300034176|Ga0364931_0035052All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium1483Open in IMG/M
3300034417|Ga0364941_011051All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1696Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil88.43%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.13%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.48%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.83%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300011397Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2EnvironmentalOpen in IMG/M
3300011399Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300011407Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT454_2EnvironmentalOpen in IMG/M
3300011408Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2EnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011424Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2EnvironmentalOpen in IMG/M
3300011425Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012129Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2EnvironmentalOpen in IMG/M
3300012133Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2EnvironmentalOpen in IMG/M
3300012134Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2EnvironmentalOpen in IMG/M
3300012137Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT560_2EnvironmentalOpen in IMG/M
3300012157Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2EnvironmentalOpen in IMG/M
3300012161Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012175Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012227Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2EnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300014861Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10DEnvironmentalOpen in IMG/M
3300014863Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10DEnvironmentalOpen in IMG/M
3300014865Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10DEnvironmentalOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300014868Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10DEnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014871Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1DaEnvironmentalOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300014874Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10DEnvironmentalOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300014876Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10DEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014879Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015248Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10DEnvironmentalOpen in IMG/M
3300015257Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10DEnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018070Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027533Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)EnvironmentalOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1035161843300000891SoilMTPETKLEGKIVRTLAKFLANEKVLIRRWRIVSNAAIVLGSVLWVLAIFAYAQSASASWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDEEQVRLRITEIDNQRSG*
Ga0063356_10105921633300004463Arabidopsis Thaliana RhizosphereMTPDAKLEEKIVRTLAKFLADEQALVRRWRIVGKAAIVLGSILWALAIFAYAQSASASWVFAALSGVGGVCLGLGLWFSTFVTQWPVVRQFIDAELVRQRIIEIDDQRSK*
Ga0063356_10261112923300004463Arabidopsis Thaliana RhizosphereAPIQPGRAARAANSTLSRMTPETKLEGKIVRTLAKFLANEKVLIRRWRIVSNAAIVLGSVLWVLAIFAYAQSASASWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDEEQVRLRITEIDNQRSG*
Ga0105095_1049786223300009053Freshwater SedimentMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASISLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0105259_106987323300009597SoilMSPDAKLEGKIVRTLARLLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIVEIDDQGPK*
Ga0105347_102740833300009609SoilMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0105347_108296013300009609SoilMSPDIKLEEKIVRTLAKFLANDQVLIRRWRIVGQASIFLGSLLWVLAIFAFAQDAGVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRMVEIDNQVTK*
Ga0105347_145005913300009609SoilMSPDAKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK*
Ga0105340_101777143300009610SoilMTPDAKLEEKIVRTLGKFLTNEQVLIRRWRAVGKASIFLGSLLWALAIFAYAQNAGASWIFAVLSGVGGLCLGLGLWFSTFVAQWPVVRQFIDAEQVHQRTIEFDDQGPK*
Ga0105340_105806223300009610SoilMKDEERIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWSAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0105340_107268513300009610SoilMSPDIKLEEKIVRTLAKFLTNEKALVRRWRVVGQASIFLGSLLWVLAIFAYAQDAAVSWIFAALSGVGGLCIGLGLWFSTFVKQWPVVRQFIDAERVRQRIAEIDSQGPK*
Ga0105252_1000935253300009678SoilMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFSYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0105252_1001460643300009678SoilMSPDAKLEAKIVRTLARFLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK*
Ga0105252_1005015523300009678SoilMSPDIKLEEKIVRTLAKFLANDQVLIRRWRIVGQASIFLGSLLWVLAIFAFAQDAGVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRMVEIDNQGPK*
Ga0105252_1006586533300009678SoilMKDEEKIVRTLAKFLADEQELVGRWRVAGKASIFLGALLWTLAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIVEIDDQGPK*
Ga0137444_100920033300011397SoilMSPDAKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137466_102790713300011399SoilMKDEEKIVRTLAKFLADEQVLVGRWRITGKASIFLGAILWVVAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRPFIDAEKVRQRIIEIDDKGSK*
Ga0137356_100515843300011402SoilMKHEEKIVRTLAKFLADEQELVGRWRVAGKASIFLGALLWTLAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDRGSK*
Ga0137340_109077313300011405SoilMSPDIKLEEKIVRTLAKFLANEQVLIRRWRVVGQASIFLGSLLWVLAIFAYAQDAAVSWIFAALSGVGGLCIGLGLWFSTFVKQWPVVRQFIDAERVRQRIAEIDSQGPK*
Ga0137454_101230633300011406SoilMSPDAKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIVEIDDQGPK*
Ga0137454_106522223300011406SoilDEQELVGRWRVVGKASIFLGSLLWVLAFFAYAQDPGASWVVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGPK*
Ga0137450_100320313300011407SoilMSPDIKLEEKIVRTLAKFLANDQVLIRRWRIVGQASIFLGSLLWVLAIFAYAQDAGVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRMVEIDNQAPK*
Ga0137450_105742823300011407SoilMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGALLWTLAIFAYAQSAGASWIVTILSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIVEIDDQGPK*
Ga0137460_106520013300011408SoilMSPEMKHEEKIVRTLAKFLADEQELVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK*
Ga0137333_101391643300011413SoilADEQELVGRWRVAGKASIFLGAILWAAAILAYAQSAGASWIVAVISGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137325_103325423300011415SoilMKDEERIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137325_104010423300011415SoilMTPDAKLEEKIVRTLAKFLANDQVLLRRWRAVGKASIFLGSLLWVLAIFAYAQDAGASWIFAVLSGVGGLCLGLGLWFSTFVAQWPVVRQFIDAEQVRQRTIEFDDQGPK*
Ga0137326_104129913300011417SoilMTPDAKLEEKIVRTLAKFLANDQVLLRRWRAVGKASIFLGSLLWVLAIFAYAQDAGASWIFAVLSGVGGLCLGLGLWFSTFVAQWPVVRQFIDAEQVHQRTIEFDDQGPK*
Ga0137326_116984713300011417SoilKIVRTLARFLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137314_114948113300011420SoilPQAADRPLQTLGRMSPDIKLEEKIVRTLAKFLANDQVLIRRWDAVGKASISLGALLWTLAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDKGSK*
Ga0137462_102283723300011421SoilMSPDIKLEEKIVRTLAKFLTNEKALVRRWRVVGQASIFLGSLLWVLAIFAYAQDAAVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRIVEIDSQGPK*
Ga0137425_100917323300011422SoilMSPDAKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQDPK*
Ga0137436_100878513300011423SoilMSPEMKHEEKIVRTLAKFLADEQELVGRWRVAGKATIFLGSLLWVLAFFAYAQNAGAFWVVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIVEIDDQGPK*
Ga0137439_103214433300011424SoilMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASISLGALLWTLAVFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137439_103635413300011424SoilMSPEMKHEEKIVRTLAKFLADEQELVGRWRVAGKATIFLGSLLWVLAFFAYAQNAGASWVVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEFDDQGPK*
Ga0137441_101697233300011425SoilMSPDMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWVVAIFAYAQSAGASWIVTVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRTIEFDDQGPT*
Ga0137441_106471433300011425SoilMSPDAKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRASEIDDQGPK*
Ga0137448_101126523300011427SoilMSPDMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWVVAIFAYAQSAGASWIVTILSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRTIEFDDQGPT*
Ga0137423_103655223300011430SoilMSPDAKLEGKIVRTLARLLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK*
Ga0137423_106017123300011430SoilMSPDIKLEEKIVRTLAKFLANDQVLIRRWRIVGQASIFLGSLLWVLAIFAFAQDAGVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRMVEIENQVPK*
Ga0137428_105580523300011432SoilMTPDAKLEEKIVRTLAKFLANDQVLLRRWRAVGKASIFLGSLLWVLAIFAYAQDAGASWIFAVLSGVGGLCLGLGLWFSTFVAQWPVVRQFIDAEQVRQRTIEFDGQGPK*
Ga0137428_116378923300011432SoilQLAALRMRRGKTRTLVHMSPDIKLEEKIVRTLAKFLANEQILIRRWRVVGKASIFLGSLLWVLAIFSYAQEAGASWIFAALSGVGGLCLGLGIWFTTFVAQWPVVRQFIDVEQVRRRAIETDDQGPK*
Ga0137428_123896713300011432SoilMKHEEKIVRTLAKFLADEQVLIRRWDAVGKASISLGALLWTLAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDKGSK*
Ga0137443_104426313300011433SoilMSPDMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWVVAIFAYAQSAGASWIVSILSGVGGLCLGLGLWFSTFVTQWPVVRQFI
Ga0137443_116821613300011433SoilMSPDIKLEEKIVRTLAKFLTNEKALVRRWRVVGQASIFLGSLLWVLAIFAYAQDAAVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRMVEI
Ga0137464_102436923300011434SoilMSPDIKLEEKIVRTLAKFLADDKVLIRRWRIVGQASIFLGSLLWVLAIFAFAQDAGVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRMVEIENQVPK*
Ga0137464_104725913300011434SoilMSPDAKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDTEKVRQRIVEFDDQGPK*
Ga0137426_101147943300011435SoilMSPRMKDEEKIVRTLAKFLADEQELVGRWRVAGKASIFLGALLWTLAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDTEKVRQRIVEFDDQGPK*
Ga0137458_102094923300011436SoilMSPDMKHEEKIVRTLAKFLADEQVLVGRWRIAGKASISLGALLWTLAVFAYAQSAGASWIVAVLTGVGGLCLGLGLWFSTFVTQWPVVRPFIDAEKVRQRIIEIDDQGSK*
Ga0137458_102476323300011436SoilMSPDIKLEEKIVRTLAKFLTNEKALVRRWRVVGQASIFLGSLLWVLAIFAFAQDAGVSWIFAALSGVGGLCIGLGLWFSTFVKQWPVVRQFIDAERVRQRIVEIDSLGPK*
Ga0137451_110628413300011438SoilMSPDMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWVVAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGFK*
Ga0137432_108438833300011439SoilMSPDAKLEGKILRTLARLLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK*
Ga0137432_114810523300011439SoilMSGRMSPRMKHEEKIVRTLAKFLANEQVLIRRWRVVGNASIFLGSLLWVLAFFAYAQNAGASWVVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRLIEIDDHGSK*
Ga0137433_113439123300011440SoilMKHEEKIVRTLAKFLADEQELVGRWRVAGKASIFLGALLWTLAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137452_104080823300011441SoilMSPDMKDEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137457_103437023300011443SoilMSPDMKDEEKIVRTLAKFLADEQVLVGRWRVAGKATIFLGALLWTLAIVAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIVEIDDQGPK*
Ga0137457_128627313300011443SoilMSPDTSLEGKIVRTLAKFLANEQILIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQDPK*
Ga0137427_1005165933300011445SoilMSPDAKLEGKIVRTLAKFLANEQILIRRWRVVGKASIFLGSLLWVLAIFSYAQEAGASWIFAALSGVGGLCLGLGIWFTTFVAQWPVVRQFIDVEQVRRRAIEIDDQGPK*
Ga0137427_1019105413300011445SoilMKHEEKIVRTLAKFLADEQVLVGRWCVAGKALIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137427_1046686623300011445SoilMSPRMKDEEKIVRTLAKFLADEQELVGRWRVAGKASIFLGALLWTLAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFI
Ga0137453_112156423300012034SoilMSPDAKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQR
Ga0137445_106460823300012035SoilMSPRMKDEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAILAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIVEIDDQGPK*
Ga0137445_112288113300012035SoilMSPDAKLEGRIVRTLARLLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK*
Ga0137421_103814433300012039SoilMSPRMKDEEKIVRTLAKFLADEQELVGRWRVAGKASIFLGALLWTLAIFAYAQSAGASWIVAVLSGVGCLCLGLGLWFSTFVTQWPVVRQFIDAE
Ga0137421_112121713300012039SoilIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWVVAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDKGSK*
Ga0137461_107643713300012040SoilMSPDMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWVVAIFAYAQSAGASWIVAVISGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRTIEFDDQGPT*
Ga0137430_107466223300012041SoilMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFSYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDTEKVRQRIVEFDDQGPK*
Ga0137345_105570713300012129SoilMSPDMKDEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIAAILSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDEQGPK*
Ga0137329_103770323300012133SoilMSPDMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAILAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137330_103418823300012134SoilRTLAKFLANDQVLIRRWRIVGQASIFLGSLLWVLAIFAFAQDAGVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRMVEIENQVPK*
Ga0137346_105814913300012137SoilMSPDAKLEAKIVRTLARFLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEI
Ga0137346_106338813300012137SoilIAAARRWAWTLGRLRPDMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFSYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRTIEFDDQGPT*
Ga0137353_104386133300012157SoilMSPDAKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIVAEKVRQRAIEIDDQGPK*
Ga0137336_101810023300012161SoilMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWVVAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137336_107695623300012161SoilMSPDAKLEGKIVRTLARFLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQDPK*
Ga0137342_113962213300012171SoilMNHEEKIVRTLAKFLADEQVLVGRWRVVGKALIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137321_103992923300012175SoilMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFSYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDKGSK*
Ga0137334_108203113300012179SoilDAKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACARWGFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK*
Ga0137334_116403113300012179SoilEEKIVRTLAKFLADDKVLIRRWRMVGQASIFLGSLLWVLAIFAYAQDAGMSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQLIDAERVRQRMVEIENQVPK*
Ga0137434_102807113300012225SoilMKHEEKIVRTLAKFLADEQELVGRWRVAGKATIFLGSLLWVLAFFAYAQNAGASWVVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIVEIDDQGPK*
Ga0137447_101514623300012226SoilMSPEMKHEEKIVRTLAKFLADEQELVGRWRVAGKATIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIVEIDDQGPK*
Ga0137449_112095813300012227SoilQVLVGRWRVAGKASMFLGALLWTLAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0137459_106639313300012228SoilMSPDTSLEGKIVRTLAKFLANEQILIRRWRVVGKASIFLGSLLWALALFAYAQDASACWVFAALCGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEQVRQRAIEIDDQGSK*
Ga0137459_106965113300012228SoilLAKFLANDQVLIRRWRIVGQASIFLGSLLWVLAIFAFAQDAGVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRIIEIDSQGPK*
Ga0180061_106628413300014861SoilMSPRMKDEEKIVRTLAKFLADEQELVGRWRVAGKASIFLGAILWVVAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGFK*
Ga0180060_103213113300014863SoilAKLEGKIVRTLARLLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK*
Ga0180078_105416513300014865SoilMSPDAKLEGKIVRTLARLLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK*
Ga0180090_109363613300014866SoilMKHEEKIVRTLAKFLADEHVLVGRWRVAGKASIFLGAILRAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGFK*
Ga0180088_105952213300014868SoilMSGRMSPRMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0180080_103586923300014870SoilMSPDAKLEGKIVRTLARLLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNASAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK*
Ga0180095_101417323300014871SoilMKHEEKIVRTLAKFLADERVLVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDD*
Ga0180087_102463423300014872SoilMSPDAKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNASAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRASEIDDQGPK*
Ga0180084_102017833300014874SoilMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGALLWTSAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0180083_101028033300014875SoilMSPAIQLEEKIVRTLAKFLTNEKALVRRWRVVGQASIFLGSLLWVLAIFAYAQDAAVSWIFAALSGVGGLCIGLGLWFSTFVKQWPVVRQFIDAERVRQRIAEIDSQGPK*
Ga0180083_111640223300014875SoilEERIVRTLAKFMADEQVRVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0180064_104345313300014876SoilLQLAALRMRRGKTRTLVHMSPDIKLEEKIVRTLAKFLANEQVLIRRWRVVGQASIFLGSLLWVLAIFAYAQDAGVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRIVEIDSQDPK*
Ga0180065_110816123300014878SoilMSPDMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWVVAIFAYAQSAGASWIVSILSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0180062_103550423300014879SoilMSPRMKDEEKIVRTLAKFLADEQELVGRWRVAGKASIFLGALLWTLAIFSYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQR
Ga0180082_102295643300014880SoilVDRTGKSGPPFTTTLGRMSPDAKLEGKIVRTLARLLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK*
Ga0180082_108004013300014880SoilMSPRMKDEEKIVRTLAKFLADEQELVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0180086_120939113300014883SoilMSPRMKDEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAILAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQHIIEIDDQGPK*
Ga0180063_114916723300014885SoilMKHEEKIVRTLAKFLANEQVLIRRWGAVGKVSISLGALLWTLAIFAYAQSAGASWIVAVLSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRMVEIENQVPK*
Ga0180079_107085213300015248SoilMNTDMKLEAKIVRTLAKFLANEQVLTRRWRVVGNASIFLGSLLWVLAFFAYAQNAGASWVVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK*
Ga0180067_100989933300015257SoilMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDTEKVRQRIVEFDDQGPK*
Ga0184616_1004161513300018055Groundwater SedimentLEEKIVRTLAKFLTNEKALVRRWRVVGQASIFLGSLLWVLAIFAYAQDAAVSWIFAALSGVGGLCIGLGLWFSTFVKQWPVVRQFIDAERVRQRIAEIDSQGPK
Ga0184631_1022223623300018070Groundwater SedimentMSPDIKLEEKIVRTLAKFLTNEKALVRRWRVVGQASIFLGSLLWVLAIFAYAQDAAVSWIFAALSGVGGLCIGLGLWFSTFVKQWPVVRQFIDAERVRQRIAEIDSQGPK
Ga0184628_1032410823300018083Groundwater SedimentMSPDAKLEGKIVRTLARFLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIVEIDDQGPK
Ga0184629_1011749223300018084Groundwater SedimentMKDEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWVVAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRTIEFDDQGPT
Ga0184629_1044766323300018084Groundwater SedimentMSPDIKLEEKIVRTLAKFLTNEKALVRRWRVVGQASIFLGSLLWVLAIFAYAQDAAVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRIVEIDSLGPK
Ga0210379_1010896723300021081Groundwater SedimentMSPDMKHEEKIVRTLAKFLADEQVLVGRWRVAGKATIFLGSLLWVLAFFAYAQNAGAFWVVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIVEIDDQGPK
Ga0208685_107099523300027513SoilMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDKGSK
Ga0208685_108562113300027513SoilKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK
Ga0208685_108960123300027513SoilMSPDIKLEEKIVRTLAKFLANDQVLIRRWRIVGQASIFLGSLLWVLAIFAFAQDAGVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQR
Ga0208185_103845933300027533SoilMTPDAKLEEKIVRTLGKFLTNEQVLIRRWRAVGKASIFLGSLLWALAIFAYAQNAGASWIFAVLSGVGGLCLGLGLWFSTFVAQWPVVRQFIDAEQVHQRTIEFDDQGPK
Ga0208185_107401513300027533SoilMKDEERIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWSAAIFAYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK
Ga0208454_103753123300027573SoilMKHEEKIVRTLAKFLADEQVLVGRWRVAGKASIFLGAILWAAAIFSYAQSAGASWIVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRIIEIDDQGSK
Ga0208454_115818813300027573SoilGDAQPFSRADRPQAADRPLQTLGRMSPDIKLEEKIVRTLAKFLANDQVLIRRWRIVGQASIFLGSLLWVLAIFAFAQDAGVSWIFAALSGVGGLCIGLGLWFSTFVTQWPVVRQFIDAERVRQRMVEIDNQGPK
Ga0307281_1027015923300028803SoilMSPDIKLEEKIVRTLAKFLTNEKALVRRWRVVGQASIFLGSLLWVLAIFAYAQDAAVSWIFAALSGVGGLCIGLGLWFSTFVKQWPVVRQFIDAERVRQRIAE
Ga0364925_0409595_141_4733300034147SedimentMSPDAKLEGKIVRTLARFLVNEQVLIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRAIEIDDQGPK
Ga0364931_0035052_808_11403300034176SedimentMNTDMKLEAKIVRTLAKFLANEQVLIRRWRVVGNALIFLGSLLWVLAFFAYAQNAGASWVVAVLSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRTIEIDDQGPK
Ga0364941_011051_534_8663300034417SedimentMSPDIKREEKIVRTLAKFLTNEKALVRRWRVVGQASIFLGSLLWVLAIFAYAQDAAVSWIFAALSGVGGLCIGLGLWFSTFVKQWPVVRQFIDAERVRQRIAEIDSQGPK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.